Loading...
HomeMy WebLinkAbout05-13-19-RAPPROVAL OF AGENDA PUBLIC INQUIRIES/INFORMATIONAL This is an opportunity for citizens to bring to the Council ’s attention any items not currently on the agenda which are relevant to the City. In addressing the Council, you must first state your name and address for the record. To allow adequate time for each person wishing to address the Council, speakers must limit their comments to three (3) minutes. Written documents may be distributed to the Council prior to the meeting to allow a more timely presentation. Speakers should not use obscene, profane, or threatening language, or make personal attacks. The Council may not respond to speaker comments, engage in a debate, or take any action on the issues raised by citizens, but may direct City staff to research or follow up on an issue, if desired by Council. If Council directs further review by staff, the results of that review will be presented at a following regular Council meeting. RESPONSE TO PUBLIC INQUIRIES PRESENTATION 2018 Financial Statements Aaron Nielsen / MMKR MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF ATTACHMENT C.PDF STAFF COMMENTS Rice Creek Commons (TCAAP) And Joint Development Authority (JDA) Update Dave Perrault, City Administrator MEMO.PDF Transportation Update Sue Polka, Interim Public Works Director/City Engineer MEMO.PDF Clean Up Day Update Mike Mrosla, City Planner MEMO.PDF APPROVAL OF MINUTES April 15, 2019 City Council Work Session 04 -15 -19 -WS.PDF April 15, 2019 Special Regular City Council 04 -15 -19 -SR.PDF April 22, 2019 Regular City Council 04 -22 -19 -R.PDF CONSENT CALENDAR Those items listed under the Consent Calendar are considered to be routine by the City Council and will be enacted by one motion under a Consent Calendar format. There will be no separate discussion of these items, unless a Councilmember so requests, in which event, the item will be removed from the general order of business and considered separately in its normal sequence on the agenda. Motion To Approve Claims And Payroll Gayle Bauman, Finance Director Pang Silseth, Accounting Analyst MEMO.PDF Motion To Approve 2018 City Financial Statements And Audit Gayle Bauman, Finance Director MEMO.PDF Motion To Approve Requests For Ramsey County Sheriff’s Department Expenditures Dave Perrault, City Administrator MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF ATTACHMENT C.PDF Motion To Approve Ramsey County Joint Powers Agreement For Recycling Funding Mike Mrosla, City Planner MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF Motion To Approve Resolution 2019 -016 Accepting A Donation From The Arden Hills Foundation Sara Knoll, Recreation Coordinator MEMO.PDF ATTACHMENT A.PDF Motion To Authorize State Of Minnesota Institution Community Work Crew (ICWC) Program Contract Sue Polka, Interim Public Works Director/City Engineer MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF Motion To Approve Payment No. 8 –Northwest Asphalt, Inc. –2018 Street And Utility Improvements Project Sue Polka, Public Works Director/City Engineer MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF Motion To Authorize Professional Services Agreement -AE2S -Water Model Update Sue Polka, Interim Public Works Director/City Engineer MEMO.PDF ATTACHMENT A.PDF Motion To Approve Payment No. 1 And Change Order No. 1 –Odessa II – Cummings Park Playground Redevelopment Project Sue Polka, Interim Public Works Director/City Engineer MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF Motion To Authorize Professional Services Agreement For Geotechnical Evaluation, Design And Construction –WSB & Associates -Royal Hills Park, Hazelnut Park And Cummings Park Tennis And Basketball Courts Improvements Sue Polka, Interim Public Works Director/City Engineer MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF Motion To Cancel May 28, 2019 Regular City Council Meeting Julie Hanson, City Clerk MEMO.PDF Motion To Approve Proposal For TCAAP Final AUAR And Final Mitigation Plan – Kimley -Horn Dave Perrault, City Administrator MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF PULLED CONSENT ITEMS Those items that are pulled from the Consent Calendar will be removed from the general order of business and considered separately in its normal sequence on the agenda. PUBLIC HEARINGS PC 18 -014 Mounds View High School Addition –Comp Plan Amendment And Master And Final Planned Unit Development Mike Mrosla, City Planner Jane Kansier, Planning Consultant MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF ATTACHMENT C.PDF ATTACHMENT D.PDF ATTACHMENT E.PDF ATTACHMENT F.PDF NEW BUSINESS PC 18 -014 Mounds View High School Addition –Comp Plan Amendment And Master And Final Planned Unit Development •Resolution 2019 -018 Authorizing the Submittal of the Comprehensive Plan Amendment for Mounds View School Disrict at 1901 Lake Valentine Road to the Metropolitan Council for Review Mike Mrosla, City Planner Jane Kansier, Planning Consultant MEMO.PDF ATTACHMENT A.PDF UNFINISHED BUSINESS COUNCIL COMMENTS ADJOURN Mayor: David Grant Councilmembers: Brenda Holden Fran Holmes Dave McClung Steve Scott Regular City Council Agenda May 13, 2019 7:00 p.m. City Hall Address: 1245 W Highway 96 Arden Hills MN 55112 Phone: 651 -792 -7800 Website : www.cityofardenhills.org City Vision Arden Hills is a strong community that values its unique environmental setting, strong residential neighborhoods, vital business community, well -maintained infrastructure, fiscal soundness, and our long -standing tradition as a desirable City in which to live, work, and play. CALL TO ORDER 1. 2. 3. 4. 4.A. Documents: 5. 5.A. Documents: 5.B. Documents: 5.C. Documents: 6. 6.A. Documents: 6.B. Documents: 6.C. Documents: 7. 7.A. Documents: 7.B. Documents: 7.C. Documents: 7.D. Documents: 7.E. Documents: 7.F. Documents: 7.G. Documents: 7.H. Documents: 7.I. Documents: 7.J. Documents: 7.K. Documents: 7.L. Documents: 8. 9. 9.A. Documents: 10. 10.A. Documents: 11. 12. APPROVAL OF AGENDAPUBLIC INQUIRIES/INFORMATIONALThis is an opportunity for citizens to bring to the Council ’s attention any items not currently on the agenda which are relevant to the City. In addressing the Council, you must first state your name and address for the record. To allow adequate time for each person wishing to address the Council, speakers must limit their comments to three (3) minutes. Written documents may be distributed to the Council prior to the meeting to allow a more timely presentation. Speakers should not use obscene, profane, or threatening language, or make personal attacks. The Council may not respond to speaker comments, engage in a debate, or take any action on the issues raised by citizens, but may direct City staff to research or follow up on an issue, if desired by Council. If Council directs further review by staff, the results of that review will be presented at a following regular Council meeting.RESPONSE TO PUBLIC INQUIRIESPRESENTATION2018 Financial StatementsAaron Nielsen / MMKR MEMO.PDFATTACHMENT A.PDFATTACHMENT B.PDFATTACHMENT C.PDFSTAFF COMMENTS Rice Creek Commons (TCAAP) And Joint Development Authority (JDA) Update Dave Perrault, City Administrator MEMO.PDF Transportation Update Sue Polka, Interim Public Works Director/City Engineer MEMO.PDF Clean Up Day Update Mike Mrosla, City Planner MEMO.PDF APPROVAL OF MINUTES April 15, 2019 City Council Work Session 04 -15 -19 -WS.PDF April 15, 2019 Special Regular City Council 04 -15 -19 -SR.PDF April 22, 2019 Regular City Council 04 -22 -19 -R.PDF CONSENT CALENDAR Those items listed under the Consent Calendar are considered to be routine by the City Council and will be enacted by one motion under a Consent Calendar format. There will be no separate discussion of these items, unless a Councilmember so requests, in which event, the item will be removed from the general order of business and considered separately in its normal sequence on the agenda. Motion To Approve Claims And Payroll Gayle Bauman, Finance Director Pang Silseth, Accounting Analyst MEMO.PDF Motion To Approve 2018 City Financial Statements And Audit Gayle Bauman, Finance Director MEMO.PDF Motion To Approve Requests For Ramsey County Sheriff’s Department Expenditures Dave Perrault, City Administrator MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF ATTACHMENT C.PDF Motion To Approve Ramsey County Joint Powers Agreement For Recycling Funding Mike Mrosla, City Planner MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF Motion To Approve Resolution 2019 -016 Accepting A Donation From The Arden Hills Foundation Sara Knoll, Recreation Coordinator MEMO.PDF ATTACHMENT A.PDF Motion To Authorize State Of Minnesota Institution Community Work Crew (ICWC) Program Contract Sue Polka, Interim Public Works Director/City Engineer MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF Motion To Approve Payment No. 8 –Northwest Asphalt, Inc. –2018 Street And Utility Improvements Project Sue Polka, Public Works Director/City Engineer MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF Motion To Authorize Professional Services Agreement -AE2S -Water Model Update Sue Polka, Interim Public Works Director/City Engineer MEMO.PDF ATTACHMENT A.PDF Motion To Approve Payment No. 1 And Change Order No. 1 –Odessa II – Cummings Park Playground Redevelopment Project Sue Polka, Interim Public Works Director/City Engineer MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF Motion To Authorize Professional Services Agreement For Geotechnical Evaluation, Design And Construction –WSB & Associates -Royal Hills Park, Hazelnut Park And Cummings Park Tennis And Basketball Courts Improvements Sue Polka, Interim Public Works Director/City Engineer MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF Motion To Cancel May 28, 2019 Regular City Council Meeting Julie Hanson, City Clerk MEMO.PDF Motion To Approve Proposal For TCAAP Final AUAR And Final Mitigation Plan – Kimley -Horn Dave Perrault, City Administrator MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF PULLED CONSENT ITEMS Those items that are pulled from the Consent Calendar will be removed from the general order of business and considered separately in its normal sequence on the agenda. PUBLIC HEARINGS PC 18 -014 Mounds View High School Addition –Comp Plan Amendment And Master And Final Planned Unit Development Mike Mrosla, City Planner Jane Kansier, Planning Consultant MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF ATTACHMENT C.PDF ATTACHMENT D.PDF ATTACHMENT E.PDF ATTACHMENT F.PDF NEW BUSINESS PC 18 -014 Mounds View High School Addition –Comp Plan Amendment And Master And Final Planned Unit Development •Resolution 2019 -018 Authorizing the Submittal of the Comprehensive Plan Amendment for Mounds View School Disrict at 1901 Lake Valentine Road to the Metropolitan Council for Review Mike Mrosla, City Planner Jane Kansier, Planning Consultant MEMO.PDF ATTACHMENT A.PDF UNFINISHED BUSINESS COUNCIL COMMENTS ADJOURN Mayor:David Grant Councilmembers:Brenda Holden Fran HolmesDave McClungSteve Scott Regular City Council AgendaMay 13, 2019 7:00 p.m. City Hall Address:1245 W Highway 96 Arden Hills MN 55112 Phone:651 -792 -7800 Website : www.cityofardenhills.org City VisionArden Hills is a strong community that values its unique environmental setting, strong residential neighborhoods, vital business community, well -maintained infrastructure, fiscal soundness, and our long -standing tradition as a desirable City in which to live, work, and play.CALL TO ORDER1.2.3.4.4.A.Documents:5. 5.A. Documents: 5.B. Documents: 5.C. Documents: 6. 6.A. Documents: 6.B. Documents: 6.C. Documents: 7. 7.A. Documents: 7.B. Documents: 7.C. Documents: 7.D. Documents: 7.E. Documents: 7.F. Documents: 7.G. Documents: 7.H. Documents: 7.I. Documents: 7.J. Documents: 7.K. Documents: 7.L. Documents: 8. 9. 9.A. Documents: 10. 10.A. Documents: 11. 12. APPROVAL OF AGENDAPUBLIC INQUIRIES/INFORMATIONALThis is an opportunity for citizens to bring to the Council ’s attention any items not currently on the agenda which are relevant to the City. In addressing the Council, you must first state your name and address for the record. To allow adequate time for each person wishing to address the Council, speakers must limit their comments to three (3) minutes. Written documents may be distributed to the Council prior to the meeting to allow a more timely presentation. Speakers should not use obscene, profane, or threatening language, or make personal attacks. The Council may not respond to speaker comments, engage in a debate, or take any action on the issues raised by citizens, but may direct City staff to research or follow up on an issue, if desired by Council. If Council directs further review by staff, the results of that review will be presented at a following regular Council meeting.RESPONSE TO PUBLIC INQUIRIESPRESENTATION2018 Financial StatementsAaron Nielsen / MMKR MEMO.PDFATTACHMENT A.PDFATTACHMENT B.PDFATTACHMENT C.PDFSTAFF COMMENTSRice Creek Commons (TCAAP) And Joint Development Authority (JDA) UpdateDave Perrault, City Administrator MEMO.PDFTransportation UpdateSue Polka, Interim Public Works Director/City Engineer MEMO.PDFClean Up Day UpdateMike Mrosla, City Planner MEMO.PDFAPPROVAL OF MINUTESApril 15, 2019 City Council Work Session04-15 -19 -WS.PDFApril 15, 2019 Special Regular City Council04-15 -19 -SR.PDFApril 22, 2019 Regular City Council04-22 -19 -R.PDFCONSENT CALENDARThose items listed under the Consent Calendar are considered to be routine by the City Council and will be enacted by one motion under a Consent Calendar format. There will be no separate discussion of these items, unless a Councilmember so requests, in which event, the item will be removed from the general order of business and considered separately in its normal sequence on the agenda.Motion To Approve Claims And PayrollGayle Bauman, Finance DirectorPang Silseth, Accounting Analyst MEMO.PDF Motion To Approve 2018 City Financial Statements And Audit Gayle Bauman, Finance Director MEMO.PDF Motion To Approve Requests For Ramsey County Sheriff’s Department Expenditures Dave Perrault, City Administrator MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF ATTACHMENT C.PDF Motion To Approve Ramsey County Joint Powers Agreement For Recycling Funding Mike Mrosla, City Planner MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF Motion To Approve Resolution 2019 -016 Accepting A Donation From The Arden Hills Foundation Sara Knoll, Recreation Coordinator MEMO.PDF ATTACHMENT A.PDF Motion To Authorize State Of Minnesota Institution Community Work Crew (ICWC) Program Contract Sue Polka, Interim Public Works Director/City Engineer MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF Motion To Approve Payment No. 8 –Northwest Asphalt, Inc. –2018 Street And Utility Improvements Project Sue Polka, Public Works Director/City Engineer MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF Motion To Authorize Professional Services Agreement -AE2S -Water Model Update Sue Polka, Interim Public Works Director/City Engineer MEMO.PDF ATTACHMENT A.PDF Motion To Approve Payment No. 1 And Change Order No. 1 –Odessa II – Cummings Park Playground Redevelopment Project Sue Polka, Interim Public Works Director/City Engineer MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF Motion To Authorize Professional Services Agreement For Geotechnical Evaluation, Design And Construction –WSB & Associates -Royal Hills Park, Hazelnut Park And Cummings Park Tennis And Basketball Courts Improvements Sue Polka, Interim Public Works Director/City Engineer MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF Motion To Cancel May 28, 2019 Regular City Council Meeting Julie Hanson, City Clerk MEMO.PDF Motion To Approve Proposal For TCAAP Final AUAR And Final Mitigation Plan – Kimley -Horn Dave Perrault, City Administrator MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF PULLED CONSENT ITEMS Those items that are pulled from the Consent Calendar will be removed from the general order of business and considered separately in its normal sequence on the agenda. PUBLIC HEARINGS PC 18 -014 Mounds View High School Addition –Comp Plan Amendment And Master And Final Planned Unit Development Mike Mrosla, City Planner Jane Kansier, Planning Consultant MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF ATTACHMENT C.PDF ATTACHMENT D.PDF ATTACHMENT E.PDF ATTACHMENT F.PDF NEW BUSINESS PC 18 -014 Mounds View High School Addition –Comp Plan Amendment And Master And Final Planned Unit Development •Resolution 2019 -018 Authorizing the Submittal of the Comprehensive Plan Amendment for Mounds View School Disrict at 1901 Lake Valentine Road to the Metropolitan Council for Review Mike Mrosla, City Planner Jane Kansier, Planning Consultant MEMO.PDF ATTACHMENT A.PDF UNFINISHED BUSINESS COUNCIL COMMENTS ADJOURN Mayor:David Grant Councilmembers:Brenda Holden Fran HolmesDave McClungSteve Scott Regular City Council AgendaMay 13, 2019 7:00 p.m. City Hall Address:1245 W Highway 96 Arden Hills MN 55112 Phone:651 -792 -7800 Website : www.cityofardenhills.org City VisionArden Hills is a strong community that values its unique environmental setting, strong residential neighborhoods, vital business community, well -maintained infrastructure, fiscal soundness, and our long -standing tradition as a desirable City in which to live, work, and play.CALL TO ORDER1.2.3.4.4.A.Documents:5.5.A.Documents:5.B.Documents:5.C.Documents:6.6.A.Documents:6.B.Documents:6.C.Documents:7.7.A. Documents: 7.B. Documents: 7.C. Documents: 7.D. Documents: 7.E. Documents: 7.F. Documents: 7.G. Documents: 7.H. Documents: 7.I. Documents: 7.J. Documents: 7.K. Documents: 7.L. Documents: 8. 9. 9.A. Documents: 10. 10.A. Documents: 11. 12. APPROVAL OF AGENDAPUBLIC INQUIRIES/INFORMATIONALThis is an opportunity for citizens to bring to the Council ’s attention any items not currently on the agenda which are relevant to the City. In addressing the Council, you must first state your name and address for the record. To allow adequate time for each person wishing to address the Council, speakers must limit their comments to three (3) minutes. Written documents may be distributed to the Council prior to the meeting to allow a more timely presentation. Speakers should not use obscene, profane, or threatening language, or make personal attacks. The Council may not respond to speaker comments, engage in a debate, or take any action on the issues raised by citizens, but may direct City staff to research or follow up on an issue, if desired by Council. If Council directs further review by staff, the results of that review will be presented at a following regular Council meeting.RESPONSE TO PUBLIC INQUIRIESPRESENTATION2018 Financial StatementsAaron Nielsen / MMKR MEMO.PDFATTACHMENT A.PDFATTACHMENT B.PDFATTACHMENT C.PDFSTAFF COMMENTSRice Creek Commons (TCAAP) And Joint Development Authority (JDA) UpdateDave Perrault, City Administrator MEMO.PDFTransportation UpdateSue Polka, Interim Public Works Director/City Engineer MEMO.PDFClean Up Day UpdateMike Mrosla, City Planner MEMO.PDFAPPROVAL OF MINUTESApril 15, 2019 City Council Work Session04-15 -19 -WS.PDFApril 15, 2019 Special Regular City Council04-15 -19 -SR.PDFApril 22, 2019 Regular City Council04-22 -19 -R.PDFCONSENT CALENDARThose items listed under the Consent Calendar are considered to be routine by the City Council and will be enacted by one motion under a Consent Calendar format. There will be no separate discussion of these items, unless a Councilmember so requests, in which event, the item will be removed from the general order of business and considered separately in its normal sequence on the agenda.Motion To Approve Claims And PayrollGayle Bauman, Finance DirectorPang Silseth, Accounting Analyst MEMO.PDFMotion To Approve 2018 City Financial Statements And Audit Gayle Bauman, Finance Director MEMO.PDFMotion To Approve Requests For Ramsey County Sheriff’s Department ExpendituresDave Perrault, City Administrator MEMO.PDFATTACHMENT A.PDFATTACHMENT B.PDFATTACHMENT C.PDFMotion To Approve Ramsey County Joint Powers Agreement For Recycling FundingMike Mrosla, City Planner MEMO.PDFATTACHMENT A.PDFATTACHMENT B.PDFMotion To Approve Resolution 2019 -016 Accepting A Donation From The Arden Hills FoundationSara Knoll,Recreation Coordinator MEMO.PDFATTACHMENT A.PDFMotion To Authorize State Of Minnesota Institution Community Work Crew (ICWC) Program ContractSue Polka, Interim Public Works Director/City Engineer MEMO.PDFATTACHMENT A.PDFATTACHMENT B.PDF Motion To Approve Payment No. 8 –Northwest Asphalt, Inc. –2018 Street And Utility Improvements Project Sue Polka, Public Works Director/City Engineer MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF Motion To Authorize Professional Services Agreement -AE2S -Water Model Update Sue Polka, Interim Public Works Director/City Engineer MEMO.PDF ATTACHMENT A.PDF Motion To Approve Payment No. 1 And Change Order No. 1 –Odessa II – Cummings Park Playground Redevelopment Project Sue Polka, Interim Public Works Director/City Engineer MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF Motion To Authorize Professional Services Agreement For Geotechnical Evaluation, Design And Construction –WSB & Associates -Royal Hills Park, Hazelnut Park And Cummings Park Tennis And Basketball Courts Improvements Sue Polka, Interim Public Works Director/City Engineer MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF Motion To Cancel May 28, 2019 Regular City Council Meeting Julie Hanson, City Clerk MEMO.PDF Motion To Approve Proposal For TCAAP Final AUAR And Final Mitigation Plan – Kimley -Horn Dave Perrault, City Administrator MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF PULLED CONSENT ITEMS Those items that are pulled from the Consent Calendar will be removed from the general order of business and considered separately in its normal sequence on the agenda. PUBLIC HEARINGS PC 18 -014 Mounds View High School Addition –Comp Plan Amendment And Master And Final Planned Unit Development Mike Mrosla, City Planner Jane Kansier, Planning Consultant MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF ATTACHMENT C.PDF ATTACHMENT D.PDF ATTACHMENT E.PDF ATTACHMENT F.PDF NEW BUSINESS PC 18 -014 Mounds View High School Addition –Comp Plan Amendment And Master And Final Planned Unit Development •Resolution 2019 -018 Authorizing the Submittal of the Comprehensive Plan Amendment for Mounds View School Disrict at 1901 Lake Valentine Road to the Metropolitan Council for Review Mike Mrosla, City Planner Jane Kansier, Planning Consultant MEMO.PDF ATTACHMENT A.PDF UNFINISHED BUSINESS COUNCIL COMMENTS ADJOURN Mayor:David Grant Councilmembers:Brenda Holden Fran HolmesDave McClungSteve Scott Regular City Council AgendaMay 13, 2019 7:00 p.m. City Hall Address:1245 W Highway 96 Arden Hills MN 55112 Phone:651 -792 -7800 Website : www.cityofardenhills.org City VisionArden Hills is a strong community that values its unique environmental setting, strong residential neighborhoods, vital business community, well -maintained infrastructure, fiscal soundness, and our long -standing tradition as a desirable City in which to live, work, and play.CALL TO ORDER1.2.3.4.4.A.Documents:5.5.A.Documents:5.B.Documents:5.C.Documents:6.6.A.Documents:6.B.Documents:6.C.Documents:7.7.A.Documents:7.B.Documents:7.C.Documents:7.D.Documents:7.E.Documents:7.F.Documents: 7.G. Documents: 7.H. Documents: 7.I. Documents: 7.J. Documents: 7.K. Documents: 7.L. Documents: 8. 9. 9.A. Documents: 10. 10.A. Documents: 11. 12. APPROVAL OF AGENDAPUBLIC INQUIRIES/INFORMATIONALThis is an opportunity for citizens to bring to the Council ’s attention any items not currently on the agenda which are relevant to the City. In addressing the Council, you must first state your name and address for the record. To allow adequate time for each person wishing to address the Council, speakers must limit their comments to three (3) minutes. Written documents may be distributed to the Council prior to the meeting to allow a more timely presentation. Speakers should not use obscene, profane, or threatening language, or make personal attacks. The Council may not respond to speaker comments, engage in a debate, or take any action on the issues raised by citizens, but may direct City staff to research or follow up on an issue, if desired by Council. If Council directs further review by staff, the results of that review will be presented at a following regular Council meeting.RESPONSE TO PUBLIC INQUIRIESPRESENTATION2018 Financial StatementsAaron Nielsen / MMKR MEMO.PDFATTACHMENT A.PDFATTACHMENT B.PDFATTACHMENT C.PDFSTAFF COMMENTSRice Creek Commons (TCAAP) And Joint Development Authority (JDA) UpdateDave Perrault, City Administrator MEMO.PDFTransportation UpdateSue Polka, Interim Public Works Director/City Engineer MEMO.PDFClean Up Day UpdateMike Mrosla, City Planner MEMO.PDFAPPROVAL OF MINUTESApril 15, 2019 City Council Work Session04-15 -19 -WS.PDFApril 15, 2019 Special Regular City Council04-15 -19 -SR.PDFApril 22, 2019 Regular City Council04-22 -19 -R.PDFCONSENT CALENDARThose items listed under the Consent Calendar are considered to be routine by the City Council and will be enacted by one motion under a Consent Calendar format. There will be no separate discussion of these items, unless a Councilmember so requests, in which event, the item will be removed from the general order of business and considered separately in its normal sequence on the agenda.Motion To Approve Claims And PayrollGayle Bauman, Finance DirectorPang Silseth, Accounting Analyst MEMO.PDFMotion To Approve 2018 City Financial Statements And Audit Gayle Bauman, Finance Director MEMO.PDFMotion To Approve Requests For Ramsey County Sheriff’s Department ExpendituresDave Perrault, City Administrator MEMO.PDFATTACHMENT A.PDFATTACHMENT B.PDFATTACHMENT C.PDFMotion To Approve Ramsey County Joint Powers Agreement For Recycling FundingMike Mrosla, City Planner MEMO.PDFATTACHMENT A.PDFATTACHMENT B.PDFMotion To Approve Resolution 2019 -016 Accepting A Donation From The Arden Hills FoundationSara Knoll,Recreation Coordinator MEMO.PDFATTACHMENT A.PDFMotion To Authorize State Of Minnesota Institution Community Work Crew (ICWC) Program ContractSue Polka, Interim Public Works Director/City Engineer MEMO.PDFATTACHMENT A.PDFATTACHMENT B.PDFMotion To Approve Payment No. 8 –Northwest Asphalt, Inc. –2018 Street And Utility Improvements ProjectSue Polka, Public Works Director/City Engineer MEMO.PDFATTACHMENT A.PDFATTACHMENT B.PDFMotion To Authorize Professional Services Agreement -AE2S -Water Model UpdateSue Polka, Interim Public Works Director/City Engineer MEMO.PDFATTACHMENT A.PDFMotion To Approve Payment No. 1 And Change Order No. 1 –Odessa II –Cummings Park Playground Redevelopment ProjectSue Polka, Interim Public Works Director/City Engineer MEMO.PDFATTACHMENT A.PDFATTACHMENT B.PDFMotion To Authorize Professional Services Agreement For Geotechnical Evaluation, Design And Construction –WSB & Associates -Royal Hills Park, Hazelnut Park And Cummings Park Tennis And Basketball Courts ImprovementsSue Polka, Interim Public Works Director/City Engineer MEMO.PDFATTACHMENT A.PDFATTACHMENT B.PDFMotion To Cancel May 28, 2019 Regular City Council MeetingJulie Hanson, City Clerk MEMO.PDFMotion To Approve Proposal For TCAAP Final AUAR And Final Mitigation Plan –Kimley -Horn Dave Perrault, City Administrator MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF PULLED CONSENT ITEMS Those items that are pulled from the Consent Calendar will be removed from the general order of business and considered separately in its normal sequence on the agenda. PUBLIC HEARINGS PC 18 -014 Mounds View High School Addition –Comp Plan Amendment And Master And Final Planned Unit Development Mike Mrosla, City Planner Jane Kansier, Planning Consultant MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF ATTACHMENT C.PDF ATTACHMENT D.PDF ATTACHMENT E.PDF ATTACHMENT F.PDF NEW BUSINESS PC 18 -014 Mounds View High School Addition –Comp Plan Amendment And Master And Final Planned Unit Development •Resolution 2019 -018 Authorizing the Submittal of the Comprehensive Plan Amendment for Mounds View School Disrict at 1901 Lake Valentine Road to the Metropolitan Council for Review Mike Mrosla, City Planner Jane Kansier, Planning Consultant MEMO.PDF ATTACHMENT A.PDF UNFINISHED BUSINESS COUNCIL COMMENTS ADJOURN Mayor:David Grant Councilmembers:Brenda Holden Fran HolmesDave McClungSteve Scott Regular City Council AgendaMay 13, 2019 7:00 p.m. City Hall Address:1245 W Highway 96 Arden Hills MN 55112 Phone:651 -792 -7800 Website : www.cityofardenhills.org City VisionArden Hills is a strong community that values its unique environmental setting, strong residential neighborhoods, vital business community, well -maintained infrastructure, fiscal soundness, and our long -standing tradition as a desirable City in which to live, work, and play.CALL TO ORDER1.2.3.4.4.A.Documents:5.5.A.Documents:5.B.Documents:5.C.Documents:6.6.A.Documents:6.B.Documents:6.C.Documents:7.7.A.Documents:7.B.Documents:7.C.Documents:7.D.Documents:7.E.Documents:7.F.Documents:7.G.Documents:7.H.Documents:7.I.Documents:7.J.Documents:7.K.Documents:7.L.Documents: 8. 9. 9.A. Documents: 10. 10.A. Documents: 11. 12. PUBLIC PRESENTATION – 4A MEMORANDUM DATE: May 13, 2019 TO: Honorable Mayor and City Councilmembers Dave Perrault, City Administrator FROM: Gayle Bauman, Finance Director SUBJECT: 2018 City Financial Statements Budgeted Amount: Actual Amount: Funding Source: N/A N/A N/A Background/Discussion The City’s 2018 Financial Statements have been completed and will be submitted to both the State Auditor and the GFOA. The City’s auditor, Aaron Nielsen from MMKR, will be present at the May 13, 2019, City Council meeting to give an overview and answer questions. The auditors have issued an unmodified (“clean”) opinion on our financial statements for the year ended December 31, 2018. The total general fund balance at December 31, 2018 was $3,340,369 with $3,052,082 of unassigned balance; the new balance equates to a decrease in the General Fund balance of $298,948. The ending unassigned General Fund balance makes up approximately 60 percent of next year’s budgeted expenditures. The City’s total net position increased by $3,427,437. The combined ending fund balances for governmental funds was $7,543,820; the combined ending unrestricted net position for the enterprise funds was $1,329,268, and internal service funds was $384,212. We have completed the report in the form prescribed by the Government Finance Officers Association of United States and Canada (GFOA) for their Certificate of Achievement for Excellence in Financial Reporting. In order to qualify for this, the report has to be published in an easily readable and efficiently organized Comprehensive Annual Financial Report (CAFR) that satisfies both accounting principles generally accepted in the United States of America and applicable legal requirements. As a note of information, the Auditing Standards are constantly increasing and changing. With these changes, you may see increased findings. This does not mean that the City has done anything wrong compared to previous years, only that the reporting requirements have become much stricter. Many cities are experiencing these findings, and the findings are expected to increase for all cities as these standards become stricter. One finding was noted in the report related to Segregation of Duties. We are pleased with the outcome of the audit. Attachments A. Management Report B. Comprehensive Annual Financial Report C. Special Purpose Audit Report Management Report for City of Arden Hills, Minnesota December 31, 2018 THIS PAGE INTENTIONALLY LEFT BLANK C E R T I F I E D A C C O U N T A N T S P UBLIC PRINCIPALS Thomas A. Karnowski, CPA Paul A. Radosevich, CPA William J. Lauer, CPA James H. Eichten, CPA Aaron J. Nielsen, CPA Victoria L. Holinka, CPA/CMA Jaclyn M. Huegel, CPA Malloy, Montague, Karnowski, Radosevich & Co., P.A. 5353 Wayzata Boulevard • Suite 410 • Minneapolis, MN 55416 • Phone: 952-545-0424 • Fax: 952-545-0569 • www.mmkr.com To the City Council and Management City of Arden Hills, Minnesota We have prepared this management report in conjunction with our audit of the City of Arden Hills, Minnesota’s (the City) financial statements for the year ended December 31, 2018. We have organized this report into the following sections: • Audit Summary • Governmental Funds Overview • Enterprise Funds Overview • Government-Wide Financial Statements • Legislative Updates • Accounting and Auditing Updates We would be pleased to further discuss any of the information contained in this report or any other concerns that you would like us to address. We would also like to express our thanks for the courtesy and assistance extended to us during the course of our audit. The purpose of this report is solely to provide those charged with governance of the City, management, and those who have responsibility for oversight of the financial reporting process comments resulting from our audit process and information relevant to city finances in Minnesota. Accordingly, this report is not suitable for any other purpose. Minneapolis, Minnesota May 2, 2019 THIS PAGE INTENTIONALLY LEFT BLANK -1- AUDIT SUMMARY The following is a summary of our audit work, key conclusions, and other information that we consider important or that is required to be communicated to the City Council, administration, or those charged with governance of the City. OUR RESPONSIBILITY UNDER AUDITING STANDARDS GENERALLY ACCEPTED IN THE UNITED STATES OF AMERICA AND GOVERNMENT AUDITING STANDARDS We have audited the financial statements of the governmental activities, the business-type activities, each major fund, and the aggregate remaining fund information of the City as of and for the year ended December 31, 2018. Professional standards require that we provide you with information about our responsibilities under auditing standards generally accepted in the United States of America and Government Auditing Standards, as well as certain information related to the planned scope and timing of our audit. We have communicated such information to you verbally and in our audit engagement letter. Professional standards also require that we communicate the following information related to our audit. PLANNED SCOPE AND TIMING OF THE AUDIT We performed the audit according to the planned scope and timing previously discussed and coordinated in order to obtain sufficient audit evidence and complete an effective audit. AUDIT OPINION AND FINDINGS Based on our audit of the City’s financial statements for the year ended December 31, 2018: • We have issued an unmodified opinion on the City’s basic financial statements. • We reported one matter involving the City’s internal control over financial reporting that we consider to be a material weakness as detailed in the Special Purpose Audit Reports. Due to the limited size of the City’s office staff, the City has limited segregation of duties in certain areas. • The results of our testing disclosed no instances of noncompliance required to be reported under Government Auditing Standards. • We reported no findings based on our testing of the City’s compliance with Minnesota laws and regulations. FUND BALANCE/NET POSITION DEFICITS As reported in the City’s Comprehensive Annual Financial Report (CAFR), the Parks Fund; Public Safety Capital Equipment Fund; and TCAAP Fund; had year-end deficit equity balances of $5,816, $19,456, and $164,132, respectively. Management has disclosed that these deficits will be eliminated with future contributions, grants, and internal fund transfers, if needed. -2- SIGNIFICANT ACCOUNTING POLICIES Management is responsible for the selection and use of appropriate accounting policies. The significant accounting policies used by the City are described in Note 1 of the notes to basic financial statements. No new accounting policies were adopted and the application of existing policies was not changed during the year ended December 31, 2018; however, the City implemented the following governmental accounting standards during the fiscal year: • Governmental Accounting Standards Board (GASB) Statement No. 85, Omnibus 2017, which addresses issues that have been identified during implementation and application of certain GASB statements. • GASB Statement No. 86, Certain Debt Extinguishment Issues, which improves the consistency in accounting and financial reporting for in-substance defeasances of debt. We noted no transactions entered into by the City during the year for which there is a lack of authoritative guidance or consensus. All significant transactions have been recognized in the financial statements in the proper period. ACCOUNTING ESTIMATES AND MANAGEMENT JUDGMENTS Accounting estimates are an integral part of the financial statements prepared by management and are based on management’s knowledge and experience about past and current events and assumptions about future events. Certain accounting estimates are particularly sensitive because of their significance to the financial statements and because of the possibility that future events affecting them may differ significantly from those expected. The most sensitive estimates affecting the financial statements were: • Depreciation – Management’s estimates of depreciation expense are based on the estimated useful lives of the assets. • Compensated Absences – Management’s estimate is based on current rates of pay and unused compensated absences balances. • Pension Benefits – The City has recorded amounts and activities for pension benefits. Actuarial estimates of the net pension balances are calculated using actuarial methodologies described in GASB Statement No. 68. The actuarial calculations include significant assumptions, including projected changes, investment returns, retirement ages, proportionate share, and employee turnover. We evaluated the key factors and assumptions used by management to develop these estimates in determining that they are reasonable in relation to the basic financial statements taken as a whole. The financial statement disclosures are neutral, consistent, and clear. CORRECTED AND UNCORRECTED MISSTATEMENTS Professional standards require us to accumulate all known and likely misstatements identified during the audit, other than those that are clearly trivial, and communicate them to the appropriate level of management. There were no misstatements detected as a result of audit procedures that were material, either individually or in the aggregate, to each opinion unit’s financial statements taken as a whole. -3- DIFFICULTIES ENCOUNTERED IN PERFORMING THE AUDIT We encountered no significant difficulties in dealing with management in performing and completing our audit. DISAGREEMENTS WITH MANAGEMENT For purposes of this report, a disagreement with management is a financial accounting, reporting, or auditing matter, whether or not resolved to our satisfaction, that could be significant to the financial statements or the auditor’s report. We are pleased to report that no such disagreements arose during the course of our audit. MANAGEMENT REPRESENTATIONS We have requested certain representations from management that are included in the management representation letter dated May 2, 2019. MANAGEMENT CONSULTATIONS WITH OTHER INDEPENDENT ACCOUNTANTS In some cases, management may decide to consult with other accountants about auditing and accounting matters, similar to obtaining a “second opinion” on certain situations. If a consultation involves application of an accounting principle to the City’s financial statements or a determination of the type of auditor’s opinion that may be expressed on those statements, our professional standards require the consulting accountant to check with us to determine that the consultant has all the relevant facts. To our knowledge, there were no such consultations with other accountants. OTHER AUDIT FINDINGS OR ISSUES We generally discuss a variety of matters, including the application of accounting principles and auditing standards, with management each year prior to retention as the City’s auditors. However, these discussions occurred in the normal course of our professional relationship and our responses were not a condition to our retention. OTHER MATTERS We applied certain limited procedures to the management’s discussion and analysis (MD&A) and the required supplementary information (RSI) that supplements the basic financial statements. Our procedures consisted of inquiries of management regarding the methods of preparing the information and comparing the information for consistency with management’s responses to our inquiries, the basic financial statements, and other knowledge we obtained during our audit of the basic financial statements. We did not audit the RSI and do not express an opinion or provide any assurance on the RSI. We were engaged to report on the supplemental information accompanying the financial statements which are not RSI. With respect to this supplemental information, we made certain inquiries of management and evaluated the form, content, and methods of preparing the information to determine that the information complies with accounting principles generally accepted in the United States of America, the method of preparing it has not changed from the prior period, and the information is appropriate and complete in relation to our audit of the financial statements. We compared and reconciled the supplemental information to the underlying accounting records used to prepare the financial statements or to the financial statements themselves. We were not engaged to report on the introductory or statistical sections, which accompany the financial statements but are not RSI. Such information has not been subjected to the auditing procedures applied in the audit of the basic financial statements and, accordingly, we do not express an opinion or provide any assurance on it. -4- GOVERNMENTAL FUNDS OVERVIEW This section of the report provides you with an overview of the financial trends and activities of the City’s governmental funds, which includes the General, special revenue, debt service, and capital project funds. These funds are used to account for the basic services the City provides to all of its citizens, which are financed primarily with property taxes. The governmental fund information in the City’s financial statements focuses on budgetary compliance and the sufficiency of each governmental fund’s current assets to finance its current liabilities. PROPERTY TAXES Minnesota cities rely heavily on local property tax levies to support their governmental fund activities. For the 2017 fiscal year, local ad valorem property tax levies provided 41.1 percent of the total governmental fund revenues for cities over 2,500 in population, and 37.4 percent for cities under 2,500 in population. Total property taxes levied by all Minnesota cities for taxes payable in 2018 increased 6.2 percent from the prior year, and total certified levies payable in 2019 are projected to increase by 5.6 percent. The total market value of property in Minnesota cities increased about 5.6 percent for the 2017 levy year (state-wide market value information for the 2018 levy year was not available at the time this report was issued). The market values used for levying property taxes are based on the previous fiscal year (e.g., market values for taxes levied in 2018 were based on assessed values as of January 1, 2017), so the trend of change in these market values lags somewhat behind the housing market and economy in general. The City’s estimated market value increased by 2.5 percent for 2017 and increased 7.4 percent for taxes payable in 2018. The following graph shows the City’s changes in estimated market value over the past 10 years: $– $200,000,000 $400,000,000 $600,000,000 $800,000,000 $1,000,000,000 $1,200,000,000 $1,400,000,000 2009 2010 2011 2012 2013 2014 2015 2016 2017 2018 Estimated Market Value -5- Tax capacity is considered the actual base available for taxation. It is calculated by applying the state’s property classification system to each property’s market value. Each property classification, such as commercial or residential, has a different calculation and uses different rates. Consequently, a city’s total tax capacity will change at a different rate than its total market value, as tax capacity is affected by the proportion of the City’s tax base that is in each property classification from year-to-year, as well as legislative changes to tax rates. The City’s tax capacity increased 2.3 percent for taxes payable in 2017, and increased 7.3 percent for taxes payable in 2018. The following graph shows the City’s change in tax capacities over the past 10 years: $– $2,000,000 $4,000,000 $6,000,000 $8,000,000 $10,000,000 $12,000,000 $14,000,000 $16,000,000 $18,000,000 2009 2010 2011 2012 2013 2014 2015 2016 2017 2018 Local Tax Capacity The following table presents the average tax rates applied to city residents for each of the last three levy years: 2016 2017 2018 Average tax rate City 26.5 27.2 25.5 County 58.9 55.9 54.0 School 26.2 25.3 28.5 Special taxing 9.1 8.6 8.2 Total 120.7 117.0 116.2 Rates Expressed as a Percentage of Net Tax Capacity City of Arden Hills The total average tax rate was consistent with the prior year. An increase in the school portion was offset by decreases in the other taxing authority rates. -6- GOVERNMENTAL FUND BALANCES The following table summarizes the changes in the fund balances of the City’s governmental funds during the year ended December 31, 2018, presented both by fund balance classification and by fund: Increase 2018 2017 (Decrease) Fund balances of governmental funds Total by classification Nonspendable 25,696$ 289,183$ (263,487)$ Restricted 1,010,521 898,739 111,782 Committed 508,241 471,996 36,245 Assigned 3,136,684 6,423,941 (3,287,257) Unassigned 2,862,678 2,626,103 236,575 Total governmental funds 7,543,820$ 10,709,962$ (3,166,142)$ Total by fund General 3,340,369$ 3,639,317$ (298,948)$ EDA Operating 508,241 303,058 205,183 Equipment, Building, and Replacement 216,902 (259,269) 476,171 Permanent Improvement Revolving 2,656,977 6,080,457 (3,423,480) Other governmental funds 821,331 946,399 (125,068) Total governmental funds 7,543,820$ 10,709,962$ (3,166,142)$ as of December 31, Governmental Fund Change in Fund Balance Fund Balance In total, the fund balances of the City’s governmental funds decreased by $3,166,142 during the year ended December 31, 2018. The majority of the decrease was in assigned fund balance in the Permanent Improvement Revolving Fund, due to spending for street and trail projects in the current year. -7- GOVERNMENTAL FUND REVENUES The following table presents the per capita revenue of the City’s governmental funds for the past three years, along with state-wide averages. We have included the most recent comparative state-wide averages available from the Office of the State Auditor to provide a benchmark for interpreting the City’s data. The amounts received from the typical major sources of governmental fund revenue will naturally vary between cities based on factors such as a city’s stage of development, location, size and density of its population, property values, services it provides, and other attributes. It will also differ from year-to-year, due to the effect of inflation and changes in its operation. Also, certain data in these tables may be classified differently than how they appear in the City’s financial statements in order to be more comparable to the state-wide information, particularly in separating capital expenditures from current expenditures. We have designed this section of our management report using per capita data in order to better identify unique or unusual trends and activities of the City. We intend for this type of comparative and trend information to complement, rather than duplicate, information in the MD&A. An inherent difficulty in presenting per capita information is the accuracy of the population count, which for most years is based on estimates. Year 2016 2017 2018 Population 2,500–10,000 10,000–20,000 20,000–100,000 9,966 9,969 10,069 Property taxes 474$ 451$ 475$ 327$ 355$ 355$ Tax increments 26 27 38 24 30 35 Franchise and other taxes 38 43 48 13 11 10 Special assessments 57 48 59 37 31 73 Licenses and permits 39 34 49 60 73 52 Intergovernmental revenues 322 276 147 40 213 100 Charges for services 108 103 103 58 59 42 Other 68 53 48 40 46 49 Total revenue 1,132$ 1,035$ 967$ 599$ 818$ 716$ City of Arden Hills Governmental Funds Revenue per Capita With State-Wide Averages by Population Class State-Wide December 31, 2017 The City’s governmental funds have generated significantly less revenue per capita in total than other Minnesota cities in its population class. A city’s stage of development, along with the way a city finances various capital projects, will impact the mix of revenue sources it receives. The City generated $7,222,675 of total revenue in its governmental funds in 2018, a decrease of $932,871 (11.4 percent) from the prior year. The City’s per capita governmental fund revenues for 2018 were $716, a decrease of $102 (12.5 percent) per capita from the prior year. Intergovernmental revenues decreased $113 per capita, due to a one-time reimbursement from the county for its share of a joint street project in the prior year. -8- GOVERNMENTAL FUND EXPENDITURES The expenditures of governmental funds will also vary from state-wide averages and from year-to-year, based on the City’s circumstances. Expenditures are classified into three types as follows: • Current – These are typically the general operating type expenditures occurring on an annual basis, and are primarily funded by general sources, such as taxes and intergovernmental revenues. • Capital Outlay and Construction – These expenditures do not occur on a consistent basis, more typically fluctuating significantly from year-to-year. Many of these expenditures are project-oriented, and are often funded by specific sources that have benefited from the expenditure, such as special assessment improvement projects. • Debt Service – Although the expenditures for debt service may be relatively consistent over the term of the respective debt, the funding source is the important factor. Some debt may be repaid through specific sources, such as special assessments or redevelopment funding, while other debt may be repaid with general property taxes. The City’s expenditures per capita of its governmental funds for the past three years, together with state-wide averages, are presented in the following table: Year 2016 2017 2018 Population 2,500–10,000 10,000–20,000 20,000–100,000 9,966 9,969 10,069 Current 147$ 120$ 101$ 120$ 119$ 116$ 270 259 287 199 206 207 128 127 101 48 45 58 96 112 99 62 62 65 76 64 77 23 27 32 717 682 665 452 459 478 Capital outlay and construction 403 319 263 99 118 591 Debt service 228 147 121 – – – 44 35 32 – – – 272 182 153 – – – Total expenditures 1,392$ 1,183$ 1,081$ 551$ 577$ 1,069$ Governmental Funds Expenditures per Capita With State-Wide Averages by Population Class City of Arden HillsState-Wide All other Principal December 31, 2017 Interest and fiscal General government Public safety Public works Parks and recreation Total expenditures in the City’s governmental funds for 2018 were $10,757,975, an increase of $5,003,332 (86.9 percent). The City’s per capita governmental funds current expenditures for 2018 were $478, a slight increase from the $459 per capita expenditures in the prior year. Capital outlay and construction increased by $473 per capita, with increased activity in the City’s Permanent Improvement Revolving Fund, due to ongoing street and trail projects. -9- GENERAL FUND The City’s General Fund accounts for the financial activity of the basic services provided to the community. The primary services included within this fund are the administration of the municipal operation, police and fire protection, building inspection, street maintenance, and parks and recreation. The graph below illustrates the change in the General Fund financial position over the last five years. We have also included a line representing annual expenditures and transfers out to reflect the change in the size of the General Fund operation over the same period. 2014 2015 2016 2017 2018 Fund Bal $2,345,942 $3,082,410 $2,944,813 $3,639,317 $3,340,369 Cash Bal $2,734,366 $3,752,294 $3,506,967 $3,906,088 $3,850,270 Exp & Trans Out $4,324,507 $3,926,100 $4,940,586 $4,536,636 $5,181,629 $– $500,000 $1,000,000 $1,500,000 $2,000,000 $2,500,000 $3,000,000 $3,500,000 $4,000,000 $4,500,000 $5,000,000 $5,500,000 General Fund Financial Position Year Ended December 31, The City’s General Fund cash and investments balance at December 31, 2018 was $3,850,270 (net of borrowing), a decrease of $55,818 from the previous year. Total fund balance at December 31, 2018 was $3,340,369, a decrease of $298,948 from the prior year. This fund balance level represents approximately 77 percent of the City’s annual General Fund expenditures, based on 2018 expenditure levels, which compares to a prior year fund balance level of 87 percent. The overall impact of operations on fund balance was $338,277 better than anticipated in the final budget. As the graph illustrates, the City has generally been able to maintain stable cash and fund balance levels as the volume of financial activity has fluctuated. This is an important factor because a government, like any organization, requires a certain amount of equity to operate. A healthy financial position allows the City to avoid volatility in tax rates; helps minimize the impact of state funding changes; allows for the adequate and consistent funding of services, repairs, and unexpected costs; and is a factor in determining the City’s bond rating and resulting interest costs. Maintaining an adequate fund balance has become increasingly important given the fluctuations in state funding for cities in recent years. A trend that is typical to Minnesota local governments, especially the General Fund of cities, is the unusual cash flow experienced throughout the year. The City’s General Fund cash disbursements are made fairly evenly during the year other than the impact of seasonal services, such as snowplowing, street maintenance, and park activities. Cash receipts of the General Fund are quite a different story. Property taxes comprise approximately 73 percent of the fund’s total annual revenue. Approximately half of these revenues are received by the City in July and the rest in December. Consequently, the City needs to have adequate cash reserves to finance its everyday operations between these payments. -10- GENERAL FUND REVENUES The following graph reflects the City’s General Fund revenues, budget and actual, for 2018: Other Charges for Services Intergovernmental Licenses and Permits Taxes General Fund Revenue Budget to Actual Budget Actual Total General Fund revenues for 2018 were $4,882,681, which was $8,052 (0.2 percent) over the final budget. Licenses and permits ($201,844) and charges for services ($27,103) were over budget, due to conservative budgeting for these sources. Taxes were $216,414 below anticipated levels, due to abatements and adjustments on delinquent balances. The following graph presents the City’s General Fund revenues by source for the last five years. The graph reflects the City’s reliance on property taxes: Taxes Licenses and Permits Intergovernmental Charges for Services Other 2014 $3,210,025 $327,727 $136,249 $400,224 $230,518 2015 $3,203,004 $518,846 $130,023 $496,908 $313,787 2016 $3,260,537 $598,686 $131,914 $577,041 $234,811 2017 $3,541,705 $729,197 $151,425 $590,141 $218,672 2018 $3,578,628 $526,444 $149,097 $427,905 $200,607 $– $500,000 $1,000,000 $1,500,000 $2,000,000 $2,500,000 $3,000,000 $3,500,000 $4,000,000 General Fund Revenue by Source Year Ended December 31, Total General Fund revenues for 2018 were $348,459 (6.7 percent) less than prior year. Licenses and permits and charges for services decreased $202,753 and $162,236, respectively, due to decreased building activity in the current year. -11- GENERAL FUND EXPENDITURES The following graph reflects the City’s General Fund expenditures, budget and actual, for 2018: Parks and Recreation Public Works Public Safety General Government General Fund Expenditures Budget Actual Total General Fund expenditures for 2018 were $4,361,629, which was $330,225 (7.0 percent) under the final budget. As presented in the budgetary comparison schedule (within the City’s CAFR), expenditure variances were both favorable and unfavorable within the various functions and departments while overall, they remained within total appropriations approved by the City Council. The general government function was $200,876 under budget, mainly in planning and zoning ($89,336) and general government buildings ($36,391) within other services and charges. The public safety function was under budget by $67,827, mainly in protective inspections ($33,033) and police and animal control ($32,819). The following graph presents the City’s General Fund expenditures by function for the last five years: General Government Public Safety Public Works Parks and Recreation 2014 $1,056,906 $1,826,098 $580,872 $648,214 2015 $1,015,835 $1,920,280 $336,398 $573,587 2016 $1,082,313 $1,981,506 $479,814 $621,832 2017 $1,076,352 $2,058,037 $443,633 $618,614 2018 $1,039,772 $2,088,345 $579,535 $653,977 $– $200,000 $400,000 $600,000 $800,000 $1,000,000 $1,200,000 $1,400,000 $1,600,000 $1,800,000 $2,000,000 $2,200,000 General Fund Expenditures by Function Year Ended December 31, Overall, General Fund expenditures increased $164,993 (3.9 percent) from the prior year, with the largest increase in public works ($135,902). -12- ENTERPRISE FUNDS OVERVIEW The City maintains enterprise funds to account for services the City provides that are financed primarily through fees charged to those utilizing the service. This section of the report provides you with an overview of the financial trends and activities of the City’s enterprise funds, which include the Water, Sewer, Surface Water Management, and Recycling Funds. The utility funds comprise a considerable portion of the City’s activities. These funds help to defray overhead and administrative costs and provide additional support to general government operations by way of annual transfers. We understand that the City is proactive in reviewing these activities on an ongoing basis and we want to reiterate the importance of continually monitoring these operations. Over the years, we have emphasized to our city clients the importance of these utility operations being self-sustaining, preventing additional burdens on general government funds. This would include the accumulation of net assets for future capital improvements and to provide a cushion in the event of a negative trend in operations. ENTERPRISE FUNDS FINANCIAL POSITION The following table summarizes the changes in the financial position of the City’s enterprise funds during the year ended December 31, 2018, presented both by classification and by fund: Increase 2018 2017 (Decrease) Net position of enterprise funds Total by classification Net investment in capital assets 17,295,916$ 16,292,000$ 1,003,916$ Unrestricted 1,329,268 1,298,744 30,524 Total enterprise funds 18,625,184$ 17,590,744$ 1,034,440$ Total by fund Water 8,179,034$ 7,519,127$ 659,907$ Sewer 5,875,144 5,765,055 110,089 Surface Water Management 4,447,569 4,175,003 272,566 Nonmajor Recycling 123,437 131,559 (8,122) Total enterprise funds 18,625,184$ 17,590,744$ 1,034,440$ Enterprise Funds Change in Financial Position Net Position as of December 31, In total, the net position of the City’s enterprise funds increased by $1,034,440 during the year ended December 31, 2018. This increase was mainly in net investment in capital assets, which increased $1,003,916, due to continued investment in utility infrastructure and other capital assets. -13- WATER FUND The following graph presents five years of operating results for the Water Fund: 2014 2015 2016 2017 2018 Oper Rev $2,132,191 $2,099,242 $2,165,773 $2,104,639 $2,256,859 Oper Exp, Excl Dep $1,711,191 $1,579,215 $1,601,171 $1,921,138 $1,812,772 Oper Inc Before Dep $421,000 $520,027 $564,602 $183,501 $444,087 $– $200,000 $400,000 $600,000 $800,000 $1,000,000 $1,200,000 $1,400,000 $1,600,000 $1,800,000 $2,000,000 $2,200,000 $2,400,000 Water Fund Year Ended December 31, The Water Fund ended 2018 with a net position of $8,179,034, an increase of $659,907 from the prior year. Of total net position, $7,190,606 represents the net investment in capital assets, leaving $988,428 of unrestricted net position. Water Fund operating revenues were $2,256,859 for 2018, an increase of $152,220 due to increased rates. Operating expenses (excluding depreciation of $260,017) were $1,812,772, which represents a decrease of $108,366. Expenses were down largely due to a decrease in other services and charges and supplies and maintenance. The Water Fund also received $500,000 in capital contributions in the current year for a watermain project. Consumption will fluctuate from year-to-year based on many factors, including weather patterns and number of utility customers. -14- SEWER FUND The following graph presents five years of operating results for the Sewer Fund: 2014 2015 2016 2017 2018 Oper Rev $1,857,272 $1,855,802 $1,989,066 $1,723,699 $1,769,466 Oper Exp, Excl Dep $1,367,820 $1,438,589 $1,362,274 $1,615,427 $1,467,028 Oper Inc Before Dep $489,452 $417,213 $626,792 $108,272 $302,438 $– $200,000 $400,000 $600,000 $800,000 $1,000,000 $1,200,000 $1,400,000 $1,600,000 $1,800,000 $2,000,000 $2,200,000 Sewer Fund Year Ended December 31, The Sewer Fund ended 2018 with a net position of $5,875,144, an increase of $110,089 from the prior year. Of total net position, $5,684,251 represents the net investment in capital assets, leaving $190,893 of unrestricted net position. Sewer Fund operating revenues for 2018 were $1,769,466, an increase of $45,767 compared to last year. Operating expenses for 2018 (excluding depreciation of $175,456) were $1,467,028, a decrease of $148,399 from the prior year, due to a decrease in other services and charges. -15- SURFACE WATER MANAGEMENT FUND The following graph presents five years of operating results for the Surface Water Management Fund: 2014 2015 2016 2017 2018 Oper Rev $762,884 $782,501 $812,044 $834,973 $839,499 Oper Exp, Excl Dep $370,747 $416,945 $390,935 $395,715 $390,882 Oper Inc Before Dep $392,137 $365,556 $421,109 $439,258 $448,617 $– $100,000 $200,000 $300,000 $400,000 $500,000 $600,000 $700,000 $800,000 $900,000 Surface Water Management Fund Year Ended December 31, The Surface Water Management Fund ended 2018 with a net position of $4,447,569, an increase of $272,566 from the prior year. Of this, $4,421,059 represents the investment in capital assets, leaving $26,510 of unrestricted net position. Surface Water Management Fund operating revenues for 2018 were $839,499, an increase of $4,526 from last year. Operating expenses for 2018 (excluding depreciation of $108,167) were $390,882, or $4,833 less than the prior year. -16- RECYCLING FUND The following graph presents five years of operating results for the Recycling Fund: 2014 2015 2016 2017 2018 Oper Rev $130,369 $129,030 $134,739 $151,272 $134,228 Oper Exp $150,417 $239,727 $141,190 $147,919 $168,145 Oper Inc (Loss)$(20,048) $(110,697) $(6,451) $3,353 $(33,917) $(125,000) $(75,000) $(25,000) $25,000 $75,000 $125,000 $175,000 $225,000 $275,000 Recycling Fund Year Ended December 31, The Recycling Fund ended 2018 with an unrestricted net position of $123,437, a decrease of $8,122 from the prior year. Recycling Fund operating revenues for 2018 were $134,228, a decrease of $17,044 from the prior year. Operating expenses for 2018 were $168,145, an increase of $20,226 from the prior year. The Recycling Fund also received $23,819 of nonoperating intergovernmental revenues that are available for the operation of the City’s Recycling Program. In 2015, intergovernmental revenues included $100,000 received from Ramsey County as a grant to upgrade city residents’ recycling receptacles. This intergovernmental revenue is not reflected in the graph above; however, the expenses related to this grant are included in the operating results presented by the graph above. This one-time grant accounts for the increase in operating expenses in the 2015 fiscal year. -17- GOVERNMENT-WIDE FINANCIAL STATEMENTS In addition to fund-based information, the current reporting model for governmental entities also requires the inclusion of two government-wide financial statements designed to present a clear picture of the City as a single, unified entity. These government-wide financial statements provide information on the total cost of delivering services, including capital assets and long-term liabilities. STATEMENT OF NET POSITION The Statement of Net Position essentially tells you what your city owns and owes at a given point in time, the last day of the fiscal year. Theoretically, net position represents the resources the City has leftover to use for providing services after its debts are settled. However, those resources are not always in spendable form, or there may be restrictions on how some of those resources can be used. Therefore, net position is divided into three components: investment in capital assets, restricted, and unrestricted. The following table presents the components of the City’s net position as of December 31, 2018 and 2017 for governmental activities and business-type activities (utility fund operations): Increase 2018 2017 (Decrease) Net position Governmental activities Net investment in capital assets 26,972,898$ 22,750,377$ 4,222,521$ Restricted 1,010,521 898,739 111,782 Unrestricted 8,736,913 10,678,219 (1,941,306) Total governmental activities 36,720,332 34,327,335 2,392,997 Business-type activities Net investment in capital assets 17,295,916 16,292,000 1,003,916 Unrestricted 1,329,268 1,298,744 30,524 Total business-type activities 18,625,184 17,590,744 1,034,440 Total net position 55,345,516$ 51,918,079$ 3,427,437$ As of December 31, Net position for governmental activities increased by $2,392,997 in 2018, as presented above. The investment in capital assets increased $4,222,521 this year, mainly due to the significant amount of construction activity in the current year. The remaining change in this category of net position typically depends on the relationship of the rate at which the City is adding capital assets, the rate capital assets are being depreciated, and how the City finances the purchase and construction of capital assets. The restricted portion of net position increased $111,782, due to increases in amounts restricted for tax increment purposes. The decrease in unrestricted net position is due to the continued investment in infrastructure using unrestricted resources of the City. The change in net position for business-type activities is consistent with our earlier discussion for the utility operations, which are presented under the same, full accrual, basis of accounting. -18- STATEMENT OF ACTIVITIES The Statement of Activities tracks the City’s yearly revenues and expenses, as well as any other transactions that increase or reduce total net position. These amounts represent the full cost of providing services. The Statement of Activities provides a more comprehensive measure than just the amount of cash that changed hands, as reflected in the fund-based financial statements. This statement includes the cost of supplies used, depreciation of long-lived capital assets, and other accrual-based expenses. The following table presents the change in the net position of the City for the years ended December 31, 2018 and 2017: 2017 Program Expenses Revenues Net Change Net Change Governmental activities 1,286,845$ 285,055$ (1,001,790)$ (870,692)$ 2,248,540 771,516 (1,477,024) (1,124,411) 1,695,449 1,841,163 145,714 (1,321,488) 765,843 1,392,080 626,237 (595,509) 391,156 – (391,156) (276,841) Business-type activities 2,147,359 2,878,336 730,977 (32,349) 1,654,079 1,885,874 231,795 15,968 499,049 840,444 341,395 354,004 168,145 158,047 (10,098) 27,794 Total net (expense) revenue 10,856,465$ 10,052,515$ (803,950) (3,823,524) General revenues Property taxes 3,578,894 3,526,347 Tax increment collections 351,569 295,788 Franchise taxes 101,237 109,070 Unrestricted investment earnings 199,687 172,101 Total general revenues 4,231,387 4,103,306 Change in net position 3,427,437$ 279,782$ 2018 Net (expense) revenue General government Public safety Parks and recreation Public works Water Recycling Economic development Sewer Surface water management One of the goals of this statement is to provide a side-by-side comparison to illustrate the difference in the way the City’s governmental and business-type operations are financed. The table clearly illustrates the dependence of the City’s governmental operations on general revenues, such as taxes and unrestricted investment earnings. It also shows that, for the most part, the City’s business-type activities are generating sufficient program revenues (service charges and program-specific grants) to cover expenses. This is critical given the current downward pressures on the general revenue sources. -19- LEGISLATIVE UPDATES The 2018 legislative session, falling in the second half of the state’s fiscal biennium, was a short session in which only two major finance-related bills were passed, omnibus bonding bills related to bonding, and pensions. The following is a brief summary of specific legislative changes from the 2018 session or previous legislative sessions potentially impacting Minnesota cities. Omnibus Bonding Bill – The omnibus bonding bill authorized financing for over $1.5 billion in capital improvements. Included in the approved funding was $542 million for various transportation infrastructure, $99 million for local city-related economic development projects, and appropriations for a number of different utility (water, sewer, wastewater, etc.) infrastructure improvement programs. Wastewater Investment Protection – Effective retroactively back to August 1, 2017, when a city builds a new wastewater treatment facility or upgrades one to meet current standards that exceed its previous performance, the investment in that facility would be considered adequate for a period of 16 years before a city could be required to upgrade the facility again to meet updated state wastewater facility standards. Competitive Bidding Threshold – Effective for contracts awarded on or after August 1, 2018, the dollar threshold at which Minnesota Statutes require the use of a sealed bidding process was raised from $100,000 to $175,000. This extends the dollar range for which contracts may be awarded using direct negotiation (obtaining two quotations) to contracts between $25,000 and $175,000. By reference, this change also increased the dollar threshold at which public contractors’ performance and payment bonds are required for contracts over $175,000. Water Tank Maintenance Contracts – Effective for contracts awarded on or after September 1, 2018, multi-year service contracts for water tank maintenance work that were previously allowed to be awarded through direct negotiation, are required to be awarded through a sealed bid or best value bid procurement process when the total cost of the contract for the services and supplies is expected to exceed the competitive bid threshold of $175,000. Minnesota Licensing and Registration System (MNLARS) – The Legislature established the MNLARS steering committee, and a one-time appropriation of $9.65 million was approved for fiscal year 2018 to fund costs related to the continued development, improvement, operation, and deployment of the MNLARS. However, a bill to provide an additional proposed appropriation of $9 million to partially compensate deputy registrars throughout the state for financial losses related to the flawed rollout of the MNLARS was vetoed by the Governor. Pension Benefit Reforms – The 2018 pension bill included a number of reforms to the various defined benefit pension plans across the state, including the plans administered by the Public Employees Retirement Association (PERA). • Reforms impacting the PERA General Employees Retirement Fund (GERF) plan included: o Post-retirement cost of living adjustments (COLAs) will be equal to 50.0 percent of the annual increase for Social Security, but not less than 0.5 percent, and not more than 1.5 percent. o For early retirees that retire on or after January 1, 2024, COLAs are deferred until the retiree reaches the normal retirement age. o Phases in actuarial reduction factors over five year on early retirement benefits payable beginning July 1, 2019. o The rate of interest paid on refunds of employee contributions to former public employees was reduced from an annual rate of 4.0 percent to 3.0 percent. -20- • Reforms impacting the PERA Public Employees Police and Fire Fund (PEPFF) plan included: o Post-retirement COLAs were permanently set at 1.00 percent. o Employer contribution rates increase from the current 16.20 percent of covered salaries to 16.95 percent beginning January 1, 2019, and 17.70 percent beginning January 1, 2020. o Employee contribution rates increase from the current 10.80 percent of covered salaries to 11.30 percent beginning January 1, 2019, and 11.80 percent beginning January 1, 2020. o To reduce the need for additional contribution increases, the state will contribute an additional $4.5 million to the plan annually for fiscal years 2019 and 2020, increasing to $9.0 million annually thereafter through fiscal 2048, or until the plan is fully funded. o The rate of interest paid on refunds of employee contributions to former public employees was reduced from an annual rate of 4.00 percent to 3.00 percent. • Reforms impacting the volunteer firefighter relief associations plan included: o Added a requirement that the fire chief annually certify each firefighter’s service credit to the relief association and the related municipality effective January 1, 2019. -21- ACCOUNTING AND AUDITING UPDATES GASB STATEMENT NO. 83, CERTAIN ASSET RETIREMENT OBLIGATIONS This statement addresses accounting and financial reporting for certain asset retirement obligations (ARO), which are legally enforceable liabilities associated with the retirement of a tangible capital asset. This statement establishes criteria for determining the timing and pattern of recognition of a liability and a corresponding deferred outflow of resources for ARO. A government that has legal obligations to perform future asset retirement activities related to its tangible capital assets should recognize a liability when it is both incurred and reasonably estimable. The measurement of an ARO is required to be based on the best estimate of the current value of outlays expected to be incurred, and a deferred outflow of resources associated with an ARO is required to be measured at the amount of the corresponding liability upon initial measurement. This statement requires the current value of a government’s AROs to be adjusted for the effects of general inflation or deflation at least annually, and a government to evaluate all relevant factors at least annually to determine whether the effects of one or more of the factors are expected to significantly change the estimated asset retirement outlays. A government should remeasure an ARO only when the result of the evaluation indicates there is a significant change in the estimated outlays. Deferred outflows of resources should be reduced and recognized as outflows of resources in a systematic and rational manner over the estimated useful life of the tangible capital asset. If a government owns a minority interest in a jointly owned tangible asset where a nongovernmental entity is the majority owner or has operational responsibility for the jointly owned asset, the government’s minority share of an ARO should be reported using the measurement produced by the nongovernmental majority owner or the nongovernmental minority owner that has operational responsibility, without adjustment to conform to the liability measurement and recognition requirements of this statement. The statement also requires disclosures of any funding or financial assurance requirements a government has related to the performance of asset retirement activities, along with any assets restricted for the payment of the government’s AROs. This statement also requires disclosure of information about the nature of a government’s AROs, the methods and assumptions used for the estimates of the liabilities, and the estimated remaining useful life of the associated tangible capital assets. If an ARO (or portions thereof) has been incurred by a government but is not yet recognized because it is not reasonably estimable, the government is required to disclose that fact and the reasons therefor. This statement requires similar disclosures for a government’s minority shares of AROs. The requirements of this statement are effective for reporting periods beginning after June 15, 2018. Earlier application is encouraged. GASB STATEMENT NO. 84, FIDUCIARY ACTIVITIES This statement establishes criteria for identifying fiduciary activities of all state and local governments. The focus of the criteria generally is on (1) whether a government is controlling the assets of the fiduciary activity, and (2) the beneficiaries with whom a fiduciary relationship exists. Separate criteria are included to identify fiduciary component units and post-employment benefit arrangements that are fiduciary activities. -22- An activity meeting the criteria should be reported in a fiduciary fund in the basic financial statements, which should present a statement of fiduciary net position and a statement of changes in fiduciary net position. This statement describes four fiduciary funds that should be reported, if applicable: (1) pension (and other employee benefit) trust funds, (2) investment trust funds, (3) private-purpose trust funds, and (4) custodial funds. Custodial funds generally should report fiduciary activities that are not held in a trust or equivalent arrangement that meets specific criteria. A fiduciary component unit, when reported in the fiduciary fund financial statements of a primary government, should combine its information with its component units that are fiduciary component units and aggregate that combined information with the primary government’s fiduciary funds. This statement also provides for recognition of a liability to the beneficiaries in a fiduciary fund when an event has occurred that compels the government to disburse fiduciary resources, defined as when a demand for the resources has been made or when no further action, approval, or condition is required to be taken or met by the beneficiary to release the assets. The requirements of this statement are effective for reporting periods beginning after December 15, 2018. Earlier application is encouraged. GASB STATEMENT NO. 87, LEASES A lease is a contract that transfers control of the right to use another entity’s nonfinancial asset as specified in the contract for a period of time in an exchange or exchange-like transaction. Examples of nonfinancial assets include buildings, land, vehicles, and equipment. Any contract that meets this definition should be accounted for under the leases guidance, unless specifically excluded in this statement. Governments enter into leases for many types of assets. Under the previous guidance, leases were classified as either capital or operating depending on whether the lease met any of the four tests. In many cases, the previous guidance resulted in reporting lease transactions differently than similar nonlease financing transactions. The goal of this statement is to better meet the information needs of users by improving accounting and financial reporting for leases by governments. It establishes a single model for lease accounting based on the principle that leases are financings of the right-to-use an underlying asset. This statement increases the usefulness of financial statements by requiring recognition of certain lease assets and liabilities for leases that previously were classified as operating leases and recognized as inflows of resources or outflows of resources based on the payment provisions of the contract. Under this statement, a lessee is required to recognize a lease liability and an intangible right-to-use lease asset, and a lessor is required to recognize a lease receivable and a deferred inflow of resources, thereby enhancing the relevance and consistency of information about governments’ leasing activities. To reduce the cost of implementation, this statement includes an exception for short-term leases, defined as a lease that, at the commencement of the lease term, has a maximum possible term under the lease contract of 12 months (or less), including any options to extend, regardless of their probability of being exercised. Lessees and lessors should recognize short-term lease payments as outflows of resources or inflows of resources, respectively, based on the payment provisions of the lease contract. The requirements of this statement are effective for reporting periods beginning after December 15, 2019. -23- GASB STATEMENT NO. 88, CERTAIN DISCLOSURES RELATED TO DEBT, INCLUDING DIRECT BORROWINGS AND DIRECT PLACEMENTS The primary objective of this statement is to improve the information that is disclosed in notes to government financial statements related to debt, including direct borrowings and direct placements. It also clarifies which liabilities governments should include when disclosing information related to debt. The requirements of this statement will improve financial reporting by providing users of financial statements with essential information that currently is not consistently provided. In addition, information about resources to liquidate debt and the risks associated with changes in terms associated with debt will be disclosed. As a result, users will have better information to understand the effects of debt on a government’s future resource flows. This statement defines debt for purposes of disclosure in notes to financial statements as a liability that arises from a contractual obligation to pay cash (or other assets that may be used in lieu of cash) in one or more payments to settle an amount that is fixed at the date the contractual obligation is established. The statement requires that additional essential information related to debt be disclosed in notes to financial statements, including unused lines of credit; assets pledged as collateral for the debt; and terms specified in debt agreements related to significant events of default with finance-related consequences, significant termination events with finance-related consequences, and significant subjective acceleration clauses. It also requires that existing and additional information be provided for direct borrowings and direct placements of debt separately from other debt. The requirements of this statement are effective for reporting periods beginning after June 15, 2018. GASB STATEMENT NO. 89, ACCOUNTING FOR INTEREST COST INCURRED BEFORE THE END OF A CONSTRUCTION PERIOD The objectives of this statement are to enhance the relevance and comparability of information about capital assets and the cost of borrowing for a reporting period and to simplify accounting for interest cost incurred before the end of a construction period. This statement requires that interest cost incurred before the end of a construction period be recognized as an expense in the period in which the cost is incurred for financial statements prepared using the economic resources measurement focus. As a result, interest cost incurred before the end of a construction period will no longer be included in the historical cost of a capital asset reported in a business-type activity or enterprise fund. This statement also reiterates that in financial statements prepared using the current financial resources measurement focus, interest cost incurred before the end of a construction period should continue to be recognized as an expenditure on a basis consistent with governmental fund accounting principles. The requirements of this statement are effective for reporting periods beginning after December 15, 2019. Earlier application is encouraged. The requirements of this statement should be applied prospectively. -24- GASB STATEMENT NO. 90, MAJORITY EQUITY INTEREST—AN AMENDMENT OF GASB STATEMENTS NO. 14 AND NO. 61 The primary objectives of this statement are to improve the consistency and comparability of reporting a government’s majority equity interest in a legally separate organization and to improve the relevance of financial statement information for certain component units. It specifies that a majority equity interest in a legally separate organization should be reported as an investment if a government’s holding of the equity interest meets the definition of an investment. It further specifies that such investments should generally be measured using the equity method, unless it is held by a special-purpose government engaged only in fiduciary activities, a fiduciary fund, or an endowment (including permanent and term endowments) or permanent fund, in which case the majority equity interest should be measured at fair value. All other holdings of a majority equity interest in a legally separate organization that do not meet the definition of an investment result in the government being financially accountable for the legally separate organization and, therefore, the government should report that organization as a component unit, and should report an asset related to the majority equity interest using the equity method. This statement also requires that a component unit in which a government has a 100 percent equity interest account for its assets, deferred outflows of resources, liabilities, and deferred inflows of resources at acquisition value at the date the government acquired a 100 percent equity interest in the component unit. Transactions presented in flows statements of the component unit in that circumstance should include only transactions that occurred subsequent to the acquisition. The requirements of this statement are effective for reporting periods beginning after December 15, 2018. Earlier application is encouraged. The requirements should be applied retroactively, except for the provisions related to reporting a majority equity interest in a component unit and reporting a component unit if the government acquires a 100 percent equity interest, which should be applied prospectively. UNIFORM GUIDANCE, MICRO-PURCHASE THRESHOLD Under the Uniform Guidance for federal programs, a micro-purchase is one for goods or services that, due to its relatively low value, does not require the government to abide by many of its ordinary competitive procedures, including small business set-asides. Because the contract is theoretically such a low amount, the contracting officer can pick virtually whatever company and product he or she wants to satisfy the procurement, so long as the price is reasonable. The standard micro-purchase threshold has been amended to increase the threshold to $10,000, effective June 20, 2018. Entities are not required to increase the micro-purchase and simplified acquisition thresholds but, if they wish to do so, they must update their procurement policies and procedures to reflect the change in thresholds. They cannot retroactively make these changes effective prior to June 20, 2018. CITY OF ARDEN HILLS RAMSEY COUNTY, MINNESOTA Comprehensive Annual Financial Report Year Ended December 31, 2018 FINANCE DEPARTMENT Page Letter of Transmittal i–iii GFOA Certificate of Achievement iv City Council and Appointed Officials v Organization Chart vi INDEPENDENT AUDITOR’S REPORT 1–3 MANAGEMENT’S DISCUSSION AND ANALYSIS 4–13 BASIC FINANCIAL STATEMENTS Government-Wide Financial Statements Statement of Net Position 14 Statement of Activities 15–16 Fund Financial Statements Governmental Funds Balance Sheet 17–18 Statement of Revenues, Expenditures, and Changes in Fund Balances 19–20 Reconciliation of the Statement of Revenues, Expenditures, and Changes in Fund Balances to the Statement of Activities 21 Proprietary Funds Statement of Net Position 22 Statement of Revenues, Expenses, and Changes in Net Position 23 Statement of Cash Flows 24 Notes to Basic Financial Statements 25–48 REQUIRED SUPPLEMENTARY INFORMATION PERA – General Employees Retirement Fund Schedule of City’s and Nonemployer Proportionate Share of Net Pension Liability 49 Schedule of City Contributions 49 Budgetary Comparison Schedule General Fund 50–52 EDA Operating Fund 53 Notes to Required Supplementary Information 54–55 SUPPLEMENTAL INFORMATION Combining and Individual Fund Statements and Schedules Nonmajor Governmental Funds Combining Balance Sheet 56 Combining Statement of Revenues, Expenditures, and Changes in Fund Balances 57 INTRODUCTORY SECTION FINANCIAL SECTION CITY OF ARDEN HILLS Table of Contents RAMSEY COUNTY, MINNESOTA Page SUPPLEMENTAL INFORMATION (CONTINUED) Combining and Individual Fund Statements and Schedules (continued) Nonmajor Special Revenue Funds Combining Balance Sheet 58 Combining Statement of Revenues, Expenditures, and Changes in Fund Balances 59 Nonmajor Capital Project Funds Combining Balance Sheet 60 Combining Statement of Revenues, Expenditures, and Changes in Fund Balances 61 Special Revenue Funds Schedule of Revenues, Expenditures, and Changes in Fund Balances – Budget and Actual Cable Fund 62 EDA Revolving Fund 63 EDA TIF District No. 3 Fund 64 EDA TIF District No. 4 Fund 65 Internal Service Funds Combining Statement of Net Position 66 Combining Statement of Revenues, Expenses, and Changes in Net Position 67 Combining Statement of Cash Flows 68 Net Position by Component 69–70 Changes in Net Position 71–74 Governmental Activities Tax Revenues by Source 75 Fund Balances of Governmental Funds 76–77 Changes in Fund Balances of Governmental Funds 78–79 General Governmental Tax Revenues by Source 80 Tax Capacity Value and Estimated Market Value of Taxable Property 81–82 Property Tax Rates – Direct and Overlapping Governments 83 Principal Property Taxpayers 84 Property Tax Levies and Collections 85 Ratios of Outstanding Debt by Type 86 Direct and Overlapping Governmental Activities Debt 87 Legal Debt Margin Information 88–89 Pledged Revenue Coverage 90 Demographic and Economic Statistics 91 Principal Employers 92 Operating Indicators by Function 93–94 Full-Time Equivalent City Government Employees by Function 95–96 Capital Asset Statistics by Function 97–98 STATISTICAL SECTION (UNAUDITED) CITY OF ARDEN HILLS Table of Contents (continued) RAMSEY COUNTY, MINNESOTA INTRODUCTORY SECTION TAB May 2, 2019 To the Honorable Mayor, Members of the City Council, and Citizens of the City of Arden Hills, Minnesota State law requires that every general-purpose local government publish a complete set of audited financial statements. This report is published to fulfill that requirement for the fiscal year ended December 31, 2018. Management assumes full responsibility for the completeness and reliability of the information contained in this report, based upon a comprehensive framework of internal control that it has established for this purpose. Because the cost of internal control should not exceed anticipated benefits, the objective is to provide reasonable, rather than absolute assurance that the financial statements are free of any material misstatements. Malloy, Montague, Karnowski, Radosevich & Co., P.A. (MMKR), Certified Public Accountants, have issued an unmodified (“clean”) opinion on the City of Arden Hills, Minnesota’s (the City) financial statements for the year ended December 31, 2018. The independent auditor’s report is located at the front of the financial section of this report. The management’s discussion and analysis (MD&A) immediately follows the independent auditor’s report and provides a narrative introduction, overview, and analysis of the basic financial statements. The MD&A complements this letter of transmittal and should be read in conjunction with it. PROFILE OF THE GOVERNMENT The City, incorporated in 1951, is a northern suburb of the Minneapolis/St. Paul metropolitan area, situated in Ramsey County. The City occupies 9.65 square miles and serves an estimated population of 10,069. The City is empowered to levy a property tax on both real and personal property located within its boundaries. The City operates under the “Optional Plan A” form of government as defined in Minnesota Statutes. Under this plan, the government of the City is directed by a City Council composed of an elected mayor and four elected councilmembers. The City Council exercises legislative authority and determines all matters of policy. The City Council appoints personnel responsible for the proper administration of all affairs relating to the City. Councilmembers serve four-year terms, with two members elected every two years. The mayor is elected for a four-year term. The mayor and members of the City Council are elected at large. -i- -ii- The City provides a full range of services: the construction and maintenance of streets and other infrastructure; recreational and cultural activities; water, sewer, surface water management, and recycling systems; community development, building inspection, and planning; and general government operations, including administration, finance/accounting, information systems, community information (newsletter), and general government buildings. The City contracts with Ramsey County for police services and Lake Johanna Fire Department for fire services. The City Council is required to adopt a final budget by late December for the subsequent year. The budget is prepared by fund, function (e.g., public safety), and department (e.g., police). Transfers of appropriations between funds require the approval of the City Council. The legal level of budgetary control is the fund level. Budgeted amounts may be amended by the City Council. The City’s capital improvement program (covering five years), the pavement management plan (covering five years), and the Twin Cities Army Ammunition Plant (TCAAP) development plan, along with the annual budget, serve as the foundation for the City’s financial planning, and the annual budget serves as the budget control. LOCAL ECONOMY A number of high-profile leaders in the medical, technology, and business sectors, including Boston Scientific, Land O’ Lakes, IntriCon, Gradient Financial, International Paper, Delkor, and Presbyterian Homes, are located within the City. These leaders of industry provide high-paying jobs to skilled employees, which in turn creates a strong base for economic diversity, quality housing, and an involved citizenry. Because of its location in a region with a varied economic base, unemployment is relatively stable. During the past 10 years, the unemployment rate has fluctuated from a high of 7.6 percent in 2009 to the current low of 2.7 percent. Unemployment is expected to remain at or below the regional and national average. During the past 10 years, property taxes have remained a stable and significant source of total General Fund and special revenue fund revenues. Intergovernmental revenues have declined over this same time period and now make up less than 3 percent of total revenues in the General Fund and special revenue funds for the current fiscal year. LONG-TERM FINANCIAL PLANNING The unassigned General Fund balance of $3,052,082 (60.3 percent of total subsequent year General Fund expenditures budgeted) meets the 50 percent target set by the City Council for budgetary and planning purposes. The total General Fund balance also includes $25,482 of nonspendable equity for prepaid items, $75,835 of assigned equity for compensated absences, and $186,970 assigned equity for subsequent year’s budget. The City’s five-year capital improvement program and pavement management plan serve as the foundation for the City’s long-term financial planning. To ensure the timely replacement of infrastructure, the City prepares long-term cost projections for the replacement of all city assets. Funding needs for capital replacements are reflected in tax levies and special assessments for capital assets, and are reflected in user fees established for the Water, Sewer, Surface Water Management, and Recycling Funds. -iii- Projections for the next 10 years indicate that property tax contributions, user fees, and investment income will need to be reevaluated to support scheduled replacements. In 2012, the City entered into a Joint Powers Agreement with Ramsey County to form a Joint Development Authority (JDA) to acquire and develop a portion of the Army property, formerly known as TCAAP. The county officially acquired this property April 15, 2013 and has cleaned it to residential standards. The City completed the TCAAP Redevelopment Code (TRC) in late 2016, which guides the land use on the site. The development details of the project are now being negotiated by the interested parties. The status of the JDA is currently in question but any future development on the site is expected to add to the City’s tax base and could include commercial/industrial, residential, and civic uses. The site is approximately 430 acres. RELEVANT FINANCIAL POLICIES Trends of the past decade, changes in state tax law, and recent legislation indicate that the City will have a greater reliance on property taxes as a source of financing for city operations in the future and less reliance on intergovernmental revenues (federal and state). Changes in state tax law over the past few years have resulted in funding changes for both schools and local governments. The elimination of the homestead and agricultural credit aids program, and large cuts in both local government aid and the market value homestead credit programs resulted in revenue losses to the City. MAJOR INITIATIVES The largest initiative on the City’s horizon is the TCAAP project, as previously mentioned. This project is a joint effort between the City, Ramsey County, and a master developer. When completed, this project will represent almost a 40 percent population increase to the City, as well as a significant increase to the commercial and industrial sectors, too. The TCAAP project is expected to be a destination site for the region and serve as a model for future developments. ACKNOWLEDGEMENTS The Government Finance Officers Association (GFOA) awarded a Certificate of Achievement for Excellence in Financial Reporting to the City for its Comprehensive Annual Financial Report (CAFR) for the fiscal year ended December 31, 2017. This is the 12th year that the City has received this prestigious award. In order to be awarded a Certificate of Achievement, the City had to publish an easily readable and efficiently organized CAFR that satisfied both accounting principles generally accepted in the United States of America and applicable legal requirements. A Certificate of Achievement is valid for a period of one year only. We believe that our current CAFR continues to meet the Certificate of Achievement Program’s requirements and we are submitting it to the GFOA to determine its eligibility for another certificate. The preparation of this report would not have been possible without the efficient and dedicated service of the entire staff of the finance department, and through the helpful guidance and assistance from our auditing firm, MMKR. We wish to express our appreciation to all members of the department who assisted and contributed to the preparation of this report. Credit also must be given to the mayor and City Council for their unfailing support in maintaining the highest standards of professionalism in the management of the City’s finances. Respectfully submitted, Dave Perrault City Administrator -iv- -v- Term Expires David Grant Mayor December 31, 2022 Brenda Holden Councilmember December 31, 2020 Fran Holmes Councilmember December 31, 2022 Dave McClung Councilmember December 31, 2020 Steve Scott Councilmember December 31, 2022 Dave Perrault City Administrator Gayle Bauman Finance Director Julie Hanson City Clerk Joel Jamnik City Attorney CITY COUNCIL APPOINTED OFFICIALS CITY OF ARDEN HILLS RAMSEY COUNTY, MINNESOTA City Council and Appointed Officials December 31, 2018 2018 City of Arden Hills Organization Chart-vi- FINANCIAL SECTION TAB C E R T I F I E D A C C O U N T A N T S P UBLIC PRINCIPALS Thomas A. Karnowski, CPA Paul A. Radosevich, CPA William J. Lauer, CPA James H. Eichten, CPA Aaron J. Nielsen, CPA Victoria L. Holinka, CPA/CMA Jaclyn M. Huegel, CPA Malloy, Montague, Karnowski, Radosevich & Co., P.A. 5353 Wayzata Boulevard • Suite 410 • Minneapolis, MN 55416 • Phone: 952-545-0424 • Fax: 952-545-0569 • www.mmkr.com -1- INDEPENDENT AUDITOR’S REPORT To the City Council and Management City of Arden Hills, Minnesota REPORT ON THE FINANCIAL STATEMENTS We have audited the accompanying financial statements of the governmental activities, the business-type activities, each major fund, and the aggregate remaining fund information of the City of Arden Hills, Minnesota (the City) as of and for the year ended December 31, 2018, and the related notes to the financial statements, which collectively comprise the City’s basic financial statements as listed in the table of contents. MANAGEMENT’S RESPONSIBILITY FOR THE FINANCIAL STATEMENTS Management is responsible for the preparation and fair presentation of these financial statements in accordance with accounting principles generally accepted in the United States of America; this includes the design, implementation, and maintenance of internal control relevant to the preparation and fair presentation of financial statements that are free from material misstatement, whether due to fraud or error. AUDITOR’S RESPONSIBILITY Our responsibility is to express opinions on these financial statements based on our audit. We conducted our audit in accordance with auditing standards generally accepted in the United States of America and the standards applicable to financial audits contained in Government Auditing Standards, issued by the Comptroller General of the United States. Those standards require that we plan and perform the audit to obtain reasonable assurance about whether the financial statements are free from material misstatement. An audit involves performing procedures to obtain audit evidence about the amounts and disclosures in the financial statements. The procedures selected depend on the auditor’s judgment, including the assessment of the risks of material misstatement of the financial statements, whether due to fraud or error. In making those risk assessments, the auditor considers internal control relevant to the City’s preparation and fair presentation of the financial statements in order to design audit procedures that are appropriate in the circumstances, but not for the purpose of expressing an opinion on the effectiveness of the City’s internal control. Accordingly, we express no such opinion. An audit also includes evaluating the appropriateness of accounting policies used and the reasonableness of significant accounting estimates made by management, as well as evaluating the overall presentation of the financial statements. We believe that the audit evidence we have obtained is sufficient and appropriate to provide a basis for our audit opinions. (continued) -2- OPINIONS In our opinion, the financial statements referred to on the previous page present fairly, in all material respects, the respective financial position of the governmental activities, the business-type activities, each major fund, and the aggregate remaining fund information of the City as of December 31, 2018, and the respective changes in financial position and, where applicable, cash flows thereof for the year then ended, in accordance with accounting principles generally accepted in the United States of America. OTHER MATTERS Required Supplementary Information Accounting principles generally accepted in the United States of America require that the management’s discussion and analysis and the required supplementary information (RSI), as listed in the table of contents, be presented to supplement the basic financial statements. Such information, although not a part of the basic financial statements, is required by the Governmental Accounting Standards Board, who considers it to be an essential part of financial reporting for placing the basic financial statements in an appropriate operational, economic, or historical context. We have applied certain limited procedures to the RSI in accordance with auditing standards generally accepted in the United States of America, which consisted of inquiries of management about the methods of preparing the information and comparing the information for consistency with management’s responses to our inquiries, the basic financial statements, and other knowledge we obtained during our audit of the basic financial statements. We do not express an opinion or provide any assurance on the information because the limited procedures do not provide us with sufficient evidence to express an opinion or provide any assurance. Other Information Our audit was conducted for the purpose of forming opinions on the financial statements that collectively comprise the City’s basic financial statements. The introductory section, supplemental information, and statistical section, as listed in the table of contents, are presented for purposes of additional analysis and are not required parts of the basic financial statements. The supplemental information is the responsibility of management and was derived from and relates directly to the underlying accounting and other records used to prepare the basic financial statements. Such information has been subjected to the auditing procedures applied in the audit of the basic financial statements and certain additional procedures, including comparing and reconciling such information directly to the underlying accounting and other records used to prepare the basic financial statements or to the basic financial statements themselves, and other additional procedures in accordance with auditing standards generally accepted in the United States of America. In our opinion, the supplemental information is fairly stated, in all material respects, in relation to the basic financial statements as a whole. The introductory and statistical sections have not been subjected to the auditing procedures applied in the audit of the basic financial statements and, accordingly, we do not express an opinion or provide any assurance on them. (continued) -3- OTHER REPORTING REQUIRED BY GOVERNMENT AUDITING STANDARDS In accordance with Government Auditing Standards, we have also issued our report dated May 2, 2019 on our consideration of the City’s internal control over financial reporting and on our tests of its compliance with certain provisions of laws, regulations, contracts, grant agreements, and other matters. The purpose of that report is solely to describe the scope of our testing of internal control over financial reporting and compliance and the results of that testing, and not to provide an opinion on the effectiveness of the City’s internal control over financial reporting or on compliance. That report is an integral part of an audit performed in accordance with Government Auditing Standards in considering the City’s internal control over financial reporting and compliance. Minneapolis, Minnesota May 2, 2019 THIS PAGE INTENTIONALLY LEFT BLANK CITY OF ARDEN HILLS Management’s Discussion and Analysis Year Ended December 31, 2018 -4- As the management of the City of Arden Hills, Minnesota (the City), we offer readers of the City’s Comprehensive Annual Financial Report (CAFR) this narrative overview and analysis of the financial activities of the City for the fiscal year ended December 31, 2018. We encourage readers to consider the information presented here in conjunction with additional information that we have furnished in our letter of transmittal, which is presented in the introductory section of this report. FINANCIAL HIGHLIGHTS • The assets and deferred outflows of resources of the City exceeded liabilities and deferred inflows of resources at the close of the most recent fiscal year by $55,345,516 (net position). Of this amount, $10,066,181 (unrestricted net position) may be used to meet the City’s ongoing obligations to citizens and creditors. • The City’s total net position increased by $3,427,437 in 2018. • As of the close of the current fiscal year, the City’s governmental funds reported combined ending fund balances of $7,543,820. Of this total amount, $25,696 is nonspendable and $1,010,521 is restricted, leaving an unrestricted balance of $6,507,603. • At the end of the current fiscal year, the General Fund has a total fund balance of $3,340,369. At December 31, 2018, the unassigned fund balance of the General Fund was, $3,052,082 or 60.3 percent, of the subsequent year’s budgeted expenditures. OVERVIEW OF THE FINANCIAL STATEMENTS This discussion and analysis is intended to serve as an introduction to the City’s basic financial statements. The City’s basic financial statements include three components: 1) government-wide financial statements, 2) fund financial statements, and 3) notes to basic financial statements. This report also contains other supplementary information in addition to the basic financial statements themselves. Government-Wide Financial Statements – The government-wide financial statements are designed to provide readers with a broad overview of the City’s finances, in a manner similar to a private sector business. The Statement of Net Position presents information on all of the City’s assets, liabilities, and deferred inflows/outflows of resources, with the difference reported as net position. Over time, increases or decreases in net position may serve as a useful indicator of whether the financial position of the City is improving or deteriorating. The Statement of Activities presents information showing how the City’s net position changed during the most recent fiscal year. All changes in net position are reported as soon as the underlying event giving rise to the change occurs, regardless of the timing of related cash flows. Thus, revenues and expenses are reported in this statement for some items that will only result in cash flows in future fiscal periods (e.g., uncollected taxes and earned but unused vacation leave). -5- Both of the government-wide financial statements distinguish functions of the City that are principally supported by taxes and intergovernmental revenues (governmental activities) from other functions that are intended to recover all or a significant portion of their costs through user fees and charges (business-type activities). The governmental activities of the City include general government, public safety, public works, parks and recreation, and economic development. The business-type activities of the City include water, sewer, surface water management, and recycling. The government-wide financial statements can be found in the financial section following this report. Fund Financial Statements – A fund is a grouping of related accounts that is used to maintain control over resources that have been segregated for specific activities or objectives. The City, like other state and local governments, uses fund accounting to ensure and demonstrate compliance with finance-related legal requirements. All of the funds of the City can be divided into two categories: governmental funds and proprietary funds. Governmental Funds – Governmental funds are used to account for essentially the same functions reported as governmental activities in the government-wide financial statements. However, unlike the government-wide financial statements, governmental funds financial statements focus on near-term inflows and outflows of spendable resources, as well as on balances of spendable resources available at the end of the fiscal year. Such information may be useful in evaluating a City’s near-term financing requirements. Because the focus of governmental funds is narrower than that of the government-wide financial statements, it is useful to compare the information presented for governmental funds with similar information presented for governmental activities in the government-wide financial statements. By doing so, readers may better understand the long-term impact of the government’s near-term financing decisions. Both the governmental funds Balance Sheet and Statement of Revenues, Expenditures, and Changes in Fund Balances provide a reconciliation to facilitate this comparison between governmental funds and governmental activities. The City maintains four individual major governmental funds. Information is presented separately in the governmental funds Balance Sheet and Statement of Revenues, Expenditures, and Changes in Fund Balances for the General; EDA Operating; Equipment, Building, and Replacement; and Permanent Improvement Revolving Funds, which are considered to be major funds. Data from all other governmental funds are combined into a single, aggregated presentation. Individual fund data for each of these nonmajor governmental funds is provided in the form of combining statements elsewhere in this report. The City adopts an annual appropriated budget for its General Fund and special revenue funds. A budgetary comparison schedule has been provided for these funds to demonstrate compliance with this budget. The basic governmental funds financial statements can be found in the financial section of this report immediately following the government-wide financial statements. -6- Proprietary Funds – The City maintains two different types of proprietary funds. Proprietary funds provide the same type of information as the government-wide financial statements, only in more detail. Enterprise funds are used to report the same functions presented as business-type activities in the government-wide financial statements. The City uses enterprise funds to account for its water, sewer, surface water management, and recycling operations. Water, sewer, and surface water management are considered to be major funds of the City. Internal service funds are an accounting device used to accumulate and allocate costs internally among the City’s various functions. The City maintains internal service funds for risk management, engineering, central garage, and technology. Because these services predominately benefit governmental rather than business-type functions, they have been included within governmental activities in the government-wide financial statements. The proprietary funds financial statements can be found in the financial section of this report immediately following the governmental funds statements. Notes to Basic Financial Statements – The notes to basic financial statements provide additional information that is essential to a full understanding of the data provided in the government-wide and fund financial statements. The notes to basic financial statements can be found following the proprietary funds statements within the financial section of this report. Other Information – In addition to the basic financial statements and accompanying notes, the financial section also presents required supplementary information, and the combining and individual fund statements and schedules (presented as supplemental information) referred to earlier in connection with nonmajor governmental funds and internal service funds, which are presented immediately following the basic financial statements. Further, a statistical section has been included as part of the CAFR to facilitate additional analysis, and is the third and final section of the report. GOVERNMENT-WIDE FINANCIAL ANALYSIS An analysis of the City’s financial position begins with a review of the Statement of Net Position and the Statement of Activities. These two statements report the City’s net position and changes in net position. It should be noted that the financial position can also be affected by nonfinancial factors, including economic conditions, population growth, and new regulations. As noted earlier, net position may serve over time as a useful indicator of the City’s financial position. As presented in the following condensed version of the Statement of Net Position, the City’s assets and deferred outflows of resources exceeded liabilities and deferred inflows of resources by $55,345,516 at December 31, 2018. The largest portion of the City’s net position, $44,268,814, or 80.0 percent, reflects its net investment in capital assets (e.g., land, construction in progress, buildings and structures, infrastructure and improvements, distribution and collection systems, machinery and equipment, office furniture and equipment, and vehicles) less any related debt used to acquire those assets that is still outstanding. The City uses these capital assets to provide services to citizens; consequently, these assets are not available for future spending. Although the City’s investment in its capital assets are reported net of related debt, it should be noted that the resources needed to repay this debt must be provided from other sources; since the capital assets themselves cannot be used to liquidate these liabilities. -7- The following table provides the City’s Summary of Net Position: 2018 2017 2018 2017 2018 2017 Assets Current and other assets 12,852,671$ 14,155,756$ 3,252,652$ 2,312,905$ 16,105,323$ 16,468,661$ Capital assets 26,972,898 22,750,377 19,867,868 16,292,000 46,840,766 39,042,377 Total assets 39,825,569$ 36,906,133$ 23,120,520$ 18,604,905$ 62,946,089$ 55,511,038$ Deferred outflows of resources Pension plan deferments – PERA 183,899$ 311,733$ 47,339$ 129,205$ 231,238$ 440,938$ Liabilities Long-term liabilities outstanding 891,506$ 1,020,742$ 3,014,867$ 541,973$ 3,906,373$ 1,562,715$ Other liabilities 2,056,217 1,204,043 1,336,827 387,738 3,393,044 1,591,781 Total liabilities 2,947,723$ 2,224,785$ 4,351,694$ 929,711$ 7,299,417$ 3,154,496$ Deferred inflows of resources Pension plan deferments – PERA 318,242$ 353,646$ 190,981$ 213,655$ 509,223$ 567,301$ State aid received for subsequent years 23,171 312,100 – – 23,171 312,100 Total deferred inflows of resources 341,413$ 665,746$ 190,981$ 213,655$ 532,394$ 879,401$ Net position Net investment in capital assets 26,972,898$ 22,750,377$ 17,295,916$ 16,292,000$ 44,268,814$ 39,042,377$ Restricted 1,010,521 898,739 – – 1,010,521 898,739 Unrestricted 8,736,913 10,678,219 1,329,268 1,298,744 10,066,181 11,976,963 Total net position 36,720,332$ 34,327,335$ 18,625,184$ 17,590,744$ 55,345,516$ 51,918,079$ Activities Activities Total Governmental Business-Type Summary of Net Position as of December 31, 2018 and 2017 Table 1 Restricted net position of $1,010,521 comprises 1.8 percent of net position at the close of the fiscal year ended December 31, 2018. These assets are subject to external restrictions on how they may be used. The balance of unrestricted net position, $10,066,181, or approximately 18.2 percent, may be used to meet the City’s ongoing obligations to citizens and creditors. Certain balances within unrestricted net position may have internally imposed commitments or limitations, which may further limit the purpose for which such net position may be used. At the end of the current fiscal year, the City is able to report positive balances in all three categories of net position, both for the government as a whole, as well as for its separate governmental and business-type activities. The same situation held true for the prior fiscal year. Both governmental activities and business-type activities experienced changes in deferred outflows of resources, deferred inflows of resources, and long-term liabilities as a result of the City’s participation in a state-wide defined benefit pension plan. The business-type activities long-term liabilities increased in the current year, due to the issuance of revenue bonds. -8- The following table provides a condensed version of the Statement of Activities for the year ended December 31, 2018 with comparative amounts for the year ended December 31, 2017: 2018 2017 2018 2017 2018 2017 Revenues Program revenues Charges for services 954,357$ 1,360,377$ 5,000,052$ 4,817,275$ 5,954,409$ 6,177,652$ Operating grants and contributions 840,634 2,031,474 27,429 24,655 868,063 2,056,129 Capital grants and contributions 2,494,823 448,945 735,220 92,566 3,230,043 541,511 General revenues Property taxes 3,578,894 3,526,347 – – 3,578,894 3,526,347 Tax increment collections 351,569 295,788 – – 351,569 295,788 Franchise taxes 101,237 109,070 – – 101,237 109,070 Unrestricted investment earnings 159,316 139,347 40,371 32,754 199,687 172,101 Total revenues 8,480,830 7,911,348 5,803,072 4,967,250 14,283,902 12,878,598 Expenses General government 1,286,845 1,322,106 – – 1,286,845 1,322,106 Public safety 2,248,540 2,158,835 – – 2,248,540 2,158,835 Public works 1,695,449 3,512,218 – – 1,695,449 3,512,218 Parks and recreation 765,843 759,737 – – 765,843 759,737 Economic development 391,156 276,841 – – 391,156 276,841 Water – – 2,147,359 2,159,874 2,147,359 2,159,874 Sewer – – 1,654,079 1,780,260 1,654,079 1,780,260 Surface water management – – 499,049 481,026 499,049 481,026 Recycling – – 168,145 147,919 168,145 147,919 Total expenses 6,387,833 8,029,737 4,468,632 4,569,079 10,856,465 12,598,816 Increase (decrease) in net position before transfers 2,092,997 (118,389) 1,334,440 398,171 3,427,437 279,782 Transfers 300,000 230,765 (300,000) (230,765) – – Increase in net position 2,392,997 112,376 1,034,440 167,406 3,427,437 279,782 Net position – beginning 34,327,335 34,214,959 17,590,744 17,423,338 51,918,079 51,638,297 Net position – ending 36,720,332$ 34,327,335$ 18,625,184$ 17,590,744$ 55,345,516$ 51,918,079$ Activities Activities Total Table 2 Changes in Net Position Years Ended December 31, 2018 and 2017 Governmental Business-Type Governmental Activities – Current year operating results of governmental activities increased net position by $2,392,997, compared to an increase of $112,376 in the prior year. Changes from the prior year included the following: • Operating grants and contributions were down, due to a one-time reimbursement from Ramsey County for its share of a joint street project in the prior year. • Capital grants and contributions were up, due to significant assessments in the current year for street projects and due to contributions from Ramsey County and Bethel University for the trail project. • Public works spending was down in the current year, due to the contribution of capital assets to Ramsey County in the prior year for a multi-year street project accumulated by the City as part of the joint street project. Business-Type Activities – Current year operating results of business-type activities increased net position by $1,034,440, due to positive results of the utility operations of the City. The increase in capital grants and contributions noted above is due to a grant from the state for a utility project in the current year. Program revenues exceeded program expenses for each of the City’s business-type activities, except recycling. -9- Below are specific graphs that provide comparisons of the governmental activities revenue and expenses: -10- Below are specific graphs that provide comparisons of the business-type activities revenue and expenses: -11- FINANCIAL ANALYSIS OF THE GOVERNMENT’S FUNDS As noted earlier, the City uses fund accounting to ensure and demonstrate compliance with finance-related legal requirements. Governmental Funds – The focus of the City’s governmental funds is to provide information on near-term inflows, outflows, and balances of spendable resources. Such information is useful in assessing the City’s financing requirements. In particular, unassigned fund balance may serve as a useful measure of a government’s net resources available for spending at the end of the fiscal year. As of the end of the current fiscal year, the City’s governmental funds reported combined ending fund balances of $7,543,820, a decrease of $3,166,142 in comparison with the prior year. Committed, assigned, and unassigned fund balance, which are available for spending at the government’s discretion, have a total balance of $6,507,603 at year-end. The remainder of fund balance is nonspendable or restricted to indicate that it is not available for new spending because it has already been obligated: 1) for tax increment purposes ($747,898), 2) for cable TV purposes ($262,623), or 3) is not in spendable form for prepaid items ($25,696). The General Fund is the chief operating fund of the City. At the end of the current fiscal year, unassigned fund balance of the General Fund was $3,052,082, while total fund balance equaled $3,340,369. As a measure of the General Fund’s liquidity, it may be useful to compare the unassigned fund balance to expenditures. Unassigned fund balance represents 60.3 percent of the total subsequent year General Fund expenditures. The City’s General Fund equity decreased by $298,948 during the current fiscal year, compared to a $637,225 decrease approved in the final budget; this was due to favorable revenue and expenditure variances, with several departments spending less than amounts approved in the budget mainly in personal services and other services and charges. Conservative budgeting for less predictable sources such as licenses and permits and charges for services contributed to the favorable revenue variance. Fund balance in the EDA Operating Fund increased by $205,183, which compares to an anticipated fund balance increase of $43,888. Tax increment collections and earnings on investments were $2,611 more than expected in the final budget, while expenditures were $158,682 below appropriations. Equity in the Equipment, Building, and Replacement Fund increased by $476,171 as revenues and other financing sources exceeded expenditures in the current year. The General Fund, Water Fund, Sewer Fund, and Surface Water Management Fund made transfers totaling $750,000 to this fund in the current year. Fund balance in the Permanent Improvement Revolving Fund decreased by $3,423,480 in the current year. Total expenditures exceeded current year revenues and transfers from the General Fund based on the timing of street and trail projects. Proprietary Funds – The City’s proprietary funds provide the same type of information found in the government-wide financial statements, but in more detail. Unrestricted net position in the respective proprietary funds includes: $988,428 for water, $190,893 for sewer, $26,510 for surface water management, and $123,437 for recycling. Water net position increased $659,907, sewer net position increased $110,089, surface water management net position increased $272,566, and recycling net position decreased $8,122 during the year. -12- GENERAL FUND BUDGETARY HIGHLIGHTS Total General Fund revenues were $8,052 more than estimated in the budget. Licenses and permits and charges for services revenue exceeded budgeted levels by $201,844 and $27,103, respectively, with development activity surpassing expected amounts. An unfavorable variance in property taxes offset the favorable variances previously discussed. Expenditures within the General Fund were less than budget by $330,225 spread across several functions, but most noticeably in general government, mainly in personal services and other services and charges. During the year, the City Council approved one budget amendment increasing transfers out by $400,000, moving available resources to the Equipment, Building, and Replacement Fund. CAPITAL ASSETS AND LONG-TERM LIABILITIES Capital Assets – The City’s investment in capital assets for its governmental and business-type activities as of December 31, 2018 amounts to $46,840,766 (net of accumulated depreciation). This investment in capital assets includes items such as land, construction in progress, buildings and structures, infrastructure and improvements, distribution and collection systems, machinery and equipment, office furniture and equipment, and vehicles. The total increase in the City’s investment in capital assets for the current fiscal year was 20.0 percent (an increase of 18.6 percent for governmental activities and an increase of 21.9 percent for business-type activities). 2018 2017 2018 2017 2018 2017 Land 2,679,818$ 2,679,818$ –$ –$ 2,679,818$ 2,679,818$ Construction in progress 5,350,261 552,481 3,328,994 324,945 8,679,255 877,426 Buildings and structures 3,404,870 3,594,986 663,234 704,778 4,068,104 4,299,764 Infrastructure and improvements 13,853,074 14,242,467 – – 13,853,074 14,242,467 Distribution and collection systems – – 15,797,304 15,173,947 15,797,304 15,173,947 Machinery and equipment 300,821 300,958 78,336 88,330 379,157 389,288 Office furniture and equipment 44,326 57,236 – – 44,326 57,236 Vehicles 1,339,728 1,322,431 – – 1,339,728 1,322,431 Total 26,972,898$ 22,750,377$ 19,867,868$ 16,292,000$ 46,840,766$ 39,042,377$ Table 3 Capital Assets (Net of Depreciation) Total Business-Type Activities Governmental Activities Increases in the current year included ongoing projects for streets, related utility infrastructure, and trails, contributing to the changes in the table above as of year-end. Additional information on the City’s capital assets can be found in Note 3 of the notes to basic financial statements. -13- Long-Term Liabilities – At the end of the current fiscal year, the City had total bonded debt outstanding of $2,415,000, which is secured by specified revenue sources. 2018 2017 2018 2017 2018 2017 Utility revenue bonds –$ –$ 2,415,000$ –$ 2,415,000$ –$ Premium – – 156,952 – 156,952 – Compensated absences 78,302 49,694 46,744 44,716 125,046 94,410 Net pension liability 813,204 971,048 396,171 497,257 1,209,375 1,468,305 Total 891,506$ 1,020,742$ 3,014,867$ 541,973$ 3,906,373$ 1,562,715$ Total Governmental Business-Type Activities Activities Table 4 Outstanding Debt Summary of Long-Term Debt State statutes limit the amount of net debt a Minnesota city may issue to 3 percent of total estimated market value. During the current year, the City issued $2,415,000 in utility revenue bonds for various projects. As previously discussed, the net pension liability decreased from the prior year for the change in the City’s proportionate share of pension obligations for the Public Employees Retirement Association – General Employees Retirement Fund state-wide pension plan. Additional information on the City’s long-term liabilities can be found in Note 4 of the notes to basic financial statements. ECONOMIC FACTORS AND NEXT YEAR’S BUDGETS AND RATES • Dramatic increases in local government aids and other state sources are not anticipated based on legislation at the time of writing this report. • Property tax collection rates are expected to remain strong, at or near the 2018 level. All of these factors were considered in preparing the City’s budget for the 2019 fiscal year. REQUESTS FOR INFORMATION This CAFR is designed to provide a general overview of the City’s finances for all those with an interest in the City’s finances. Questions concerning any of the information provided in this report or requests for additional financial information should be addressed to the finance department, 1245 West Highway 96, Arden Hills, Minnesota 55112. BASIC FINANCIAL STATEMENTS TAB Governmental Business-Type Activities Activities Total Assets Cash and investments 9,125,229$ 1,485,884$ 10,611,113$ Accrued interest receivable 42,248 7,943 50,191 Accounts receivable 644,383 1,250,348 1,894,731 Taxes receivable 105,770 – 105,770 Special assessments receivable 2,223,284 – 2,223,284 Due from other governmental units 686,061 500,000 1,186,061 Prepaid items 25,696 75 25,771 Inventory – 8,402 8,402 Capital assets Nondepreciable 8,030,079 3,328,994 11,359,073 Depreciable, net of accumulated depreciation 18,942,819 16,538,874 35,481,693 Total assets 39,825,569 23,120,520 62,946,089 Deferred outflows of resources Pension plan deferments – PERA 183,899 47,339 231,238 Liabilities Accounts payable 756,926 148,872 905,798 Salaries payable 31,399 20,323 51,722 Deposits payable 506,021 – 506,021 Due to other governmental units 660,739 1,126,730 1,787,469 Accrued interest payable – 40,902 40,902 Unearned revenue 101,132 – 101,132 Long-term liabilities Due within one year 58,727 35,058 93,785 Due in more than one year 832,779 2,979,809 3,812,588 Total long-term liabilities 891,506 3,014,867 3,906,373 Total liabilities 2,947,723 4,351,694 7,299,417 Deferred inflows of resources Pension plan deferments – PERA 318,242 190,981 509,223 State aid received for subsequent years 23,171 – 23,171 Total deferred inflows of resources 341,413 190,981 532,394 Net position Net investment in capital assets 26,972,898 17,295,916 44,268,814 Restricted for Tax increment purposes 747,898 – 747,898 Cable TV 262,623 – 262,623 Unrestricted 8,736,913 1,329,268 10,066,181 Total net position 36,720,332$ 18,625,184$ 55,345,516$ CITY OF ARDEN HILLS Statement of Net Position as of December 31, 2018 See notes to basic financial statements -14- Operating Capital Charges for Grants and Grants and Expenses Services Contributions Contributions Functions/programs Primary government Governmental activities General government 1,286,845$ 214,833$ 70,222$ –$ Public safety 2,248,540 619,406 113,240 38,870 Public works 1,695,449 6,150 649,425 1,185,588 Parks and recreation 765,843 113,968 7,747 1,270,365 Economic development 391,156 – – – Total governmental activities 6,387,833 954,357 840,634 2,494,823 Business-type activities Water 2,147,359 2,256,859 1,232 620,245 Sewer 1,654,079 1,769,466 1,433 114,975 Surface water management 499,049 839,499 945 – Recycling 168,145 134,228 23,819 – Total business-type activities 4,468,632 5,000,052 27,429 735,220 Total primary government 10,856,465$ 5,954,409$ 868,063$ 3,230,043$ General revenues Property taxes Tax increment collections Franchise taxes Unrestricted investment earnings Transfers Total general revenues and transfers Change in net position Net position – beginning Net position – ending CITY OF ARDEN HILLS Statement of Activities Year Ended December 31, 2018 Program Revenues See notes to basic financial statements -15- Governmental Business-Type Activities Activities Total (1,001,790)$ –$ (1,001,790)$ (1,477,024) – (1,477,024) 145,714 – 145,714 626,237 – 626,237 (391,156) – (391,156) (2,098,019) – (2,098,019) – 730,977 730,977 – 231,795 231,795 – 341,395 341,395 – (10,098) (10,098) – 1,294,069 1,294,069 (2,098,019) 1,294,069 (803,950) 3,578,894 – 3,578,894 351,569 – 351,569 101,237 – 101,237 159,316 40,371 199,687 300,000 (300,000) – 4,491,016 (259,629) 4,231,387 2,392,997 1,034,440 3,427,437 34,327,335 17,590,744 51,918,079 36,720,332$ 18,625,184$ 55,345,516$ Changes in Net Position Net (Expense) Revenue and -16- Equipment, Permanent EDA Building, and Improvement General Operating Replacement Revolving Cash and investments 3,850,270$ 506,776$ 260,735$ 2,993,824$ Accrued interest receivable 18,437 2,426 – 14,257 Accounts receivable 8,500 – – 600,000 Taxes receivable 103,456 2,042 – – Special assessments receivable 6,086 – – 2,217,198 Interfund receivable – – – 187,450 Due from other governmental units 126,543 – – 559,518 Prepaid items 25,482 – – – Total assets 4,138,774$ 511,244$ 260,735$ 6,572,247$ Liabilities Accounts payable 92,817$ 363$ 43,833$ 471,062$ Salaries payable 29,042 598 – – Deposits payable 506,021 – – – Interfund payable – – – – Due to other governmental units 30,515 – – 619,173 Unearned revenue 101,132 – – – Total liabilities 759,527 961 43,833 1,090,235 Deferred inflows of resources Unavailable revenue – taxes 32,792 2,042 – – Unavailable revenue – special assessments 6,086 – – 2,201,864 Unavailable revenue – long-term receivable – – – 600,000 State aid received for subsequent years – – – 23,171 Total deferred inflows of resources 38,878 2,042 – 2,825,035 Fund balances (deficits) Nonspendable 25,482 – – – Restricted – – – – Committed – 508,241 – – Assigned 262,805 – 216,902 2,656,977 Unassigned 3,052,082 – – – Total fund balances (deficits)3,340,369 508,241 216,902 2,656,977 Total liabilities, deferred inflows of resources, and fund balances 4,138,774$ 511,244$ 260,735$ 6,572,247$ Fund balances reported above Amounts reported for governmental activities in the Statement of Net Position are different because: Nondepreciable Depreciable Due within one year Due in more than one year Deferred outflows of resources – pension plans Deferred inflows of resources – pension plans Deferred inflows of resources – unavailable revenues Net position of governmental activities Long-term liabilities are not payable with current financial resources and, therefore, are not reported in governmental funds (see Note 4 for more details on components of long-term liabilities). The recognition of certain revenues and expenses/expenditures differ between the full accrual governmental activities financial statements and the modified accrual governmental fund financial statements. as of December 31, 2018 Assets CITY OF ARDEN HILLS Balance Sheet Governmental Funds Capital assets used in governmental activities are not financial resources and, therefore, are not reported in the funds. Internal service funds are used to allocate costs to individual funds. Net position is included in governmental activities in the Statement of Net Position. See notes to basic financial statements -17- Other Total Governmental Intra-Activity Governmental Funds Eliminations Funds 1,097,956$ –$ 8,709,561$ 5,257 – 40,377 35,883 – 644,383 272 – 105,770 – – 2,223,284 – (187,450) – – – 686,061 214 – 25,696 1,139,582$ (187,450)$ 12,435,132$ 129,530$ –$ 737,605$ 1,271 – 30,911 – – 506,021 187,450 (187,450) – – – 649,688 – – 101,132 318,251 (187,450) 2,025,357 – – 34,834 – – 2,207,950 – – 600,000 – – 23,171 – – 2,865,955 214 – 25,696 1,010,521 – 1,010,521 – – 508,241 – – 3,136,684 (189,404) – 2,862,678 821,331 – 7,543,820 1,139,582$ (187,450)$ 12,435,132$ 7,543,820$ 8,030,079 18,942,819 384,212 (56,877) (832,162) 183,899 (318,242) 2,842,784 36,720,332$ -18- Equipment, Permanent EDA Building, and Improvement General Operating Replacement Revolving Revenues Taxes General property taxes 3,578,628$ –$ –$ –$ Tax increments – 2,451 – – Special assessments 5,362 – – 730,007 Licenses and permits 526,444 – – – Intergovernmental 149,097 – – 854,588 Charges for services 427,905 – – – Fines and forfeits 37,080 – – – Earnings on investments 64,996 5,760 – 65,431 Franchise taxes – – – – Antenna rental fees 57,067 – – – Miscellaneous reimbursements 30,700 – – – Other 5,402 – – 150,000 Total revenues 4,882,681 8,211 – 1,800,026 Expenditures Current General government 1,039,772 – – – Public safety 2,088,345 – – – Public works 579,535 – – – Parks and recreation 653,977 – – – Economic development – 58,755 – – Capital outlay General government – – – – Public safety – – 67,301 – Public works – – 237,289 2,679,315 Parks and recreation – – 38,397 2,744,191 Total expenditures 4,361,629 58,755 342,987 5,423,506 Revenues over (under) expenditures 521,052 (50,544) (342,987) (3,623,480) Other financing sources (uses) Sale of capital assets – – 69,158 – Transfers in – 255,727 750,000 200,000 Transfers out (820,000) – – – Total other financing sources (uses)(820,000) 255,727 819,158 200,000 Net changes in fund balances (298,948) 205,183 476,171 (3,423,480) Fund balances (deficits) – beginning 3,639,317 303,058 (259,269) 6,080,457 Fund balances – ending 3,340,369$ 508,241$ 216,902$ 2,656,977$ Year Ended December 31, 2018 CITY OF ARDEN HILLS Statement of Revenues, Expenditures, and Changes in Fund Balances Governmental Funds See notes to basic financial statements -19- Other Total Governmental Intra-Activity Governmental Funds Eliminations Funds –$ –$ 3,578,628$ 349,118 – 351,569 – – 735,369 – – 526,444 – – 1,003,685 – – 427,905 – – 37,080 18,182 – 154,369 101,237 – 101,237 – – 57,067 – – 30,700 63,220 – 218,622 531,757 – 7,222,675 124,885 – 1,164,657 – – 2,088,345 – – 579,535 – – 653,977 265,793 – 324,548 13,770 – 13,770 166,000 – 233,301 – – 2,916,604 650 – 2,783,238 571,098 – 10,757,975 (39,341) – (3,535,300) – – 69,158 50,000 (955,727) 300,000 (135,727) 955,727 – (85,727) – 369,158 (125,068) – (3,166,142) 946,399 – 10,709,962 821,331$ –$ 7,543,820$ -20- THIS PAGE INTENTIONALLY LEFT BLANK Net changes in fund balances – total governmental funds (3,166,142)$ Governmental funds report capital outlays as expenditures. However,in the Statement of Activities the cost of those assets is allocated over their estimated useful lives and reported as depreciation expense. Capital outlay 5,153,974 Depreciation expense (861,410) A gain or loss on the disposal of capital assets, including the difference between the carrying value and any related sale proceeds,is included in the change in net position. However, only the sale proceeds are included in the change in fund balances.(70,043) Adjustments are made between the governmental funds and the Statement of Activities for the long-term liability activity of the net pension liability.157,844 The recognition of certain revenues and expenses/expenditures differ between the full accrual governmental activities financial statements and the modified accrual governmental fund financial statements. Deferred outflows of resources – pension plans (127,834) Deferred inflows of resources – pension plans 35,404 Deferred inflows of resources – unavailable revenues 1,247,573 Internal service funds are used to allocate costs to individual funds. The net revenue of the Internal Service Fund is reported with governmental activities in the government-wide financial statements.51,143 Some expenses reported in the Statement of Activities do not require the use of current financial resources and, therefore, are not reported as expenditures in governmental funds. Compensated absences (27,512) Change in net position of governmental activities 2,392,997$ Amounts reported for governmental activities in the Statement of Activities are different because: CITY OF ARDEN HILLS Reconciliation of the Statement of Revenues, Expenditures, and Changes in Fund Balances to the Statement of Activities Governmental Funds Year Ended December 31, 2018 See notes to basic financial statements -21- Surface Internal Water Nonmajor Service Water Sewer Management Recycling Totals Funds Assets Current assets Cash and investments 1,310,726$ 32,334$ –$ 142,824$ 1,485,884$ 415,668$ Accrued interest receivable 7,055 204 – 684 7,943 1,871 Accounts receivable Customers 500,165 467,232 216,339 6 1,183,742 – Customer accounts certified to county 26,215 30,449 6,783 3,159 66,606 – Interfund receivable 26,268 – – – 26,268 – Due from other governmental units 500,000 – – – 500,000 – Prepaid items 25 25 25 – 75 – Inventory 8,402 – – – 8,402 – Total current assets 2,378,856 530,244 223,147 146,673 3,278,920 417,539 Noncurrent assets Capital assets Buildings and structures 818,476 16,564 – – 835,040 – Distribution and collection systems 10,477,385 9,649,493 4,258,519 – 24,385,397 – Machinery and equipment 315,065 490,962 745 – 806,772 – Office furniture and equipment 5,216 3,199 – – 8,415 – Construction in progress 2,241,881 181,810 905,303 – 3,328,994 – Total capital assets 13,858,023 10,342,028 5,164,567 – 29,364,618 – Less accumulated depreciation (4,441,644) (4,311,598) (743,508) – (9,496,750) – Total capital assets (net of accumulated depreciation)9,416,379 6,030,430 4,421,059 – 19,867,868 – Total assets 11,795,235 6,560,674 4,644,206 146,673 23,146,788 417,539 Deferred outflows of resources Pension plan deferments – PERA 16,104 17,811 13,424 – 47,339 – Liabilities Current liabilities Accounts payable 51,614 77,329 9,060 10,869 148,872 19,321 Salaries payable 6,806 8,091 4,819 607 20,323 488 Interfund payable – – 26,268 – 26,268 – Due to other governmental units 1,096,275 20,253 179 10,023 1,126,730 11,051 Accrued interest payable 35,396 5,506 – – 40,902 – Compensated absences payable 11,630 13,121 9,004 1,303 35,058 1,850 Total current liabilities 1,201,721 124,300 49,330 22,802 1,398,153 32,710 Noncurrent liabilities Bonds payable 2,225,773 346,179 – – 2,571,952 – Compensated absences payable 3,877 4,374 3,001 434 11,686 617 Net pension liability 135,618 153,748 106,805 – 396,171 – Total noncurrent liabilities 2,365,268 504,301 109,806 434 2,979,809 617 Total liabilities 3,566,989 628,601 159,136 23,236 4,377,962 33,327 Deferred inflows of resources Pension plan deferments – PERA 65,316 74,740 50,925 – 190,981 – Net position Net investment in capital assets 7,190,606 5,684,251 4,421,059 – 17,295,916 – Unrestricted 988,428 190,893 26,510 123,437 1,329,268 384,212 Total net position 8,179,034$ 5,875,144$ 4,447,569$ 123,437$ 18,625,184$ 384,212$ Business-Type Activities – Enterprise Funds CITY OF ARDEN HILLS Statement of Net Position Proprietary Funds as of December 31, 2018 See notes to basic financial statements -22- Surface Internal Water Nonmajor Service Water Sewer Management Recycling Totals Funds Operating revenues Charges for services 2,244,311$ 1,764,675$ 838,927$ 124,687$ 4,972,600$ 771,728$ Permit fees 2,773 1,650 – – 4,423 – Miscellaneous 9,775 3,141 572 9,541 23,029 2,619 Total operating revenues 2,256,859 1,769,466 839,499 134,228 5,000,052 774,347 Operating expenses Personal services 283,110 330,239 200,427 25,340 839,116 72,608 Supplies and maintenance 50,433 16,197 6,820 – 73,450 151,808 Other services and charges 386,035 202,897 113,190 18,444 720,566 129,805 Rent 27,415 26,551 11,800 – 65,766 – Insurance 22,710 22,710 22,710 – 68,130 – Utilities 14,180 18,490 – – 32,670 – Purchased services 76,748 55,631 35,935 8,669 176,983 373,930 Purchased water 952,141 – – – 952,141 – Recycling charges – – – 115,692 115,692 – Sewer charges – 794,313 – – 794,313 – Depreciation 260,017 175,456 108,167 – 543,640 – Total operating expenses 2,072,789 1,642,484 499,049 168,145 4,382,467 728,151 Operating income (loss)184,070 126,982 340,450 (33,917) 617,585 46,196 Nonoperating revenues (expenses) Intergovernmental revenue 1,232 1,433 945 23,819 27,429 – Earnings on investments 28,930 4,294 5,171 1,976 40,371 4,947 Interest and fiscal charges (74,570) (11,595)– – (86,165) – Total nonoperating revenues (expenses)(44,408) (5,868) 6,116 25,795 (18,365) 4,947 Income (loss) before contributions and transfers 139,662 121,114 346,566 (8,122) 599,220 51,143 Capital contributions 500,000 – – – 500,000 – Capital contributions – connection fees 120,245 114,975 – – 235,220 – Transfers out (100,000) (126,000) (74,000) – (300,000) – Change in net position 659,907 110,089 272,566 (8,122) 1,034,440 51,143 Net position Beginning of year 7,519,127 5,765,055 4,175,003 131,559 17,590,744 333,069 End of year 8,179,034$ 5,875,144$ 4,447,569$ 123,437$ 18,625,184$ 384,212$ Business-Type Activities – Enterprise Funds CITY OF ARDEN HILLS Statement of Revenues, Expenses, and Changes in Net Position Proprietary Funds Year Ended December 31, 2018 See notes to basic financial statements -23- Surface Internal Water Nonmajor Service Water Sewer Management Recycling Totals Funds Cash flows from operating activities Receipts from customers and users 2,220,238$ 1,759,607$ 841,295$ 134,677$ 4,955,817$ 774,347$ Payments to suppliers (1,202,533) (1,021,872) (150,577) (133,892) (2,508,874) (697,563) Payments to employees (294,054) (343,304) (209,638) (24,291) (871,287) (71,256) Payments for interfund services used (56,565) (58,235) (38,429) (4,165) (157,394) – Net cash flows from operating activities 667,086 336,196 442,651 (27,671) 1,418,262 5,528 Cash flows from noncapital financing activities Grants received 1,232 1,433 945 23,819 27,429 – Cash paid to other funds (26,268) (291,870) – – (318,138) (15,992) Cash received from other funds – – 26,268 – 26,268 – Transfers out (100,000) (126,000) (74,000) – (300,000) – Net cash flows from noncapital financing activities (125,036) (416,437) (46,787) 23,819 (564,441) (15,992) Cash flows from capital and related financing activities Acquisition and construction of capital assets (2,387,967) (346,580) (816,153) – (3,550,700) – Capital contributions – connection fees received 120,245 114,975 – – 235,220 – Proceeds from issuance of revenue bonds 2,231,889 347,133 – – 2,579,022 – Interest paid (45,290) (7,043) – – (52,333) – Net cash flows from noncapital financing activities (81,123) 108,485 (816,153) – (788,791) – Cash flows from investing activities Earnings on investments 26,564 4,090 7,811 2,004 40,469 4,672 Net change in cash and cash equivalents 487,491 32,334 (412,478) (1,848) 105,499 (5,792) Cash and cash equivalents – beginning 823,235 – 412,478 144,672 1,380,385 421,460 Cash and cash equivalents – ending 1,310,726$ 32,334$ –$ 142,824$ 1,485,884$ 415,668$ Reconciliation of operating income (loss) to net cash flows from operating activities Operating income (loss)184,070$ 126,982$ 340,450$ (33,917)$ 617,585$ 46,196$ Adjustments to reconcile operating income (loss) to net cash flows from operating activities Depreciation 260,017 175,456 108,167 – 543,640 – Decrease (increase) in customer receivables (36,621) (9,859) 1,796 449 (44,235) – Decrease (increase) in prepaid items 290 290 290 – 870 23 Decrease (increase) in inventory 889 – – – 889 – Decrease (increase) in deferred outflows 27,953 32,503 21,410 – 81,866 – Increase (decrease) in accounts payable 26,751 38,599 980 3,759 70,089 (16,946) Increase (decrease) in salaries payable 2,739 2,841 1,866 249 7,695 256 Increase (decrease) in due to other governments 242,634 17,793 179 989 261,595 (25,097) Increase (decrease) in net pension liability (34,515) (40,134) (26,437) – (101,086) – Increase (decrease) in compensated absences payable 621 727 (120) 800 2,028 1,096 Increase (decrease) in deferred inflows (7,742) (9,002) (5,930) – (22,674) – Total adjustments 483,016 209,214 102,201 6,246 800,677 (40,668) Net cash flows from operating activities 667,086$ 336,196$ 442,651$ (27,671)$ 1,418,262$ 5,528$ Noncash investing, capital, and financing activities Capital asset purchased on account 568,808$ –$ –$ –$ 568,808$ –$ Due from other governmental units – Contribution 500,000$ –$ –$ –$ 500,000$ –$ Amortization of bond premium (discount)6,116$ 954$ –$ –$ 7,070$ –$ Business-Type Activities – Enterprise Funds CITY OF ARDEN HILLS Statement of Cash Flows Proprietary Funds Year Ended December 31, 2018 See notes to basic financial statements -24- CITY OF ARDEN HILLS Notes to Basic Financial Statements December 31, 2018 -25- NOTE 1 – SIGNIFICANT ACCOUNTING POLICIES A. Organization The City of Arden Hills, Minnesota (the City) was incorporated in 1951 and operates under the “Optional Plan A” form of government as defined in Minnesota Statutes. Under this plan, the government of the City is directed by a council composed of an elected mayor and four elected councilmembers. The City Council exercises legislative authority and determines all matters of policy. The City Council appoints personnel responsible for the proper administration of all affairs relating to the City. The City provides the following municipal services: public safety (police, fire, civil defense, protective inspections, and animal control), highways and streets, sanitation and health, parks and recreation, public improvements, community development, and general administrative services. The accounting policies of the City conform to accounting principles generally accepted in the United States of America as applicable to governmental units. The Governmental Accounting Standards Board (GASB) is the accepted standard-setting body for establishing governmental accounting and financial reporting principles. B. Reporting Entity As required by accounting principles generally accepted in the United States of America, these financial statements include the City (the primary government) and its component unit. Component units are legally separate entities for which the primary government is financially accountable, or for which the exclusion of the component unit would render the financial statements of the primary government misleading. The criteria used to determine if the primary government is financially accountable for a component unit includes whether or not the primary government appoints the voting majority of the potential component unit’s board, is able to impose its will on the potential component unit, is in a relationship of financial benefit or burden with the potential component unit, or is fiscally depended upon by the potential component unit. Blended component units, although legally separate entities, are, in substance, part of the City’s operations; therefore, data from these units are combined with data of the City. The City’s blended component unit has a December 31 year-end. The City has the following component unit: Arden Hills Economic Development Authority (EDA) – The EDA of the City was created pursuant to Minnesota Statutes § 469.090–469.108 to carryout economic and industrial development and redevelopment consistent with policies established by the City Council. It is composed of the members of the City Council and the City has operational responsibility for the component unit. The EDA’s activities are blended and reported in separate special revenue funds. Separate financial statements are not issued for this component unit. -26- NOTE 1 – SIGNIFICANT ACCOUNTING POLICIES (CONTINUED) C. Government-Wide Financial Statement Presentation The government-wide financial statements (Statement of Net Position and Statement of Activities) display information about the reporting government as a whole. These statements include all of the financial activities of the City. Governmental activities, which are normally supported by taxes and intergovernmental revenues, are reported separately from business-type activities, which significantly rely upon sales, fees, and charges for support. The Statement of Activities demonstrates the degree to which the direct expenses of a given function or segment are offset by program revenues. Direct expenses are those that are clearly identifiable with a specific function or segment. Program revenues include: 1) charges to customers or applicants who purchase, use, or directly benefit from goods, services, or privileges provided by a given function or segment, 2) operating grants and contributions, and 3) capital grants and contributions, including special assessments that are restricted to meeting the operational or capital requirements of a particular function or segment. Taxes and other internally directed revenues are reported as general revenues. The government-wide financial statements are reported using the economic resources measurement focus and the accrual basis of accounting. Revenues are recorded when earned and expenses are recorded when a liability is incurred, regardless of the timing of related cash flows. Property taxes and special assessments are recognized as revenues in the fiscal year for which they are certified for levy. Grants and similar items are recognized when all eligibility requirements imposed by the provider have been met. As a general rule, the effect of interfund activity has been eliminated from the government-wide financial statements. However, charges between the City’s enterprise funds and other functions are not eliminated, as that would distort the direct costs and program revenues reported in those functions. Depreciation expense is included in the direct expenses of each function. Interest on long-term debt is considered an indirect expense and is reported separately on the Statement of Activities. D. Fund Financial Statement Presentation Separate fund financial statements are provided for governmental and proprietary funds. Major individual governmental and enterprise funds are reported as separate columns in the fund financial statements. Aggregated information for the remaining nonmajor governmental funds is reported in a single column in the fund financial statements. Governmental fund financial statements are reported using the current financial resources measurement focus and the modified accrual basis of accounting. Under this basis of accounting, transactions are recorded in the following manner: 1. Revenue Recognition – Revenue is recognized when it becomes measurable and available. “Measurable” means the amount of the transaction can be determined and “available” means collectible within the current period or soon enough thereafter to be used to pay liabilities of the current period. For this purpose, the City considers revenues to be available if they are collected within 60 days after year-end. Only the portion of special assessments receivable due within the current fiscal period is considered to be susceptible to accrual as revenue of the current period. Grants and similar items are recognized when all eligibility requirements imposed by the provider have been met. Proceeds of long-term debt and acquisitions under capital leases, when applicable, are reported as other financing sources. Major revenue that is susceptible to accrual includes property taxes, special assessments, intergovernmental revenue, charges for services, and interest earned on investments. Major revenue that is not susceptible to accrual includes licenses and permits, fees, and miscellaneous revenue. Such revenue is recorded only when received because it is not measurable until collected. -27- NOTE 1 – SIGNIFICANT ACCOUNTING POLICIES (CONTINUED) 2. Recording of Expenditures – Expenditures are generally recorded when a liability is incurred, except for principal and interest on long-term debt and other long-term obligations, which are recognized as expenditures to the extent they have matured. Capital asset acquisitions are reported as capital outlay expenditures in the governmental funds. Proprietary fund financial statements are reported using the economic resources measurement focus and accrual basis of accounting, similar to the government-wide financial statements. Proprietary funds distinguish operating revenues and expenses from nonoperating items. Operating revenues and expenses generally result from providing services and producing and delivering goods in connection with a proprietary fund’s principal ongoing operations. The principal operating revenues of the City’s enterprise funds and internal service funds are charges to customers for sales and services. The operating expenses for the enterprise funds and internal service funds include the cost of sales and services, administrative expenses, and depreciation on capital assets. All revenues and expenses that do not meet this definition are reported as nonoperating revenues and expenses. Aggregated information for the internal service funds is reported in a single column in the proprietary fund financial statements. Because the principal user of the internal services is the City’s governmental activities, the financial statements of the internal service funds are consolidated into the governmental column when presented in the government-wide financial statements. The cost of these services is reported in the appropriate functional activity. Description of Funds The City reports the following major governmental funds: General Fund – The General Fund is the City’s primary operating fund. It accounts for all financial resources of the general government, except those required to be accounted for in another fund. EDA Operating Fund – The EDA Operating Fund (special revenue fund) accounts for revenue sources, including tax increments and other sources, that are legally restricted or committed to expenditures for specified purposes (not including major capital projects). Equipment, Building, and Replacement Fund – The Equipment, Building, and Replacement Fund (capital project fund) was established for resources designated to be used for the purchase of capital equipment and building repairs. Permanent Improvement Revolving Fund – The Permanent Improvement Revolving Fund (capital project fund) accounts for the acquisition of capital assets or construction for major capital projects not being financed by proprietary funds. The City reports the following major proprietary funds: Water Fund – The Water Fund accounts for the water service charges, which are used to finance the water system operations. Sewer Fund – The Sewer Fund accounts for the sewer service charges, which are used to finance the sanitary sewer system operations. Surface Water Management Fund – The Surface Water Management Fund accounts for the surface water charges, which are used to finance the surface water system operations. -28- NOTE 1 – SIGNIFICANT ACCOUNTING POLICIES (CONTINUED) The City reports the following nonmajor proprietary fund: Recycling Fund – The Recycling Fund accounts for the recycling service charges, which are used to finance the City’s recycling operations. Additionally, the City reports the following fund type: Internal Service Funds – The internal service funds account for the financing of goods or services provided by one department or agency to other departments or agencies of the City, or to other governments on a cost reimbursement basis. The City’s internal service funds account for risk management, engineering, central garage, and technology services. E. Budgets and Budgetary Accounting Budgets are legally adopted on a basis consistent with accounting principles generally accepted in the United States of America. Annual appropriated budgets are legally adopted for the General Fund and all special revenue funds. Budgeted expenditure appropriations lapse at year-end, but may be adopted in the subsequent year. The City follows these procedures in establishing the budgetary data reflected in the financial statements: 1. The city administrator submits to the City Council a proposed operating budget for the fiscal year commencing the following January 1. The operating budget includes proposed expenditures and the means of financing them. 2. Public hearings are conducted to obtain taxpayer comments. 3. The budget is legally enacted through passage of a resolution. The appropriated budget is prepared by fund, function, and department. The City’s department heads, with the approval of the city administrator, may make transfers of appropriations within a department. Transfers of appropriations between funds require the approval of the City Council. The legal level of budgetary control is the fund level. Budgeted amounts are as amended by the City Council. 4. The city administrator is authorized to transfer appropriations within any fund budget. Adjustments to appropriations between funds, and budget additions and deletions must be authorized by the City Council. 5. Formal budgetary integration is employed as a management control device during the year for the General Fund and special revenue funds. 6. Legal debt obligation indentures determine the appropriation level and debt service tax levies for the Debt Service Fund (if necessary). Supplementary budgets are adopted for the proprietary funds to determine and calculate user charges. These debt service and budget amounts represent general obligation bond indenture provisions and net income for operation and capital maintenance, and are not reflected in the financial statements. 7. A capital improvement program is reviewed annually by the City Council for the capital project funds. However, appropriations for major projects are not adopted until the actual bid award of the improvement. The appropriations are not reflected in the financial statements. For the year ended December 31, 2018, actual expenditures exceeded budgeted expenditures in the EDA Revolving Fund and EDA TIF District No. 4 Fund by $34,208 and $90,559, respectively. These variances were financed by revenues in excess of budget and available fund balance. -29- NOTE 1 – SIGNIFICANT ACCOUNTING POLICIES (CONTINUED) F. Cash and Investments Cash and investments include balances that are combined and invested to the extent available in various securities as authorized by state law. Allocations of pooled investment earnings to the respective funds is based on participation by each fund. For purposes of the Statement of Cash Flows, the City considers all highly liquid debt instruments with an original maturity from the time of purchase by the City of three months or less to be cash equivalents. The proprietary funds’ portion in the government-wide cash and investment management pool is considered to be cash equivalent. The City generally reports investments at fair value. The Minnesota Municipal Money Market (4M) Fund is an external investment pool regulated by Minnesota Statutes that is not registered with the Securities and Exchange Commission (SEC), but follows the same regulatory rules of the SEC. The fair value of the position in the pool is the same as the value of the pool shares, which is based on an amortized cost method that approximates fair value. The 4M Fund is sponsored by the League of Minnesota Cities. For this investment pool, there are no unfunded commitments, redemption frequency is daily, and there is no redemption notice required for the Liquid Class; the redemption notice period is 14 days for the Plus Class. The City categorizes its fair value measurements within the fair value hierarchy established by accounting principles generally accepted in the United States of America. The hierarchy is based on the valuation inputs used to measure the fair value of the asset. Level 1 inputs are quoted prices in active markets for identical assets; Level 2 inputs are significant other observable inputs; and Level 3 inputs are significant unobservable inputs. Debt securities classified in Level 2 of the fair value hierarchy are valued using a matrix pricing technique. Matrix pricing is used to value securities based on the securities’ relationship to benchmark quoted prices. See Note 2 for the City’s recurring fair value measurements as of year-end. G. Interfund Receivables and Payables During the course of operations, numerous transactions occur between individual funds for goods provided or services rendered. Short-term interfund loans are classified as “interfund receivables/payables.” All short-term interfund receivables and payables at year-end are planned to be eliminated in the subsequent year. Long-term interfund loans are classified as “advances receivable/payable.” Any residual balances outstanding between the governmental activities and business-type activities are reported in the government-wide financial statements as “internal balances.” H. Receivables Property taxes and special assessments receivable have been reported net of estimated uncollectible accounts (see Note 1 I. and J.). Because utility bills are considered liens on property, no estimated uncollectible amounts are established. Uncollectible amounts are not material for other receivables and have not been reported. The only receivables not expected to be collected within one year are property taxes and special assessments receivable. -30- NOTE 1 – SIGNIFICANT ACCOUNTING POLICIES (CONTINUED) I. Property Taxes Property tax levies are set by the City Council in December of each year, and are certified to Ramsey County for collection in the following year. In Minnesota, counties act as collection agents for all property taxes. The county spreads the levies over all taxable property. Such taxes become a lien on January 1 and are recorded as receivables by the City on that date. Real property taxes may be paid by taxpayers in two equal installments on May 15 and October 15. Personal property taxes are due in full on May 15. The county provides tax settlements to cities and other taxing districts three times a year: in July, December, and January. Property taxes are recognized as revenue in the year levied in the government-wide financial statements and proprietary fund financial statements. In the governmental fund financial statements, taxes are recognized as revenue when received in cash or within 60 days after year-end. Taxes which remain unpaid on December 31 are classified as delinquent taxes receivable, and are offset by a deferred inflow of resources in the governmental fund financial statements. J. Special Assessments Special assessments primarily represent the financing for public improvements paid for by benefiting property owners. As previously mentioned under receivables, the City is also generally able to certify delinquent amounts to the county for collection as special assessments. Special assessments are recorded as receivables upon certification to the county. Special assessments are recognized as revenue in the year levied in the government-wide financial statements and proprietary fund financial statements. In the governmental fund financial statements, special assessments are recognized as revenue when received in cash or within 60 days after year-end. Governmental fund special assessments receivable which remain unpaid on December 31 are offset by a deferred inflow of resources in the governmental fund financial statements. K. Inventories The original cost of materials and supplies has been recorded as expenses/expenditures at the time of purchase for both the governmental and proprietary funds with the exception of water meters in the Water Fund. These funds do not maintain material amounts of materials and supplies. The water meter inventory in the Water Fund is stated at the lower of cost or market on the first-in, first-out method. L. Prepaid Items Certain payments to vendors reflect costs applicable to future accounting periods and are recorded as prepaid items in both government-wide and fund financial statements. Prepaid items are reported using the consumption method and recorded as expenses/expenditures at the time of consumption. M. Capital Assets Capital assets, which include property, plant, equipment, and infrastructure assets (e.g., roads, bridges, sidewalks, and similar items) are reported in the applicable governmental or business-type activities columns in the government-wide financial statements. Such assets are capitalized at historical cost, or estimated historical cost for assets where actual historical cost is not available. Donated assets are recorded as capital assets at their estimated acquisition value on the date of donation. The City defines capital assets with an initial, individual cost of more than $5,000 and an estimated useful life in excess of one year. The costs of normal maintenance and repairs that do not add to the value of the asset or materially extend assets lives are not capitalized. -31- NOTE 1 – SIGNIFICANT ACCOUNTING POLICIES (CONTINUED) In the case of the initial capitalization of general infrastructure assets (i.e., those reported by governmental activities), the City chose to include items dating back to June 30, 1980. These assets are reported at historical cost. The City estimated historical cost for the initial reporting of these assets through back trending (estimating the current replacement cost and utilizing an appropriate price-level index to deflate the cost to the acquisition year). As the City constructs or acquires additional infrastructure assets each period, they will be capitalized and reported at historical cost. Capital assets are recorded in the government-wide and proprietary fund financial statements, but are not reported in the governmental fund financial statements. Interest incurred during the construction phase of capital assets of business-type activities is included as part of the capitalized value of the assets constructed. For the year ended December 31, 2018, no interest was capitalized in connection with construction in progress. Property, plant, and equipment of the City is depreciated using the straight-line method over the following estimated useful lives: Buildings and structures 7–40 years Infrastructure and improvements 15–50 years Distribution and collection systems 15–50 years Machinery and equipment 5–15 years Office furniture and equipment 5–10 years Vehicles 7–20 years Land and construction in progress are not depreciated. N. Compensated Absences It is the City’s policy to permit employees to accumulate earned, but unused annual leave and sick pay benefits called personal time off (PTO). All PTO is accrued when incurred in the government-wide and proprietary fund financial statements. PTO is payable when used or upon termination of employment. A liability for these amounts is reported in the governmental funds only if they have matured, for example, as a result of employee resignations and retirements. A liability is recognized for that portion of accumulated PTO benefits that is vested as severance pay. PTO is payable when used and, in some cases, upon termination of employment. For regular employees, PTO is payable upon retirement or involuntary termination up to the amount accrued, not to exceed 240 hours, who have served at least 12 consecutive months prior to separation, and have given the City at least two weeks’ notice prior to the effective date of such separation. The recorded portion of PTO (compensated absences) represents the estimated amount expected, based on previous years’ history and those eligible for retirement, to be paid at separation. O. Long-Term Obligations In the government-wide and proprietary fund financial statements, long-term debt and other long-term obligations are reported as liabilities. Bond premiums and discounts, if material, are deferred and amortized over the life of the bonds using the straight-line method. Bond issuance costs are expensed in the period incurred. -32- NOTE 1 – SIGNIFICANT ACCOUNTING POLICIES (CONTINUED) P. Pensions For purposes of measuring the net pension liability, deferred outflows/inflows of resources, and pension expense, information about the fiduciary net position of the Public Employees Retirement Association (PERA) and additions to/deductions from the PERA’s fiduciary net position have been determined on the same basis as they are reported by the PERA, except that the PERA’s fiscal year-end is June 30. For this purpose, plan contributions are recognized as of employer payroll paid dates and benefit payments, and refunds are recognized when due and payable in accordance with the benefit terms. Investments are reported at fair value. The PERA has a special funding situation created by a direct aid contribution made by the state of Minnesota. The direct aid is a result of the merger of the Minneapolis Employees Retirement Fund into the PERA on January 1, 2015. Q. Deferred Outflows/Inflows of Resources In addition to assets and liabilities, statements of financial position or balance sheets will sometimes report separate sections for deferred outflows or inflows of resources. These separate financial statement elements represent a consumption or acquisition of net position that applies to a future period and so will not be recognized as an outflow of resources (expense/expenditure) or an inflow of financial resources (revenue) until then. The City reports deferred outflows and inflows of resources related to pensions in the government-wide and enterprise funds Statement of Net Position. These deferred outflows and inflows result from differences between expected and actual economic experience, changes in actuarial assumptions, differences between projected and actual investment earnings, changes in proportion, and contributions to the plan subsequent to the measurement date and before the end of the reporting period. These amounts are deferred and amortized as required under pension standards. Unavailable revenue, arises only under the modified accrual basis of accounting and, therefore, is reported only in the governmental funds Balance Sheet. The governmental funds report unavailable revenue from three sources: property taxes, special assessments, and long-term receivables. These amounts are deferred and recognized as an inflow of resources in the period that the amounts become available. The City also reports deferred inflows of resources related to state aid entitlements received for subsequent years in the government-wide and governmental funds Balance Sheet. This item is deferred and recognized as an inflow of resources in the period that the resources are appropriated. R. Net Position Classifications and Flow Assumptions In the government-wide and proprietary fund financial statements, net position represents the difference between assets, deferred outflows of resources, liabilities, and deferred inflows of resources. Net position is displayed in three components: • Net Investment in Capital Assets – Consists of capital assets, net of accumulated depreciation, reduced by any outstanding debt attributable to acquire capital assets. • Restricted Net Position – Consists of net position restricted when there are limitations imposed on its use through external restrictions imposed by creditors, grantors, or laws or regulations of other governments. -33- NOTE 1 – SIGNIFICANT ACCOUNTING POLICIES (CONTINUED) • Unrestricted Net Position – All other elements of net position that do not meet the definition of “restricted” or “net investment in capital assets.” When both restricted and unrestricted resources are available for use, it is the City’s policy to use restricted resources first, then unrestricted resources as they are needed. S. Fund Balance Classifications and Flow Assumptions In the fund financial statements, governmental funds report fund balance in classific ations that disclose constraints for which amounts in those funds can be spent. These classifications are as follows: • Nonspendable – Consists of amounts that are not in spendable form, such as prepaid items, inventory, and other long-term assets. • Restricted – Consists of amounts related to externally imposed constraints established by creditors, grantors, or contributors; or constraints imposed by state statutory provisions. • Committed – Consists of internally imposed constraints that are established by resolution of the City Council. Those committed amounts cannot be used for any other purpose unless the City Council removes or changes the specified use by taking the same type of action it employed to previously commit those amounts. • Assigned – Consists of internally imposed constraints for amounts intended to be used by the City for specific purposes but do not meet the criteria to be classified as restricted or committed. In governmental funds, assigned amounts represent intended uses established by the governing body itself or by an official to which the governing body delegates the authority. Pursuant to City Council resolution, the finance director and/or the city administrator is authorized to establish assignments of fund balance. • Unassigned – The residual classification for the General Fund, which also reflects negative residual amounts in other funds. When both restricted and unrestricted resources are available for use, it is the City’s policy to first use restricted resources, then use unrestricted resources as they are needed. When committed, assigned, or unassigned resources are available for use, it is the City’s policy to use resources in the following order: 1) committed, 2) assigned, and 3) unassigned. T. Use of Estimates The preparation of financial statements, in conformity with accounting principles generally accepted in the United States of America, requires management to make estimates and assumptions that affect the reported amounts and disclosures in the financial statements. Actual results could differ from those estimates. -34- NOTE 2 – DEPOSITS AND INVESTMENTS A. Components of Cash and Investments The City had the following cash and investments at year-end: Fair Value Measurements Less Than 1 to 5 6 to 10 Greater Than Investment Type Rating Agency Using 1 Year Years Years 10 Years Total Federal National Mortgage Association AA S&P Level 2 –$ –$ 98,306$ 249,305$ 347,611$ Federal Home Loan Bank AA S&P Level 2 – 369,108 – – 369,108 Federal Farm Credit Bank AA S&P Level 2 – – 254,582 – 254,582 Federal Home Loan Mortgage Corp AA S&P Level 2 – 89,486 – – 89,486 Municipal bonds AAA S&P Level 2 – 146,952 – – 146,952 Municipal bonds AA S&P Level 2 272,095 1,039,228 663,597 – 1,974,920 Municipal bonds AA Moody’s Level 2 – – 1,143,584 – 1,143,584 Municipal bonds A S&P Level 2 – 319,791 – – 319,791 Negotiable certificates of deposit N/R N/A Level 2 149,951 2,975,572 138,162 143,403 3,407,088 Investment pools/mutual funds External investment pool – 4M Fund N/R N/A N/A 2,094,337 – – – 2,094,337 Wells Fargo Money Market Advantage AAA S&P Level 1 38,295 – – – 38,295 Total investments 2,554,678$ 4,940,137$ 2,298,231$ 392,708$ 10,185,754 Deposits 424,859 Petty cash 500 Total cash and investments 10,611,113$ N/R – Not Rated N/A – Not Applicable Interest Risk – Maturity Duration in Years Credit Risk B. Deposits In accordance with applicable Minnesota Statutes, the City maintains deposits at depository banks authorized by the City Council, including checking accounts and certificates of deposit. The following is considered the most significant risk associated with deposits: Custodial Credit Risk – In the case of deposits, this is the risk that in the event of a failure, the City’s deposits may be lost. Minnesota Statutes require that all deposits be protected by federal deposit insurance, corporate surety bond, or collateral. The fair value of collateral pledged must equal 110 percent of the deposits not covered by federal deposit insurance or corporate surety bonds. Authorized collateral includes treasury bills, notes, and bonds; issues of U.S. government agencies; general obligations rated “A” or better; revenue obligations rated “AA” or better; irrevocable standard letters of credit issued by the Federal Home Loan Bank; and certificates of deposit. Minnesota Statutes require that securities pledged as collateral be held in safekeeping in a restricted account at the Federal Reserve Bank or in an account at a trust department of a commercial bank or other financial institution that is not owned or controlled by the financial institution furnishing the collateral. The City has no additional deposit policies addressing custodial credit risk. At year-end, the carrying amount of the City’s deposits and the bank balance was $424,859. The entire bank balance was covered by federal deposit insurance, surety bonds, or by collateral held by the City’s agent in the City’s name. -35- NOTE 2 – DEPOSITS AND INVESTMENTS (CONTINUED) C. Investments Investments are subject to various risks, the following of which are considered the most significant: Custodial Credit Risk – For investments, this is the risk that in the event of a failure of the counterparty to an investment transaction (typically a broker-dealer), the City would not be able to recover the value of its investments or collateral securities that are in the possession of an outside party. The City’s investment policies do not further address this risk, but typically li mits its exposure by purchasing insured or registered investments, or by the control of who holds the securities. Credit Risk – This is the risk that an issuer or other counterparty to an investment will not fulfill its obligations. Minnesota Statutes limit the City’s investments to direct obligations or obligations guaranteed by the United States or its agencies; shares of investment companies registered under the Federal Investment Company Act of 1940 that receive the highest credit rating, are rated in one of the two highest rating categories by a statistical rating agency, and all of the investments have a final maturity of 13 months or less; general obligations rated “A” or better; revenue obligations rated “AA” or better; general obligations of the Minnesota Housing Finance Agency rated “A” or better; bankers’ acceptances of United States banks eligible for purchase by the Federal Reserve System; commercial paper issued by United States corporations or their Canadian subsidiaries, rated of the highest quality category by at least two nationally recognized rating agencies, and maturing in 270 days or less; Guaranteed Investment Contracts guaranteed by a United States commercial bank, domestic branch of a foreign bank, or a United States insurance company, and with a credit quality in one of the top two highest categories; repurchase or reverse purchase agreements and securities lending agreements with financial institutions qualified as a “depository” by the government entity, with banks that are members of the Federal Reserve System with capitalization exceeding $10,000,000; that are a primary reporting dealer in U.S. government securities to the Federal Reserve Bank of New York; or certain Minnesota securities broker-dealers. The City’s investment policies do not further address credit risk. Interest Rate Risk – This is the risk of potential variability in the fair value of fixed rate investments resulting from changes in interest rates (the longer the period for which an interest rate is fixed, the greater the risk). The City’s investment policies do not mandate a limit on the duration of investments. Concentration Risk – This is the risk associated with investing a significant portion of the City’s investment (considered 5 percent or more) in the secur ities of a single issuer, excluding United States guaranteed investments (such as treasuries), investment pools, and mutual funds. The City’s investment policies state that no more than 5 percent of the overall portfolio may be invested in the securities of a single issuer, except for the securities of the United States government, or a maximum of 25.0 percent with any individual counterparty in an external investment pool. At year-end, the City’s investments in the City of Minneapolis, Minnesota (municipal bonds) represented 5.4 percent, and in the City of Oshkosh, Wisconsin (municipal bonds) represented 5.8 percent. -36- NOTE 3 – CAPITAL ASSETS Capital asset activity for the year ended December 31, 2018 was as follows: A. Governmental Activities Beginning Completed Ending Balance Increases Decreases Construction Balance Primary government Governmental activities Capital assets, not being depreciated Land 2,679,818$ –$ –$ –$ 2,679,818$ Construction in progress 552,481 4,797,780 – – 5,350,261 Total capital assets, not being depreciated 3,232,299 4,797,780 – – 8,030,079 Capital assets, being depreciated Buildings and structures 6,705,962 – (14,208) – 6,691,754 Infrastructure and improvements 17,679,146 41,830 – – 17,720,976 Machinery and equipment 983,869 75,632 (88,306) – 971,195 Office furniture and equipment 153,553 – – – 153,553 Vehicles 1,989,291 238,732 (205,856) – 2,022,167 Total capital assets, being depreciated 27,511,821 356,194 (308,370) – 27,559,645 Less accumulated depreciation for Buildings and structures 3,110,976 188,696 (12,788) – 3,286,884 Infrastructure and improvements 3,436,679 431,223 – – 3,867,902 Machinery and equipment 682,911 57,451 (69,988) – 670,374 Office furniture and equipment 96,317 12,910 – – 109,227 Vehicles 666,860 171,130 (155,551) – 682,439 Total accumulated depreciation 7,993,743 861,410 (238,327) – 8,616,826 Total capital assets being depreciated – net 19,518,078 (505,216) (70,043) – 18,942,819 Governmental activities capital assets – net 22,750,377$ 4,292,564$ (70,043)$ –$ 26,972,898$ B. Business-Type Activities Beginning Completed Ending Balance Increases Decreases Construction Balance Primary government Business-type activities Capital assets, not being depreciated Construction in progress 324,945$ 4,107,638$ –$ (1,103,589)$ 3,328,994$ Capital assets, being depreciated Buildings and structures 835,040 – – – 835,040 Distribution and collection systems 23,269,938 11,870 – 1,103,589 24,385,397 Machinery and equipment 950,701 – (143,929) – 806,772 Office furniture and equipment 11,975 – (3,560) – 8,415 Vehicles 136,659 – (136,659) – – Total capital assets, being depreciated 25,204,313 11,870 (284,148) 1,103,589 26,035,624 Less accumulated depreciation for Buildings and structures 130,262 41,544 – – 171,806 Distribution and collection systems 8,095,991 492,102 – – 8,588,093 Machinery and equipment 862,371 9,994 (143,929) – 728,436 Office furniture and equipment 11,975 – (3,560) – 8,415 Vehicles 136,659 – (136,659) – – Total accumulated depreciation 9,237,258 543,640 (284,148) – 9,496,750 Total capital assets, being depreciated – net 15,967,055 (531,770) – 1,103,589 16,538,874 Business-type activities capital assets – net 16,292,000$ 3,575,868$ –$ –$ 19,867,868$ -37- NOTE 3 – CAPITAL ASSETS (CONTINUED) C. Depreciation Expense by Function Depreciation expense was charged to the following functions: Governmental activities General government 133,340$ Public safety 2,964 Public works 550,768 Parks and recreation 109,793 Economic development 64,545 861,410$ Business-type activities Water 260,017$ Sewer 175,456 Surface water management 108,167 543,640$ D. Construction Commitments At December 31, 2018, the City had the following construction project commitments: Project Amount Permanent Improvement Revolving Fund Johanna Marsh Park Improvements 1,462$ Old Snelling Trail and Watermain 230,474 2018 Street Project 269,376 Old Snelling Avenue Bridge Replacement 16,349 Water Fund Water Tower Rehabilitation 16,446 534,107$ -38- NOTE 4 – LONG-TERM LIABILITIES A. Components of Long-Term Liabilities Final Maturity Authorized Balance – Issue Date Date and Issued End of Year Governmental activities Compensated absences 78,302$ Net pension liability 813,204 Total governmental activities 891,506$ Business-type activities General Obligation Bonds Utility Revenue Bonds of 2018A 07/18/2018 02/01/2029 3.00–4.00 % 2,415,000$ 2,415,000$ Premium 156,952 Compensated absences 46,744 Net pension liability 396,171 Total business-type activities 3,014,867$ Total government-wide activities 3,906,373$ Interest Rate B. Changes in Long-Term Liabilities Beginning Ending Due Within Balance Additions Deletions Balance One Year Governmental activities Compensated absences 49,694$ 98,009$ 69,401$ 78,302$ 58,727$ Net pension liability 971,048 67,757 225,601 813,204 – Total governmental activities 1,020,742 165,766 295,002 891,506 58,727 Business-type activities Utility revenue bonds – 2,415,000 – 2,415,000 – Premium – 164,022 7,070 156,952 – Total bonds – 2,579,022 7,070 2,571,952 – Compensated absences 44,716 70,707 68,679 46,744 35,058 Net pension liability 497,257 43,393 144,479 396,171 – Total business-type activities 541,973 2,693,122 220,228 3,014,867 35,058 Total government-wide 1,562,715$ 2,858,888$ 515,230$ 3,906,373$ 93,785$ -39- NOTE 4 – LONG-TERM LIABILITIES (CONTINUED) C. Minimum Debt Payments Minimum annual payments required to retire bonds are as follows: Year Ending December 31, Principal Interest 2019 –$ 94,286$ 2020 200,000 87,000 2021 210,000 78,800 2022 220,000 70,200 2023 225,000 61,300 2024–2028 1,275,000 161,875 2029 285,000 4,275 2,415,000$ 557,736$ Business-Type Activities Utility Revenue Bonds D. Descriptions of Long-Term Liabilities • Utility Revenue Bonds – Water and Sewer Enterprise Fund revenues will be used to repay this debt. The liability is recorded in the applicable enterprise fund. • Net Pension Liability – The liability represents the City’s pension benefit obligations as further described later in these notes. The General, Special Revenue, Water, Sewer, and Surface Water Management Funds will be used to liquidate this liability. • Compensated Absences – This liability represents vested benefits earned by employees through the end of the year, which will be paid or used in future periods. The General, Special Revenue, Water, Sewer, and Surface Water Management Funds will be used to liquidate this liability. E. Revenue Pledged Future revenue pledged for the payment of long-term debt is as follows: Percent of Remaining Principal Pledged Use of Total Term of Principal and Interest Revenue Debt Issue Proceeds Type Debt Service Pledge and Interest Paid Received Utility Revenue Bonds of 2018A Utility improvements Utility charges 100% 2018–2029 2,972,736$ –$ 4,261,545$ Revenue Pledged Current Year -40- NOTE 5 – FUND BALANCES A. Classifications At December 31, 2018, a summary of the City’s governmental fund balance classifications are as follows: Equipment, Permanent Other EDA Building, and Improvement Governmental General Operating Replacement Revolving Funds Total Nonspendable Prepaid items 25,482$ –$ –$ –$ 214$ 25,696$ Restricted for Tax increment purposes – – – – 747,898 747,898 Cable TV – – – – 262,623 262,623 Total restricted – – – – 1,010,521 1,010,521 Committed for Economic development authority – 508,241 – – – 508,241 Assigned for Compensated absences 75,835 – – – – 75,835 Subsequent year’s budget 186,970 – – – – 186,970 Capital improvements – – 216,902 2,656,977 – 2,873,879 Total assigned 262,805 – 216,902 2,656,977 – 3,136,684 Unassigned 3,052,082 – – – (189,404) 2,862,678 Total 3,340,369$ 508,241$ 216,902$ 2,656,977$ 821,331$ 7,543,820$ B. Minimum Unassigned Fund Balance Policy The City Council has formally adopted a fund balance policy regarding the minimum unassigned fund balance for the General Fund. The policy establishes the City will strive to maintain an unassigned General Fund balance of 50.0 percent of the subsequent year’s General Fund budgeted expenditures. At December 31, 2018, the unassigned fund balance of the General Fund was 60.3 percent of the subsequent year’s budgeted expenditures. NOTE 6 – DEFINED BENEFIT PENSION PLAN – STATE-WIDE A. Plan Description The City participates in the following cost-sharing, multiple-employer defined benefit pension plan administered by the PERA of Minnesota. The PERA’s defined benefit pension plan is established and administered in accordance with Minnesota Statutes, Chapters 353 and 356. The PERA’s defined benefit pension plan is a tax qualified plan under Section 401(a) of the Internal Revenue Code. General Employees Retirement Fund (GERF) All full-time and certain part-time employees of the City are covered by the GERF. The GERF members belong to the Coordinated Plan. Coordinated Plan members are covered by Social Security. -41- NOTE 6 – DEFINED BENEFIT PENSION PLAN – STATE-WIDE (CONTINUED) B. Benefits Provided The PERA provides retirement, disability, and death benefits. Benefit provisions are established by state statutes and can only be modified by the State Legislature. Vested, terminated employees who are entitled to benefits but are not receiving them yet, are bound by the provisions in effect at the time they last terminated their public service. GERF Benefits Benefits are based on a member’s highest average salary for any five successive years of allowable service, age, and years of credit at termination of service. Two methods are used to compute benefits for the PERA’s Coordinated Plan members. Members hired prior to July 1, 1989, receive the higher of Method 1 or Method 2 formulas. Only Method 2 is used for members hired after June 30, 1989. Under Method 1, the accrual rate for Coordinated Plan members is 1.2 percent of average salary for each of the first 10 years of service, and 1.7 percent of average salary for each additional year. Under Method 2, the accrual rate for Coordinated Plan members is 1.7 percent of average salary for all years of service. For members hired prior to July 1, 1989, a full annuity is available when age plus years of service equal 90, and normal retirement age is 65. For members hired on or after July 1, 1989, normal retirement age is the age for unreduced Social Security benefits capped at age 66. Benefit increases are provided to benefit recipients each January. Increases are related to the funding ratio of the plan. If the GERF is at least 90.0 percent funded for two consecutive years, benefit recipients are given a 2.5 percent increase. If the plan has not exceeded 90.0 percent funded, or has fallen below 80.0 percent, benefit recipients are given a 1.0 percent increase. A benefit recipient who has been receiving a benefit for at least 12 full months as of June 30 will receive a full increase. Members receiving benefits for at least one month, but less than 12 full months as of June 30, will receive a pro rata increase. C. Contributions Minnesota Statutes, Chapter 353 sets the rates for employer and employee contributions. Contribution rates can only be modified by the State Legislature. GERF Contributions Coordinated Plan members were required to contribute 6.50 percent of their annual covered salary in fiscal year 2018. The City was required to contribute 7.50 percent for Coordinated Plan members. The City’s contributions to the GERF for the year ended December 31, 2018 were $111,628. The City’s contributions were equal to the required contributions as set by state statutes. D. Pension Costs GERF Pension Costs At December 31, 2018, the City reported a liability of $1,209,375 for its proportionate share of the GERF’s net pension liability. The net pension liability was measured as of June 30, 2018, and the total pension liability used to calculate the net pension liability was determined by an actuarial valuation as of that date. The City’s proportion of the net pension liability was based on the Cit y’s contributions received by the PERA during the measurement period for employer payroll paid dates from July 1, 2017 through June 30, 2018, relative to the total employer contributions received from all of the PERA’s participating employers. The City’s proportionate share was 0.0218 percent at the end of the measurement period and 0.0230 percent for the beginning of the period. -42- NOTE 6 – DEFINED BENEFIT PENSION PLAN – STATE-WIDE (CONTINUED) The City’s net pension liability reflected a reduction, due to the state of Minnesota’s contribution of $16 million to the fund. The state of Minnesota is considered a nonemployer contributing entity and the state’s contribution meets the definition of a special funding situation. The amount recognized by the City as its proportionate share of the net pension liability, the direct aid, and total portion of the net pension liability that was associated with the City were as follows: City’s proportionate share of the net pension liability 1,209,375$ State’s proportionate share of the net pension liability associated with the City 39,819$ For the year ended December 31, 2018, the City recognized pension expense of $4,272 for its proportionate share of the GERF’s pension expense. In addition, the City recognized an additional $9,245 as pension expense (and grant revenue) for its proportionate share of the state of Minnesota’s contribution of $16 million to the GERF. At December 31, 2018, the City reported its proportionate share of the GERF’s deferred outflows of resources and deferred inflows of resources related to pensions from the following sources: Deferred Deferred Outflows Inflows of Resources of Resources Differences between expected and actual economic experience 33,694$ 43,200$ Changes in actuarial assumptions 141,491 141,007 Difference between projected and actual investment earnings – 96,620 Changes in proportion – 228,396 Contributions paid to the PERA subsequent to the measurement date 56,053 – Total 231,238$ 509,223$ Deferred outflows of resources reported $56,053 related to pensions resulting from city contributions subsequent to the measurement date that will be recognized as a reduction of the net pension liability in the year ending December 31, 2019. Other amounts reported as deferred outflows and deferred inflows of resources related to pensions will be recognized in pension expense as follows: Pension Year Ending Expense December 31, Amount 2019 (37,994)$ 2020 (150,266)$ 2021 (120,534)$ 2022 (25,244)$ -43- NOTE 6 – DEFINED BENEFIT PENSION PLAN – STATE-WIDE (CONTINUED) E. Actuarial Assumptions The total pension liability in the June 30, 2018 actuarial valuation was determined using an individual entry-age normal actuarial cost method and the following actuarial assumptions: Inflation 2.50% per year Active member payroll growth 3.25% per year Investment rate of return 7.50% Salary increases were based on a service-related table. Mortality rates for active members, retirees, survivors, and disabilitants for all plans were based on RP-2014 tables for males and females, as appropriate, with slight adjustments to fit the PERA’s experience. Cost of living benefit increases after retirement for retirees are assumed to be 1.25 percent per year for the GERF. Actuarial assumptions used in the June 30, 2018 valuation were based on the results of actuarial experience studies. The most recent six-year experience study in the GERF was completed in 2015. Economic assumptions were updated in 2017 based on a review of inflation and investment return assumptions. The following changes in actuarial assumptions occurred in 2018: GERF • The mortality projection scale was changed from MP-2015 to MP-2017. • The assumed post-retirement benefit increase was changed from 1.00 percent per year through 2044, and 2.50 percent per year thereafter, to 1.25 percent per year. The State Board of Investment, which manages the investments of the PERA, prepares an analysis of the reasonableness on a regular basis of the long-term expected rate of return using a building-block method in which best-estimate ranges of expected future rates of return are developed for each major asset class. These ranges are combined to produce an expected long-term rate of return by weighting the expected future rates of return by the target asset allocation percentages. The target allocation and best-estimates of geometric real rates of return for each major asset class are summarized in the following table: Asset Class Domestic stocks 36 % 5.10 % International stocks 17 5.30 % Bonds 20 0.75 % Alternative assets 25 5.90 % Cash 2 – % Total 100 % Allocation Target Real Rate of Return Long-Term Expected -44- NOTE 6 – DEFINED BENEFIT PENSION PLAN – STATE-WIDE (CONTINUED) F. Discount Rate The discount rate used to measure the total pension liabi lity in 2018 was 7.50 percent. The projection of cash flows used to determine the discount rate assumed that contributions from plan members and employers will be made at rates set in Minnesota Statutes. Based on these assumptions, the fiduciary net position of the GERF was projected to be available to make all projected future benefit payments of current plan members. Therefore, the long-term expected rate of return on pension plan investments was applied to all periods of projected benefit payments to determine the total pension liability. G. Pension Liability Sensitivity The following presents the City’s proportionate share of the net pension liability for all plans it participates in, calculated using the discount rate disclosed in the preceding paragraph, as well as what the City’s proportionate share of the net pension liability would be if it were calculated using a discount rate 1 percentage point lower or 1 percentage point higher than the current discount rate: 1% Decrease in 1% Increase in Discount Rate Discount Rate Discount Rate 6.50%7.50%8.50% City’s proportionate share of the GERF net pension liability 1,965,389$ 1,209,375$ 585,307$ H. Pension Plan Fiduciary Net Position Detailed information about the GERF’s fiduciary net position is available in a separately issued PERA financial report that includes financial statements and required supplementary information. That report may be obtained on the PERA website at www.mnpera.org; by writing to the PERA at 60 Empire Drive, Suite 200, St. Paul, Minnesota 55103; or by calling (651) 296-7460 or (800) 652-9026. -45- NOTE 7 – INTERFUND RECEIVABLES, PAYABLES, AND TRANSFERS A. Interfund Receivable and Payable Interfund receivable and payable balances at December 31, 2018 are as follows: Fund Receivable Payable Governmental funds Permanent Improvement Revolving 187,450$ –$ Nonmajor – other governmental – 187,450 Intra-activity eliminations (187,450) (187,450) Total governmental funds – – Proprietary funds Enterprise funds Water 26,268 – Surface Water Management – 26,268 Total proprietary funds 26,268 26,268 Total all funds 26,268$ 26,268$ Interfund receivables and payables are used for temporary cash deficits. These balances will be eliminated with park dedication fees, other reimbursements, future charges for services, grants, and other internal fund transfers, if needed. B. Transfers In and Transfers Out Equipment, Permanent Nonmajor – EDA Building, and Improvement Other Transfers Out Operating Replacement Revolving Governmental Total Governmental funds General Fund 120,000$ 450,000$ 200,000$ 50,000$ 820,000$ Nonmajor – other governmental 135,727 – – – 135,727 Proprietary funds Water – 100,000 – – 100,000 Sewer – 126,000 – – 126,000 Surface Water Management – 74,000 – – 74,000 Total 255,727$ 750,000$ 200,000$ 50,000$ 1,255,727$ Transfers In Governmental Funds Interfund transfers allow the City to allocate financial resources to the funds that receive benefits from services provided by another fund. All of the City’s interfund transfers fall under that category. All of the 2018 transfers are considered routine and consistent with previous practices. -46- NOTE 8 – DEFICIT FUND BALANCES/NET POSITION The City had deficit fund balances/net position at December 31, 2018 as follows: Amount Governmental funds Nonmajor – Parks 5,816$ Nonmajor – Public Safety Capital Equipment 19,456 Nonmajor – TCAAP 164,132 189,404$ These fund deficits will be eliminated with future contributions, grants, and internal fund transfers, if needed. NOTE 9 – TAX ABATEMENT AGREEMENTS The City, in order to spur economic development and redevelopment will enter into private development and redevelopment agreements to encourage a developer to construct, expand, or improve new or existing properties and buildings or clean-up and redevelop blighted areas. These agreements may in substance be a tax abatement, but will depend on their individual circumstances. The City currently has two agreements that would be considered a tax abatement under GASB Statement No. 77. In 2013, the City entered into a development agreement with Presbyterian Homes of Arden Hills, Inc. to aid in financing certain public development costs and administrative costs of a project undertaken. For this agreement, the City used an economic development vehicle known as tax increment financing whereby tax increment revenue is generated on the incremental increase in value above a base value established on the date that the tax increment district is created. The City will abate 90 percent of the incremental taxes received through February 2019, and 75 percent of the incremental taxes received through February 2028, through execution of a tax increment revenue note to be retired in 2028. The outstanding principal balance as of December 31, 2018, was $688,831 and the City rebated $228,512 in the current year. In 2016, the City entered into an abatement agreement with Land O’Lakes, Inc. The City did not have any collections or rebate of property tax increment in the current year. The City is authorized to create a tax increment financing plan under Minnesota Statutes, Chapter 469.175. The criteria that must be met under the statute are that, in the opinion of the municipality: • The proposed development or redevelopment would not reasonably be expected to occur solely through private investment within the reasonably foreseeable future; • The increased market value of the site that could reasonably be expected to occur without the use of tax increment financing would be less than the increase in the market value estimated to result from the proposed development after subtracting the present value of the projected tax increments for the maximum duration of the district permitted by the plan. The requirements of this item do not apply if the district is a housing district; -47- NOTE 9 – TAX ABATEMENT AGREEMENTS (CONTINUED) • The tax increment financing plan conforms to the general plan for the development or redevelopment of the municipality as a whole; and • The tax increment financing plan will afford maximum opportunity, consistent with the sound needs of the municipality as a whole, for the development or redevelopment of the project by private enterprise. NOTE 10 – COMMITMENTS AND CONTINGENCIES A. Risk Management The City is exposed to various risks of loss related to torts: theft of, damage to, and destruction of assets; errors and omissions; injuries to employees; and natural disasters for which the City carries insurance. The City obtains insurance through participation in the League of Minnesota Cities Insurance Trust (LMCIT), which is a risk-sharing pool with other governmental units. The City pays an annual premium to the LMCIT for its workers’ compensation and property and casualty insurance. The LMCIT is self-sustaining through member premiums and will reinsure for claims above a prescribed dollar amount for each insurance event. There were no significant reductions in insurance from the previous year or settled claims in excess of insurance coverage for any of the past three fiscal years. Liabilities are reported when it is probable that a loss has occurred and the amount of the loss can be reasonably estimated. Liabilities, if any, include an amount for claims that have been incurred, but not reported. The City’s management is not aware of any incurred, but unreported claims. B. Litigation The city attorney has indicated that existing and pending lawsuits, claims, and other actions in which the City is a defendant are either covered by insurance, of an immaterial amount, or, in the judgment of the city attorney, remotely recoverable by plaintiffs. No loss has been recorded on the City’s financial statements relating to these claims. C. Federal and State Funds Amounts recorded or receivable from federal and state agencies are subject to agency audit and adjustment. Any disallowed claims, including amounts already collected, may constitute a liability of the applicable funds. The amount, if any, of claims which may be disallowed by the grantor agencies cannot be determined at this time, although the City expects such amounts, if any, to be immaterial. D. Tax Increment Districts The City’s tax increment districts are subject to review by the Minnesota Office of the State Auditor. Any disallowed claims or misuse of tax increments could become a liability of the applicable fund. Management has indicated that they are not aware of any instances of noncompliance which would have a material effect on the financial statements. -48- NOTE 10 – COMMITMENTS AND CONTINGENCIES (CONTINUED) E. Lake Johanna Volunteer Fire Department, Inc. The City receives fire protection under a contract with the Lake Johanna Volunteer Fire Department, Inc. The contract calls for annual payments and expired December 31, 2018. During the current year, the City extended this contract through December 31, 2023, with extension through December 31, 2038. The contract cost will be based on the budget submitted by the fire department and approved by the City. Capital costs are billed separately in addition to the contract rate. The amount expended under the contract was $541,663 in 2018. NOTE 11 – CONDUIT DEBT OBLIGATION The City has issued private activity bonds to provide financial assistance to private sector entities for the acquisition and construction of industrial and commercial facilities deemed to be in the public interest. The bonds constitute special obligations of the City, payable solely from revenues of the projects pledged to the payment thereof. The bonds do not constitute a debt of the City and the City has no obligation for repayment. Accordingly, the bonds are not reported as liabilities in the City’s financi al statements. Bonds outstanding at December 31, 2018 could not be determined; however, their original issue amounts are as follows: Amount Bond Description Issued Commercial Facilities Revenue Note, Series 2008 Office facilities 5,500,000$ Senior Housing Revenue Note, Series 2011A Senior housing 10,000,000 Senior Housing Revenue Note, Series 2012A Senior housing 10,000,000 Senior Housing Revenue Note, Series 2015A Senior housing 10,000,000 Total 35,500,000$ REQUIRED SUPPLEMENTARY INFORMATION TAB Proportionate Share of the City’s Net Pension Proportionate Liability and City’s Share of the the City’s Proportionate Plan Fiduciary State of Share of the Share of the Net Position City’s City’s Minnesota’s State of Net Pension as a PERA Fiscal Proportion Proportionate Proportionate Minnesota’s Liability as a Percentage Year-End Date of the Net Share of the Share of the Share of the City’s Percentage of of the Total (Measurement Pension Net Pension Net Pension Net Pension Covered Covered Pension Date) Liability Liability Liability Liability Payroll Payroll Liability 06/30/2015 0.0283% 1,466,653$ –$ 1,466,653$ 1,662,826$ 88.20%78.20% 06/30/2016 0.0267% 2,167,909$ 28,367$ 2,196,276$ 1,669,147$ 129.88% 68.90% 06/30/2017 0.0230% 1,468,305$ 18,435$ 1,486,740$ 1,479,483$ 99.24%75.90% 06/30/2018 0.0218% 1,209,375$ 39,819$ 1,249,194$ 1,467,987$ 82.38%79.50% Contributions Contributions in Relation to as a Statutorily the Statutorily Contribution Percentage Required Required Deficiency Covered of Covered Contributions Contributions (Excess) Payroll Payroll 129,774$ 129,774$ –$ 1,731,651$ 7.49% 115,814$ 115,814$ –$ 1,553,950$ 7.45% 106,513$ 106,513$ –$ 1,420,174$ 7.50% 111,628$ 111,628$ –$ 1,488,376$ 7.50% Note: Year Ended December 31, 2018 12/31/2017 The City implemented GASB Statement No.68 in fiscal 2015 (using a June 30, 2015 measurement date). This schedule is intended to present 10-year trend information. Additional years will be added as they become available. Year-End Date City Fiscal 12/31/2016 12/31/2015 12/31/2018 CITY OF ARDEN HILLS PERA – General Employees Retirement Fund Schedule of City’s and Nonemployer Proportionate Share of Net Pension Liability PERA – General Employees Retirement Fund Schedule of City Contributions Year-End Date City Fiscal 12/31/2016 12/31/2015 Year Ended December 31, 2018 12/31/2017 12/31/2018 -49- THIS PAGE INTENTIONALLY LEFT BLANK Actual Variance With Original Budget Final Budget Amounts Final Budget Revenues General property taxes 3,795,042$ 3,795,042$ 3,578,628$ (216,414)$ Special assessments 2,000 2,000 5,362 3,362 Licenses and permits Business 50,700 50,700 64,932 14,232 Nonbusiness 273,900 273,900 461,512 187,612 Total licenses and permits 324,600 324,600 526,444 201,844 Intergovernmental State Road maintenance 88,000 88,000 98,357 10,357 PERA aid 5,179 5,179 5,179 – Police aid 40,000 40,000 45,561 5,561 Total intergovernmental 133,179 133,179 149,097 15,918 Charges for services General government 16,800 16,800 18,125 1,325 Public safety 113,000 113,000 179,127 66,127 Parks and recreation 122,200 122,200 113,968 (8,232) Administrative charges 213,704 148,802 116,685 (32,117) Total charges for services 465,704 400,802 427,905 27,103 Fines and forfeits 34,000 34,000 37,080 3,080 Earnings on investments 55,000 55,000 64,996 9,996 Antenna rental fees 120,000 120,000 57,067 (62,933) Miscellaneous reimbursements 9,000 9,000 30,700 21,700 Other 1,006 1,006 5,402 4,396 Total revenues 4,939,531 4,874,629 4,882,681 8,052 Expenditures Current General government City Council Personal services 31,200 31,200 31,165 35 Other services and charges 36,300 36,300 30,798 5,502 Total City Council 67,500 67,500 61,963 5,537 Elections Other services and charges 23,000 23,000 22,869 131 Administration Personal services 194,200 194,200 182,233 11,967 Materials and supplies 500 500 297 203 Other services and charges 132,800 132,800 121,027 11,773 Total administration 327,500 327,500 303,557 23,943 CITY OF ARDEN HILLS Required Supplementary Information Budgetary Comparison Schedule – General Fund Year Ended December 31, 2018 -50-(continued) Actual Variance With Original Budget Final Budget Amounts Final Budget Expenditures (continued) Current (continued) General government (continued) Finance Personal services 51,000 51,000 47,233 3,767 Materials and supplies 23,100 23,100 14,413 8,687 Other services and charges 102,200 102,200 92,755 9,445 Total finance 176,300 176,300 154,401 21,899 TCAAP Personal services 107,700 107,700 21,250 86,450 Materials and supplies 1,000 1,000 – 1,000 Other services and charges 61,300 61,300 125,111 (63,811) Total TCAAP 170,000 170,000 146,361 23,639 Planning and zoning Personal services 83,500 83,500 87,540 (4,040) Materials and supplies 200 200 – 200 Other services and charges 182,550 182,550 89,374 93,176 Total planning and zoning 266,250 266,250 176,914 89,336 General government buildings Personal services 40,500 40,500 37,357 3,143 Materials and supplies 6,000 6,000 11,683 (5,683) Other services and charges 228,500 163,598 124,667 38,931 Total general government buildings 275,000 210,098 173,707 36,391 Total general government 1,305,550 1,240,648 1,039,772 200,876 Public safety Police and animal control Other services and charges 1,194,775 1,194,775 1,161,956 32,819 Dispatch Other services and charges 65,175 65,175 65,175 – Fire protection Other services and charges 544,000 544,000 541,663 2,337 Emergency management Personal services 2,726 2,726 4,423 (1,697) Other services and charges 6,750 6,750 5,415 1,335 Total emergency management 9,476 9,476 9,838 (362) CITY OF ARDEN HILLS Required Supplementary Information Budgetary Comparison Schedule – General Fund (continued) Year Ended December 31, 2018 -51-(continued) Actual Variance With Original Budget Final Budget Amounts Final Budget Expenditures (continued) Current (continued) Public safety (continued) Protective inspections Personal services 270,500 270,500 245,917 24,583 Materials and supplies 3,046 2,646 188 2,458 Other services and charges 69,200 69,600 63,608 5,992 Total protective inspections 342,746 342,746 309,713 33,033 Total public safety 2,156,172 2,156,172 2,088,345 67,827 Public works Street maintenance Personal services 234,200 234,200 239,081 (4,881) Materials and supplies 25,600 25,600 59,934 (34,334) Other services and charges 328,072 328,072 280,520 47,552 Total public works 587,872 587,872 579,535 8,337 Parks and recreation Park maintenance Personal services 236,200 236,200 205,200 31,000 Materials and supplies 36,100 36,100 32,928 3,172 Other services and charges 168,212 168,212 155,198 13,014 Total park maintenance 440,512 440,512 393,326 47,186 Recreation Personal services 174,000 174,000 182,172 (8,172) Materials and supplies 22,250 22,250 31,158 (8,908) Other services and charges 70,400 70,400 47,321 23,079 Total recreation 266,650 266,650 260,651 5,999 Total parks and recreation 707,162 707,162 653,977 53,185 Total expenditures 4,756,756 4,691,854 4,361,629 330,225 Revenues over expenditures 182,775 182,775 521,052 338,277 Other financing sources (uses) Transfers out (420,000) (820,000) (820,000) – Net change in fund balance (237,225)$ (637,225)$ (298,948) 338,277$ Fund balance – beginning 3,639,317 Fund balance – ending 3,340,369$ Budgetary Comparison Schedule – General Fund (continued) Year Ended December 31, 2018 CITY OF ARDEN HILLS Required Supplementary Information -52- Actual Variance With Original Budget Final Budget Amounts Final Budget Revenues Taxes – tax increments –$ –$ 2,451$ 2,451$ Earnings on investments 5,600 5,600 5,760 160 Total revenues 5,600 5,600 8,211 2,611 Expenditures Economic development Current Personal services 70,550 70,550 25,690 44,860 Materials and supplies 650 650 632 18 Other services and charges 66,237 66,237 32,433 33,804 Capital outlay 80,000 80,000 – 80,000 Total expenditures 217,437 217,437 58,755 158,682 Revenues over (under) expenditures (211,837) (211,837) (50,544) 161,293 Other financing sources Transfers in 120,000 255,725 255,727 (2) Net change in fund balances (91,837)$ 43,888$ 205,183 161,295$ Fund balance – beginning 303,058 Fund balance – ending 508,241$ CITY OF ARDEN HILLS Required Supplementary Information Budgetary Comparison Schedule – EDA Operating Fund Year Ended December 31, 2018 -53- CITY OF ARDEN HILLS Notes to Required Supplementary Information December 31, 2018 -54- NOTE 1 – LEGAL COMPLIANCE – BUDGETS The General Fund and EDA Operating Fund budgets are legally adopted on a basis consistent with accounting principles generally accepted in the United States of America. The legal level of budgetary control is at the fund level for these funds. Budgeted appropriations lapse at year-end. NOTE 2 – PERA – GENERAL EMPLOYEES RETIREMENT FUND 2018 CHANGES CHANGES IN ACTUARIAL ASSUMPTIONS: • The mortality projection scale was changed from MP-2015 to MP-2017. • The assumed benefit increase was changed from 1.00 percent per year through 2044, and 2.50 percent per year thereafter, to 1.25 percent per year. 2017 CHANGES CHANGES IN PLAN PROVISIONS: • The state’s special funding contribution increased from $6 million to $16 million. CHANGES IN ACTUARIAL ASSUMPTIONS: • The Combined Service Annuity (CSA) loads were changed from 0.80 percent for active members and 60.00 percent for vested and nonvested deferred members. The revised CSA loads are now zero percent for active member liability, 15.00 percent for vested deferred member liability, and 3.00 percent for nonvested deferred member liability. • The assumed post-retirement benefit increase rate was changed from 1.00 percent per year for all years, to 1.00 percent per year through 2044, and 2.50 percent per year thereafter. 2016 CHANGES CHANGES IN ACTUARIAL ASSUMPTIONS: • The assumed post-retirement benefit increase rate was changed from 1.00 percent per year through 2035, and 2.50 percent per year thereafter, to 1.00 percent per year for all years. • The assumed investment return was changed from 7.90 percent to 7.50 percent. The single discount rate was changed from 7.90 percent to 7.50 percent. CITY OF ARDEN HILLS Notes to Required Supplementary Information (continued) December 31, 2018 -55- NOTE 2 – PERA – GENERAL EMPLOYEES RETIREMENT FUND (CONTINUED) 2016 CHANGES (CONTINUED) CHANGES IN ACTUARIAL ASSUMPTIONS (CONTINUED): • Other assumptions were changed pursuant to the experience study dated June 30, 2015. The assumed future salary increases, payroll growth, and inflation were decreased by 0.25 percent to 3.25 percent for payroll growth, and 2.50 percent for inflation. 2015 CHANGES CHANGES IN PLAN PROVISIONS: • On January 1, 2015, the Minneapolis Employees Retirement Fund was merged into the General Employees Retirement Fund, which increased the total pension liability by $1.1 billion and increased the fiduciary plan net position by $892 million. Upon consolidation, state and employer contributions were revised. CHANGES IN ACTUARIAL ASSUMPTIONS: • The assumed post-retirement benefit increase rate was changed from 1.00 percent per year through 2030, and 2.50 percent per year thereafter, to 1.00 percent per year through 2035, and 2.50 percent per year thereafter. SUPPLEMENTAL INFORMATION TAB NONMAJOR GOVERNMENTAL FUNDS Special Revenue Funds – Special revenue funds are used to account for revenues derived from specific taxes or other earmarked revenue sources. They are usually required by statute, local ordinance, and/or resolution to finance particular functions, activities, or governments. Capital Project Funds – Capital project funds account for financial resources to be used for the acquisition or construction of major capital facilities (other than those financed by proprietary funds). Total Nonmajor Governmental Special Revenue Capital Project Funds Assets Cash and investments 1,097,956$ –$ 1,097,956$ Accrued interest receivable 5,257 – 5,257 Accounts receivable 25,274 10,609 35,883 Taxes receivable 272 – 272 Prepaid items 214 – 214 Total assets 1,128,973$ 10,609$ 1,139,582$ Liabilities Accounts payable 116,967$ 12,563$ 129,530$ Salaries payable 1,271 – 1,271 Interfund payable – 187,450 187,450 Total liabilities 118,238 200,013 318,251 Fund balances (deficits) Nonspendable 214 – 214 Restricted 1,010,521 – 1,010,521 Unassigned – (189,404) (189,404) Total fund balances (deficits)1,010,735 (189,404) 821,331 Total liabilities and fund balances 1,128,973$ 10,609$ 1,139,582$ CITY OF ARDEN HILLS Nonmajor Governmental Funds Combining Balance Sheet as of December 31, 2018 -56- Total Nonmajor Governmental Special Revenue Capital Project Funds Revenues Taxes Tax increments 349,118$ –$ 349,118$ Earnings (charges) on investments 18,444 (262) 18,182 Franchise taxes 101,237 – 101,237 Other – 63,220 63,220 Total revenues 468,799 62,958 531,757 Expenditures Current General government 124,885 – 124,885 Economic development 265,793 – 265,793 Capital outlay General government – 13,770 13,770 Public safety – 166,000 166,000 Parks and recreation – 650 650 Total expenditures 390,678 180,420 571,098 Revenues over (under) expenditures 78,121 (117,462) (39,341) Other financing sources (uses) Transfers in – 50,000 50,000 Transfers out (135,727) – (135,727) Total other financing soures (uses)(135,727) 50,000 (85,727) Net change in fund balances (57,606) (67,462) (125,068) Fund balances (deficits) – beginning 1,068,341 (121,942) 946,399 Fund balances (deficits) – ending 1,010,735$ (189,404)$ 821,331$ CITY OF ARDEN HILLS Nonmajor Governmental Funds Combining Statement of Revenues, Expenditures, and Changes in Fund Balances Year Ended December 31, 2018 -57- THIS PAGE INTENTIONALLY LEFT BLANK NONMAJOR SPECIAL REVENUE FUNDS The City had the following nonmajor special revenue funds during the year: Cable Fund – This fund was established to account for transactions associated with cable television in the City. Revenues are franchise fees from Comcast. Expenditures include the operation of the North Suburban Cable Commission and other costs relating to cable television activity, internet, and other forms of communication. EDA Revolving Fund – This fund was established to help businesses develop and grow with the expectation to pay back the City. Once the funds are replaced, those funds are available to be loaned out to another business. EDA TIF District No. 3 Fund – This fund was established as a Housing District in 1993. The revenue is derived from tax increment and expenditures are for developer reimbursements and administrative expenses. EDA TIF District No. 4 Fund – This fund was established as a redevelopment plan for Presbyterian Homes of Arden Hills, Inc. in 2010. The revenue is derived from tax increment and expenditures are for developer reimbursements and administrative expenses. Total EDA EDA Nonmajor TIF TIF Special EDA District District Revenue Cable Revolving No. 3 No. 4 Funds Assets Cash and investments 240,181$ –$ 666,054$ 191,721$ 1,097,956$ Accrued interest receivable 1,150 – 3,189 918 5,257 Accounts receivable 25,274 – – – 25,274 Taxes receivable – – 272 – 272 Prepaid items 214 – – – 214 Total assets 266,819$ –$ 669,515$ 192,639$ 1,128,973$ Liabilities Accounts payable 2,711$ –$ –$ 114,256$ 116,967$ Salaries payable 1,271 – – – 1,271 Total liabilities 3,982 – – 114,256 118,238 Fund balances Nonspendable 214 – – – 214 Restricted 262,623 – 669,515 78,383 1,010,521 Total fund balances 262,837 – 669,515 78,383 1,010,735 Total liabilities and fund balances 266,819$ –$ 669,515$ 192,639$ 1,128,973$ CITY OF ARDEN HILLS Nonmajor Special Revenue Funds Combining Balance Sheet as of December 31, 2018 -58- Total EDA EDA Nonmajor TIF TIF Special EDA District District Revenue Cable Revolving No. 3 No. 4 Funds Revenues Taxes Tax increments –$ –$ 95,215$ 253,903$ 349,118$ Earnings on investments 4,361 547 11,389 2,147 18,444 Franchise taxes 101,237 – – – 101,237 Total revenues 105,598 547 106,604 256,050 468,799 Expenditures Current General government 124,885 – – – 124,885 Economic development – 34,208 1,501 230,084 265,793 Total expenditures 124,885 34,208 1,501 230,084 390,678 Revenues over (under) expenditures (19,287) (33,661) 105,103 25,966 78,121 Other financing sources (uses) Transfers out – (135,727) – – (135,727) Net changes in fund balances (19,287) (169,388) 105,103 25,966 (57,606) Fund balances – beginning 282,124 169,388 564,412 52,417 1,068,341 Fund balances – ending 262,837$ –$ 669,515$ 78,383$ 1,010,735$ CITY OF ARDEN HILLS Nonmajor Special Revenue Funds Combining Statement of Revenues, Expenditures, Year Ended December 31, 2018 and Changes in Fund Balances -59- THIS PAGE INTENTIONALLY LEFT BLANK NONMAJOR CAPITAL PROJECT FUNDS The City had the following nonmajor capital project funds during the year: Parks Fund – This fund was established for park/trail acquisition and development. Revenue for this fund comes from developer park dedication fees, contributions, state grants, and investment interest. Public Safety Capital Equipment Fund – This fund was established to account for resources designated to be used for the City’s share of public safety equipment through contracts with the Lake Johanna Volunteer Fire Department, Inc. and Ramsey County Sheriff’s Department. TCAAP Fund – This fund was established to account for resources designated to be used for the City’s share of capital costs related to the approximately 430-acre TCAAP site purchased by Ramsey County. Total Public Safety Nonmajor Capital Capital Parks Equipment TCAAP Project Funds Assets Accounts receivable –$ 10,609$ –$ 10,609$ Liabilities Accounts payable –$ 6,534$ 6,029$ 12,563$ Interfund payable 5,816 23,531 158,103 187,450 Total liabilities 5,816 30,065 164,132 200,013 Fund balances (deficits) Unassigned (5,816) (19,456) (164,132) (189,404) Total liabilities and fund balances –$ 10,609$ –$ 10,609$ CITY OF ARDEN HILLS Nonmajor Capital Project Funds Combining Balance Sheet as of December 31, 2018 -60- Total Public Safety Nonmajor Capital Capital Parks Equipment TCAAP Project Funds Revenues Earnings (charges) on investments –$ (262)$ –$ (262)$ Other 24,350 38,870 – 63,220 Total revenues 24,350 38,608 – 62,958 Expenditures Capital outlay General government – – 13,770 13,770 Public safety – 166,000 – 166,000 Parks and recreation 650 – – 650 Total expenditures 650 166,000 13,770 180,420 Revenues over (under) expenditures 23,700 (127,392) (13,770) (117,462) Other financing sources Transfers in – 50,000 – 50,000 Net changes in fund balances 23,700 (77,392) (13,770) (67,462) Fund balances (deficits) – beginning (29,516) 57,936 (150,362) (121,942) Fund balances (deficits) – ending (5,816)$ (19,456)$ (164,132)$ (189,404)$ CITY OF ARDEN HILLS Nonmajor Capital Project Funds Combining Statement of Revenues, Expenditures, Year Ended December 31, 2018 and Changes in Fund Balances -61- Variance With Original Budget Final Budget Actual Amounts Final Budget Revenues Earnings on investments 5,000$ 5,000$ 4,361$ (639)$ Franchise taxes 100,000 100,000 101,237 1,237 Total revenues 105,000 105,000 105,598 598 Expenditures Current General government Personal services 58,085 58,085 59,453 (1,368) Other services and charges 98,685 98,685 65,432 33,253 Capital outlay General government 2,000 2,000 – 2,000 Total expenditures 158,770 158,770 124,885 33,885 Net change in fund balances (53,770)$ (53,770)$ (19,287) 34,483$ Fund balances – beginning 282,124 Fund balances – ending 262,837$ CITY OF ARDEN HILLS Special Revenue Fund – Cable Fund Schedule of Revenues, Expenditures, and Changes in Fund Balances Budget and Actual Year Ended December 31, 2018 -62- Variance With Original Budget Final Budget Actual Amounts Final Budget Revenues Earnings on investments 3,000$ 3,000$ 547$ (2,453)$ Expenditures Current Economic development – – 34,208 (34,208) Revenues over (under) expenditures 3,000 3,000 (33,661) (36,661) Other financing sources (uses) Transfers out – (135,725) (135,727)(2) Net change in fund balances 3,000$ (132,725)$ (169,388) (36,663)$ Fund balances – beginning 169,388 Fund balances – ending –$ CITY OF ARDEN HILLS Special Revenue Fund – EDA Revolving Fund Schedule of Revenues, Expenditures, and Changes in Fund Balances Budget and Actual Year Ended December 31, 2018 -63- Variance With Original Budget Final Budget Actual Amounts Final Budget Revenues Taxes Tax increments 65,000$ 65,000$ 95,215$ 30,215$ Earnings on investments 7,000 7,000 11,389 4,389 Total revenues 72,000 72,000 106,604 34,604 Expenditures Current Economic development Other services and charges 4,725 4,725 1,501 3,224 Net change in fund balances 67,275$ 67,275$ 105,103 37,828$ Fund balances – beginning 564,412 Fund balances – ending 669,515$ CITY OF ARDEN HILLS Special Revenue Fund – EDA TIF District No. 3 Fund Schedule of Revenues, Expenditures, and Changes in Fund Balances Budget and Actual Year Ended December 31, 2018 -64- Variance With Original Budget Final Budget Actual Amounts Final Budget Revenues Taxes Tax increments 150,000$ 150,000$ 253,903$ 103,903$ Earnings on investments 700 700 2,147 1,447 Total revenues 150,700 150,700 256,050 105,350 Expenditures Current Economic development Other services and charges 139,525 139,525 230,084 (90,559) Net change in fund balances 11,175$ 11,175$ 25,966 14,791$ Fund balances – beginning 52,417 Fund balances – ending 78,383$ CITY OF ARDEN HILLS Special Revenue Fund – EDA TIF District No. 4 Fund Schedule of Revenues, Expenditures, and Changes in Fund Balances Budget and Actual Year Ended December 31, 2018 -65- THIS PAGE INTENTIONALLY LEFT BLANK INTERNAL SERVICE FUNDS The City had the following internal service funds during the year: Risk Management Fund – This fund was established to account for the payment of property, liability, and workers’ compensation insurance deductibles and funds wellness activities for all departments. Engineering Fund – This fund was established to account for the costs related to engineering services. All costs are compiled in this fund and charged out to the departments based on usage. Central Garage Fund – This fund was established to account for certain public works department costs related to streets, parks, water, sanitary sewer, and surface water management. All costs are compiled in this fund and charged out to the departments based on usage. Technology Fund – This fund was established to account for costs related to technology. All costs are compiled in this fund and charged out to the departments based on usage. Total Risk Central Internal Management Engineering Garage Technology Service Funds Assets Current assets Cash and investments 382,146$ 2,537$ 22,266$ 8,719$ 415,668$ Accrued interest receivable 1,829 – – 42 1,871 Total assets 383,975 2,537 22,266 8,761 417,539 Liabilities Current liabilities Accounts payable 375 1,562 14,948 2,436 19,321 Salaries payable – 143 246 99 488 Due to other governmental units – – 5,760 5,291 11,051 Compensated absences payable – 624 984 242 1,850 Total current liabilities 375 2,329 21,938 8,068 32,710 Noncurrent liabilities Compensated absences payable – 208 328 81 617 Total liabilities 375 2,537 22,266 8,149 33,327 Net position Unrestricted 383,600$ –$ –$ 612$ 384,212$ CITY OF ARDEN HILLS Combining Statement of Net Position Internal Service Funds as of December 31, 2018 -66- Total Risk Central Internal Management Engineering Garage Technology Service Funds Operating revenues Charges for services 115,025$ 117,118$ 306,665$ 232,920$ 771,728$ Miscellaneous 2,619 – – – 2,619 Total operating revenues 117,644 117,118 306,665 232,920 774,347 Operating expenses Personal services 10,136 36,750 20,436 5,286 72,608 Supplies and maintenance – – 147,193 4,615 151,808 Other services and charges 13,239 525 109,489 6,552 129,805 Purchased services 114,422 72,752 2,649 184,107 373,930 Total operating expenses 137,797 110,027 279,767 200,560 728,151 Operating income (loss)(20,153) 7,091 26,898 32,360 46,196 Nonoperating revenues (expenses) Earnings (charges) on investments 5,077 (71) (101) 42 4,947 Change in net position (15,076) 7,020 26,797 32,402 51,143 Net position – beginning 398,676 (7,020) (26,797) (31,790) .333,069 Net position – ending 383,600$ –$ –$ 612$ 384,212$ CITY OF ARDEN HILLS Combining Statement of Revenues, Expenses, and Changes in Net Position Internal Service Funds Year Ended December 31, 2018 -67- Total Risk Central Internal Management Engineering Garage Technology Service Funds Cash flows from operating activities Receipts from customers and users 117,644$ 117,118$ 306,665$ 232,920$ 774,347$ Payments to suppliers (127,661) (85,274) (281,735) (202,893) (697,563) Payments to employees (10,395) (36,055) (19,490) (5,316) (71,256) Net cash flows from operating activities (20,412) (4,211) 5,440 24,711 5,528 Cash flows from noncapital financing activities Cash paid to other funds – – – (15,992) (15,992) Cash flows from investing activities Earnings (charges) on investments 4,693 (13) (8) – 4,672 Net change in cash and cash equivalents (15,719) (4,224) 5,432 8,719 (5,792) Cash and cash equivalents – beginning 397,865 6,761 16,834 – 421,460 Cash and cash equivalents – ending 382,146$ 2,537$ 22,266$ 8,719$ 415,668$ Reconciliation of operating income (loss) to net cash flows from operating activities Operating income (loss)(20,153)$ 7,091$ 26,898$ 32,360$ 46,196$ Adjustments to reconcile operating income (loss) to net cash provided (used) by operating activities Decrease (increase) in prepaid items – – 23 – 23 Increase (decrease) in accounts payable – (11,997) 1,368 (6,317) (16,946) Increase (decrease) in salaries payable 185 26 47 (2) 256 Increase (decrease) in due to other governments – – (23,795) (1,302) (25,097) Increase (decrease) in compensated absences payable (444) 669 899 (28) 1,096 Total adjustments (259) (11,302) (21,458) (7,649) (40,668) Net cash flows from operating activities (20,412)$ (4,211)$ 5,440$ 24,711$ 5,528$ CITY OF ARDEN HILLS Combining Statement of Cash Flows Internal Service Funds Year Ended December 31, 2018 -68- STATISTICAL SECTION (UNAUDITED) TAB STATISTICAL SECTION (UNAUDITED) This part of the City’s Comprehensive Annual Financial Report (CAFR) presents detailed information as a context for understanding this year’s financial statements, note disclosures, and supplementary information. This information has not been audited by the independent auditor. The contents of the statistical section include: Financial Trends – These tables contain trend information that may assist the reader in assessing the City’s current financial performance by placing it in historical perspective. Revenue Capacity – These schedules contain information to assist the reader in assessing the City’s most significant local revenue source—property taxes. Debt Capacity – These tables present information that may assist the reader in analyzing the affordability of the City’s current levels of outstanding debt and the City’s ability to issue additional debt in the future. Demographic and Economic Information – These tables offer economic and demographic indicators that are commonly used for financial analysis and that can assist the reader in understanding the City’s present and ongoing financial status. Operating Information – These tables contain service and infrastructure indicators that can assist the reader in understanding how the information in the City’s financial report relates to the services the City provides and the activities it performs. Source – Unless otherwise noted, the information in these tables is derived from the CAFR for the relevant year. 2009 2010 2011 2012 Governmental activities Net investment in capital assets 14,789,291$ 16,341,354$ 17,498,478$ 17,167,531$ Restricted 1,060,973 1,329,092 1,694,212 1,788,007 Unrestricted 9,176,652 9,008,528 9,133,279 9,738,832 Total governmental activities net position 25,026,916$ 26,678,974$ 28,325,969$ 28,694,370$ Business-type activities Net investment in capital assets 10,507,344$ 10,530,204$ 10,961,855$ 12,360,674$ Unrestricted 2,171,942 2,621,579 3,248,534 2,403,645 Total business-type activities net position 12,679,286$ 13,151,783$ 14,210,389$ 14,764,319$ Primary government Net investment in capital assets 25,296,635$ 26,871,558$ 28,460,333$ 29,528,205$ Restricted 1,060,973 1,329,092 1,694,212 1,788,007 Unrestricted 11,348,594 11,630,107 12,381,813 12,142,477 Total primary government net position 37,706,202$ 39,830,757$ 42,536,358$ 43,458,689$ Note:The City implemented GASB Statement No.68 in fiscal 2015.The City reported a change in accounting principle as a result of implementing this standard that decreased unrestricted net position. Prior year information has not been restated. Fiscal Year CITY OF ARDEN HILLS Net Position by Component Last Ten Fiscal Years (Accrual Basis of Accounting) -69- 2013 2014 2015 2016 2017 2018 17,435,976$ 18,837,904$ 24,909,453$ 25,178,721$ 22,750,377$ 26,972,898$ 896,106 917,300 675,052 786,678 898,739 1,010,521 10,274,835 11,472,102 8,765,793 8,249,560 10,678,219 8,736,913 28,606,917$ 31,227,306$ 34,350,298$ 34,214,959$ 34,327,335$ 36,720,332$ 14,356,782$ 14,464,713$ 16,167,536$ 16,306,381$ 16,292,000$ 17,295,916$ 1,158,470 1,793,112 238,381 1,116,957 1,298,744 1,329,268 15,515,252$ 16,257,825$ 16,405,917$ 17,423,338$ 17,590,744$ 18,625,184$ 31,792,758$ 33,302,617$ 41,076,989$ 41,485,102$ 39,042,377$ 44,268,814$ 896,106 917,300 675,052 786,678 898,739 1,010,521 11,433,305 13,265,214 9,004,174 9,366,517 11,976,963 10,066,181 44,122,169$ 47,485,131$ 50,756,215$ 51,638,297$ 51,918,079$ 55,345,516$ -70- 2009 2010 2011 2012 Expenses Governmental activities General government 1,622,425$ 1,232,225$ 1,199,609$ 1,186,404$ Public safety 1,648,349 1,585,447 1,736,422 1,900,443 Public works 436,200 636,406 614,761 894,954 Parks and recreation 734,148 732,824 811,533 838,138 Economic development 48,322 3,311 6,862 61,770 Interest on long-term debt 53,496 46,470 39,146 31,287 Total governmental activities 4,542,940 4,236,683 4,408,333 4,912,996 Business-type activities Water 1,648,815 1,678,954 1,573,669 1,983,200 Sewer 1,268,018 1,367,429 1,454,302 1,595,379 Surface water management 269,562 321,693 353,330 388,406 Recycling 118,197 129,139 137,622 142,114 Total business-type activities 3,304,592 3,497,215 3,518,923 4,109,099 Total primary government 7,847,532$ 7,733,898$ 7,927,256$ 9,022,095$ Program revenues Governmental activities Charges for services General government 341,736$ 271,972$ 353,224$ 377,621$ Public safety 307,306 207,876 385,133 376,576 Public works – – – – Parks and recreation 91,305 98,395 110,830 118,179 Operating grants and contributions 210,140 275,869 410,228 291,712 Capital grants and contributions 705,858 1,171,451 946,122 134,710 Total governmental activities 1,656,345 2,025,563 2,205,537 1,298,798 Business-type activities Charges for services Water 1,709,639 1,824,086 1,950,932 2,285,161 Sewer 1,313,897 1,574,493 1,852,364 1,739,123 Surface water management 503,070 518,672 531,845 567,361 Recycling 87,700 121,892 142,858 121,688 Operating grants and contributions 19,866 20,114 20,846 19,802 Capital grants and contributions – – 140,428 25,506 Total business-type activities 3,634,172 4,059,257 4,639,273 4,758,641 Total primary government 5,290,517$ 6,084,820$ 6,844,810$ 6,057,439$ Fiscal Year CITY OF ARDEN HILLS Changes in Net Position Last Ten Fiscal Years (Accrual Basis of Accounting) -71- 2013 2014 2015 2016 2017 2018 1,133,379$ 1,294,830$ 1,281,557$ 1,384,908$ 1,322,106$ 1,286,845$ 1,956,260 1,887,877 1,978,210 2,047,961 2,158,835 2,248,540 944,104 852,109 194,667 800,157 3,512,218 1,695,449 807,363 711,174 711,181 751,910 759,737 765,843 403,143 522,193 733,528 361,029 276,841 391,156 25,767 11,004 817 – – – 5,270,016 5,279,187 4,899,960 5,345,965 8,029,737 6,387,833 1,843,530 1,893,217 1,803,405 1,833,468 2,159,874 2,147,359 1,560,796 1,506,927 1,587,808 1,513,219 1,780,260 1,654,079 453,727 432,788 489,377 468,965 481,026 499,049 144,541 150,417 239,727 141,190 147,919 168,145 4,002,594 3,983,349 4,120,317 3,956,842 4,569,079 4,468,632 9,272,610$ 9,262,536$ 9,020,277$ 9,302,807$ 12,598,816$ 10,856,465$ 338,546$ 275,735$ 271,991$ 299,692$ 314,166$ 214,833$ 341,114 366,452 628,573 735,730 915,632 619,406 – 4,973 5,205 4,535 7,029 6,150 113,374 116,951 119,338 134,579 123,550 113,968 343,486 300,536 389,219 308,900 2,031,474 840,634 326,213 2,302,439 3,080,749 462,105 448,945 2,494,823 1,462,733 3,367,086 4,495,075 1,945,541 3,840,796 4,289,814 2,271,072 2,132,191 2,099,242 2,165,773 2,104,271 2,256,859 1,798,889 1,857,272 1,855,802 1,989,066 1,727,124 1,769,466 639,747 762,884 782,501 812,044 834,891 839,499 122,666 130,369 129,030 134,739 150,989 134,228 19,694 19,611 124,228 26,323 24,655 27,429 156,585 – – 59,248 92,566 735,220 5,008,653 4,902,327 4,990,803 5,187,193 4,934,496 5,762,701 6,471,386$ 8,269,413$ 9,485,878$ 7,132,734$ 8,775,292$ 10,052,515$ -72-(continued) 2009 2010 2011 2012 Net (expense) revenue Governmental activities (2,886,595)$ (2,211,120)$ (2,202,796)$ (3,614,198)$ Business-type activities 329,580 562,042 1,120,350 649,542 Total primary government (2,557,015)$ (1,649,078)$ (1,082,446)$ (2,964,656)$ General revenues and other changes in net position Governmental activities Taxes Property taxes 2,860,820$ 2,836,982$ 2,920,078$ 3,095,488$ Tax increment collections 540,408 566,725 342,109 431,060 Franchise taxes 104,148 85,131 90,123 94,532 Unrestricted investment earnings 275,500 231,340 307,769 218,519 Gain on sale of capital assets – – 46,712 – Transfers 132,500 143,000 143,000 143,000 Total governmental activities 3,913,376 3,863,178 3,849,791 3,982,599 Business-type activities Unrestricted investment earnings 55,106 53,455 81,256 47,388 Transfers (132,500) (143,000) (143,000) (143,000) Total business-type activities (77,394) (89,545) (61,744) (95,612) Total primary government 3,835,982$ 3,773,633$ 3,788,047$ 3,886,987$ Change in net position Governmental activities 1,026,781$ 1,652,058$ 1,646,995$ 368,401$ Business-type activities 252,186 472,497 1,058,606 553,930 Total primary government 1,278,967$ 2,124,555$ 2,705,601$ 922,331$ Fiscal Year CITY OF ARDEN HILLS Changes in Net Position Last Ten Fiscal Years (continued) (Accrual Basis of Accounting) -73- 2013 2014 2015 2016 2017 2018 (3,807,283)$ (1,912,101)$ (404,885)$ (3,400,424)$ (4,188,941)$ (2,098,019)$ 1,006,059 918,978 870,486 1,230,351 365,417 1,294,069 (2,801,224)$ (993,123)$ 465,601$ (2,170,073)$ (3,823,524)$ (803,950)$ 3,094,036$ 3,182,331$ 3,191,426$ 3,278,287$ 3,526,347$ 3,578,894$ 466,280 565,422 697,898 242,544 295,788 351,569 96,820 103,711 72,837 132,548 109,070 101,237 (168,071) 450,261 245,540 155,191 139,347 159,316 – – – – – – 230,765 230,765 230,765 230,765 230,765 300,000 3,719,830 4,532,490 4,438,466 4,039,335 4,301,317 4,491,016 (24,361) 54,360 35,857 17,835 32,754 40,371 (230,765) (230,765) (230,765) (230,765) (230,765) (300,000) (255,126) (176,405) (194,908) (212,930) (198,011) (259,629) 3,464,704$ 4,356,085$ 4,243,558$ 3,826,405$ 4,103,306$ 4,231,387$ (87,453)$ 2,620,389$ 4,033,581$ 638,911$ 112,376$ 2,392,997$ 750,933 742,573 675,578 1,017,421 167,406 1,034,440 663,480$ 3,362,962$ 4,709,159$ 1,656,332$ 279,782$ 3,427,437$ -74- THIS PAGE INTENTIONALLY LEFT BLANK Tax Property Increment Franchise Fiscal Year Taxes Collections Taxes Total 2009 2,860,820$ 540,408$ 104,148$ 3,505,376$ 2010 2,836,982 566,725 85,131 3,488,838 2011 2,920,078 342,109 90,123 3,352,310 2012 3,095,488 431,060 94,532 3,621,080 2013 3,094,036 466,280 96,820 3,657,136 2014 3,182,331 565,422 103,711 3,851,464 2015 3,191,426 697,898 72,837 3,962,161 2016 3,278,287 242,544 132,548 3,653,379 2017 3,526,347 295,788 109,070 3,931,205 2018 3,578,894 351,569 101,237 4,031,700 CITY OF ARDEN HILLS Governmental Activities Tax Revenues by Source Last Ten Fiscal Years (Accrual Basis of Accounting) -75- 2009 2010 2011 2012 General Fund Reserved 24,304$ 32,587$ –$ –$ Unreserved 1,797,956 1,730,605 – – Nonspendable – – 29,063 22,326 Assigned – – 106,592 126,134 Unassigned – – 2,015,680 2,202,459 Total General Fund 1,822,260$ 1,763,192$ 2,151,335$ 2,350,919$ All other governmental funds Reserved 1,063,087$ 1,331,259$ –$ –$ Unreserved, reported in Special revenue funds 733,626 468,786 – – Capital project funds 7,242,406 7,212,442 – – Nonspendable – – – 628 Restricted – – 1,696,379 1,799,380 Committed – – 264,016 452,496 Assigned – – 6,993,767 6,863,115 Unassigned – – (542,821) (303,339) Total all other governmental funds 9,039,119$ 9,012,487$ 8,411,341$ 8,812,280$ Note: The City implemented GASB Statement No. 54 in fiscal 2011. Prior year information has not been restated. Fiscal Year CITY OF ARDEN HILLS Fund Balances of Governmental Funds Last Ten Fiscal Years -76- 2013 2014 2015 2016 2017 2018 –$ –$ –$ –$ –$ –$ – – – – – – 22,754 21,059 23,983 26,271 288,519 25,482 119,440 139,721 251,497 257,771 285,548 262,805 2,223,512 2,185,162 2,806,930 2,660,771 3,065,250 3,052,082 2,365,706$ 2,345,942$ 3,082,410$ 2,944,813$ 3,639,317$ 3,340,369$ –$ –$ –$ –$ –$ –$ – – – – – – – – – – – – 910 395 845 214 664 214 888,707 917,300 675,052 786,678 898,739 1,010,521 421,989 471,161 449,898 450,433 471,996 508,241 7,111,210 7,346,178 3,902,898 3,872,938 6,138,393 2,873,879 (134,316) (150,893) (216,521) (217,607) (439,147) (189,404) 8,288,500$ 8,584,141$ 4,812,172$ 4,892,656$ 7,070,645$ 4,203,451$ -77- Fiscal Year 2009 2010 2011 2012 Revenues Taxes General property tax 2,835,253$ 2,867,028$ 2,913,248$ 3,087,160$ Tax increments 540,408 566,725 342,109 431,060 Special assessments 410,935 388,768 561,238 252,879 Licenses and permits 318,849 255,265 429,991 415,070 Intergovernmental 130,622 878,944 246,416 143,085 Charges for services 332,358 322,978 419,197 450,589 Fines and forfeits 26,111 27,013 29,593 33,192 Earnings on investments 275,500 231,340 296,249 215,119 Franchise taxes 104,148 85,131 90,123 94,532 Antenna rental fees 63,009 65,759 72,351 75,745 Miscellaneous/other 147,187 118,096 365,259 113,974 Total revenues 5,184,380 5,807,047 5,765,774 5,312,405 Expenditures Current General government 1,283,267 1,127,726 1,060,744 1,054,662 Public safety 1,526,819 1,561,046 1,640,801 1,728,669 Public works 282,019 322,793 273,165 377,101 Parks and recreation 606,822 605,210 661,746 679,282 Economic development 48,322 3,311 6,862 57,766 Capital outlay General government 285,028 108,575 684,492 8,847 Public safety 156,543 18,927 91,579 169,894 Public works 1,088,586 865,334 1,063,181 376,872 Parks and recreation 128,037 1,141,300 64,923 109,761 Economic development – – – 5,330 Debt service Principal 225,000 235,000 245,000 255,000 Interest and paying agent fees 53,425 46,525 39,325 31,698 Total expenditures 5,683,868 6,035,747 5,831,818 4,854,882 Revenues over (under) expenditures (499,488) (228,700) (66,044) 457,523 Other financing sources (uses) Transfers in 809,621 719,791 143,000 143,000 Transfers out (677,121) (576,791) – – Sale of capital assets – – 46,712 – Total other financing sources (uses)132,500 143,000 189,712 143,000 Net change in fund balances (366,988)$ (85,700)$ 123,668$ 600,523$ Debt service as a percentage of noncapital expenditures 6.52 % 7.12 % 6.99 % 6.21 % CITY OF ARDEN HILLS Changes in Fund Balances of Governmental Funds Last Ten Fiscal Years (Modified Accrual Basis of Accounting) -78- 2013 2014 2015 2016 2017 2018 3,086,064$ 3,210,025$ 3,203,004$ 3,260,537$ 3,541,705$ 3,578,628$ 466,280 565,422 697,898 242,544 295,788 351,569 382,366 304,315 908,964 373,415 308,990 735,369 382,039 327,727 518,846 598,686 729,197 526,444 316,859 1,408,240 1,396,269 396,275 2,124,414 1,003,685 410,995 400,224 496,908 577,041 590,141 427,905 32,055 29,569 32,792 31,868 29,989 37,080 (164,535) 433,402 236,947 148,679 133,231 154,369 96,820 103,711 72,837 132,548 109,070 101,237 76,574 110,144 189,534 123,815 128,765 57,067 43,777 89,482 241,463 94,442 164,256 249,322 5,129,294 6,982,261 7,995,462 5,979,850 8,155,546 7,222,675 1,054,852 1,155,120 1,143,037 1,194,579 1,189,500 1,164,657 1,779,549 1,826,098 1,920,280 1,981,506 2,058,037 2,088,345 391,711 580,872 336,398 479,814 443,633 579,535 675,073 648,214 573,587 621,832 618,614 653,977 90,222 286,991 249,484 229,688 264,905 324,548 9,545 5,559 – – – 13,770 170,511 66,079 52,936 47,880 100,215 233,301 1,017,328 1,833,535 6,198,264 786,873 734,411 2,916,604 68,493 18,883 – – 337,808 2,783,238 328,248 231,025 502,842 151,306 7,520 – 260,000 270,000 280,000 – – – 23,520 14,773 4,900 – – – 5,869,052 6,937,149 11,261,728 5,493,478 5,754,643 10,757,975 (739,758) 45,112 (3,266,266) 486,372 2,400,903 (3,535,300) 230,765 230,765 230,765 230,765 471,590 300,000 – – – – – – – – – – – 69,158 230,765 230,765 230,765 230,765 471,590 369,158 (508,993)$ 275,877$ (3,035,501)$ 717,137$ 2,872,493$ (3,166,142)$ 5.82 % 5.73 % 6.20 % – % – % – % -79- THIS PAGE INTENTIONALLY LEFT BLANK Fiscal Year General Tax Increment Franchise Tax Total 2009 2,835,253$ 540,408$ 104,148$ 3,479,809$ 2010 2,867,028 566,725 85,131 3,518,884 2011 2,913,248 342,109 90,123 3,345,480 2012 3,087,160 431,060 94,532 3,612,752 2013 3,086,064 466,280 96,820 3,649,164 2014 3,210,025 565,422 103,711 3,879,158 2015 3,203,004 697,898 72,837 3,973,739 2016 3,260,537 242,544 132,548 3,635,629 2017 3,541,705 295,788 109,070 3,946,563 2018 3,578,628 351,569 101,237 4,031,434 CITY OF ARDEN HILLS General Governmental Tax Revenues by Source Last Ten Fiscal Years (Modified Accrual Basis of Accounting) Property Tax -80- Fiscal Year Less Tax Ended Real Personal Total Increment December 31,Property Property Tax Capacity District 2009 16,414,454$ *153,000$ 16,567,454$ 583,017$ 2010 15,659,356 164,655 15,824,011 590,269 2011 14,606,183 178,841 14,785,024 531,415 2012 13,848,510 190,989 14,039,499 436,893 2013 13,262,619 213,949 13,476,568 438,897 2014 13,413,316 216,679 13,629,995 510,906 2015 14,162,432 224,125 14,386,557 684,465 2016 14,364,828 236,271 14,601,099 207,526 2017 14,671,678 262,904 14,934,582 256,243 2018 15,751,958 276,244 16,028,202 308,152 Tax Capacity Value and Estimated Market Value of Taxable Property CITY OF ARDEN HILLS Last Ten Fiscal Years Source: Ramsey County Assessor * The breakdown between Real and Personal Property was estimated for 2009. -81- Less Fiscal Adjusted Estimated Disparity Tax Capacity Market Contribution (ATC) Value Value (EMV) 2,865,756$ 13,118,681$ 20.53 % 1,229,529,900$ 1.07 % 3,096,380 12,137,362 22.67 1,171,068,100 1.04 2,921,351 11,332,258 24.19 1,109,327,600 1.02 2,505,319 11,097,287 25.54 1,043,419,700 1.06 2,474,502 10,563,169 27.93 1,035,471,700 1.02 2,375,745 10,743,344 27.95 1,055,153,800 1.02 2,303,582 11,398,510 27.29 1,122,428,000 1.02 2,280,682 12,112,891 26.54 1,144,221,600 1.06 2,365,021 12,313,318 27.21 1,173,397,600 1.05 2,141,470 13,578,580 25.53 1,260,228,800 1.08 of EMV ATC as a Percentage Direct Tax Rate Total * The breakdown between Real and Personal Property was estimated for 2009. -82- 20.534 % 46.546 % 22.937 %– %90.017 % 22.672 50.248 24.560 7.953 105.433 24.187 54.678 25.573 8.354 112.792 25.544 61.316 29.044 9.955 125.859 27.931 65.240 29.444 10.200 132.815 27.950 63.735 29.734 9.825 131.244 27.294 58.922 27.378 9.179 122.773 26.539 58.885 26.245 9.052 120.721 27.211 55.850 25.305 8.558 116.924 25.532 53.962 28.464 8.249 116.207 (1) Note: Source: Ramsey County Assessor School 2018 RateFiscal Year Rates for special taxing districts were not readily available prior to 2010. CITY OF ARDEN HILLS Property Tax Rates Last Ten Fiscal Years Direct and Overlapping (1) Governments Special Ramsey Districts Overlapping RatesDirect Rate Operating Taxing City Overlapping rates are those of local and county governments that apply to property owners within the City. Not all overlapping rates apply to all city property owners (e.g., the rates for special districts apply only to the proportion of the City’s property owners whose property is located within the geographic boundaries of the special district). County 2010 2009 2016 2017 2013 2015 Total 2011 2012 District 2014 -83- Taxable Taxable Capacity Value Rank Capacity Value Rank Cardiac Pacemakers, Inc.1,129,960$ 1 7.05 %1,999,250$ 1 12.07 % NSP 532,022 2 3.32 262,674 10 1.59 Space Center Arden Hills, LLC 435,144 3 2.71 – – – St. Paul Fire and Marine Insurance Company 432,544 4 2.70 401,342 4 2.42 Land O’Lakes, Inc.380,754 5 2.38 390,146 6 2.35 Presbyterian Homes, Inc.338,250 6 2.11 – – – CSM Corporation 252,880 7 1.58 471,730 2 2.85 LSREF4 BISON LLC 199,740 8 1.25 – – – RAM Development, LLC 187,790 9 1.17 – – – ET Arden Hills, LLC 149,306 10 0.93 – – – Arden Hills Industrial, LLC – – – 436,234 3 2.63 Mutual Service Insurance Company – – – 399,250 5 2.41 Inland Shannon Square Cub, LLC – – – 363,602 7 2.19 IRET Properties, LP – – – 359,250 8 2.17 Pharmacia Deltec, Inc.– – – 273,250 9 1.65 Total 4,038,390$ 25.20 % 5,356,728$ 32.33 % Total capacity value 16,028,202$ 16,567,454$ Source: Ramsey County Assessor Taxpayer Percentage of Total City Value Percentage of Total City Value Capacity CITY OF ARDEN HILLS Principal Property Taxpayers Current Year and Nine Years Ago 2018 Capacity 2009 -84- Taxes Collections Fiscal Year Levied in Ended for the Additions/ Subsequent December 31, Fiscal Year Amount (Abatements) Years Amount 2009 2,892,774$ 2,829,900$ 97.83 %(47,523)$ 15,351$ 2,892,774$ 100.00 % 2010 2,953,128 2,890,946 97.89 (29,095) 33,087 2,953,128 100.00 2011 3,040,964 3,008,068 98.92 (2,326) 30,570 3,040,964 100.00 2012 3,096,994 3,045,572 98.34 (11,376) 40,046 3,096,994 100.00 2013 3,191,230 3,117,083 97.68 (38,542) 35,605 3,191,230 100.00 2014 3,257,456 3,219,641 98.84 (19,251) 17,175 3,256,067 99.96 2015 3,359,775 3,295,723 98.09 (75,019) (12,469) 3,358,273 99.96 2016 3,478,775 3,408,642 97.98 (79,442) (10,421) 3,477,663 99.97 2017 3,641,290 3,562,166 97.83 (66,924) 10,748 3,639,838 99.96 2018 3,786,942 3,710,786 97.99 (58,021) – 3,768,807 99.52 Source: Ramsey County Assessor CITY OF ARDEN HILLS Last Ten Fiscal Years Property Tax Levies and Collections Collected Within the Fiscal Year of the Levy Percentage of Levy Percentage of Levy Total Collections to Date -85- Governmental Activities General Total Obligation Revenue Primary Per TIF Bonds Bonds Premium Total Government Capita (1) 1,545,000$ –$ –$ –$ 1,545,000$ 0.40 % 152$ 1,310,000 – – – 1,310,000 0.37 137 1,065,000 – – – 1,065,000 0.30 114 810,000 – – – 810,000 0.24 84 550,000 – – – 550,000 0.17 59 280,000 – – – 280,000 0.08 29 (2)– – – – – – – (2)– – – – – – – (2)– – – – – – – (2)– 2,415,000 156,952 2,571,952 2,571,952 0.66 255 (1) (2) Note: Fiscal Year CITY OF ARDEN HILLS Ratios of Outstanding Debt by Type Last Ten Fiscal Years Business-Type Activities Income (1) of Personal Percentage 2010 2009 2015 2014 2013 See the Schedule of Demographic and Economic Statistics for personal income and population data. The City made the final governmental activities bond payment in 2015. There is no outstanding bonded debt as of year-end. Details regarding the City’s outstanding debt can be found in the notes to basic financial statements. 2012 2011 2016 2017 2018 -86- THIS PAGE INTENTIONALLY LEFT BLANK Net Estimated Debt Share of Governmental Unit Outstanding Overlapping Debt Debt repaid with property taxes Ramsey County 98,073,786$ 2.51 %2,465,275$ County library 26,437,422 5.00 1,322,851 Independent School District No. 621 229,100,266 13.73 31,459,287 Independent School District No. 623 170,245,228 0.78 1,319,847 Intermediate School District No. 916 75,125,459 5.08 3,817,807 Metropolitan Council 1,351,243,297 0.37 5,019,673 Total overlapping debt 45,404,740 City of Arden Hills – 100.00 – Total direct and overlapping debt 45,404,740$ (1) Note: Source: The percentage of overlapping debt applicable is estimated using taxable assessed property values. Applicable percentages were estimated by determining the portion of the county’s taxable assessed value that is within the City’s boundaries and dividing it by the county’s total taxable assessed value. Overlapping governments are those that coincide,at least in part, with the geographic boundaries of the City. This schedule estimates the portion of the outstanding debt of those overlapping governments that is borne by the residents and businesses of the City. This process recognizes that, when considering the City’s ability to issue and repay long-term debt, the entire debt burden borne by the residents and businesses should be taken into account. However, this does not imply that every taxpayer is a resident and, therefore, responsible for repaying the debt of each overlapping government. Assessed value data used to estimate applicable percentages provided by the Ramsey County Assessor. Debt outstanding data provided by the county. CITY OF ARDEN HILLS Direct and Overlapping Governmental Activities Debt as of December 31, 2018 Estimated Percentage Applicable (1) -87- 2009 2010 2011 2012 36,885,897$ 35,132,043$ 33,279,828$ 31,302,591$ – – – – 36,885,897$ 35,132,043$ 33,279,828$ 31,302,591$ Total net debt applicable to the limit – – – – Note:Under state finance law, the City’s net debt should not exceed 3 percent of total market value.By law, the debt subject to the limitation may be offset by amounts set aside for repaying bonds. Tax increment and revenue bonds are not subject to the debt limit; therefore, they are not included. CITY OF ARDEN HILLS Legal Debt Margin Information Last Ten Fiscal Years Fiscal Year Debt limit Total net debt applicable to the limit Legal debt margin as a percentage of debt limit -88- 2013 2014 2015 2016 2017 2018 31,064,151$ 31,654,614$ 33,672,840$ 34,326,648$ 35,201,928$ 37,806,864$ – – – – – – 31,064,151$ 31,654,614$ 33,672,840$ 34,326,648$ 35,201,928$ 37,806,864$ – – – – – – Total estimated market value 1,260,228,800$ Debt limit (3% of market value)37,806,864 Debt applicable to the limit General obligation bonds – Less amount set aside for repayment of general obligation debt – Total net debt applicable to the limit – Legal debt margin 37,806,864$ Legal Debt Margin Calculation for Fiscal Year 2018 -89- Operating Less Operating Net Available Revenues Expenses Revenue Principal Interest 4,026,325$ 3,279,800$ 746,525$ –$ –$ N/A N/A – Not Applicable Note 1: Note 2: CITY OF ARDEN HILLS Pledged Revenue Coverage Last Ten Fiscal Years 2018 represents the first year the City pledged revenue for utility revenue bonds. Debt Service Includes Water and Sewer Funds. Operating expenses do not include interest or depreciation. Fiscal Year Coverage 2018 -90- Per Capita Arden Hills Personal Total Personal Median School Population (1) Income (3) Income (4) Age (6) Enrollment (5) 10,137 37,918$ 384,374,766$ 35.0 10,071 7.6 % 9,552 36,806 351,570,912 36.2 10,032 7.5 9,381 37,371 350,577,351 34.8 10,090 6.6 9,597 35,375 339,493,875 34.8 10,234 5.7 9,359 33,688 315,285,992 34.8 10,480 4.9 9,652 34,481 332,810,612 36.9 10,734 4.0 9,847 35,222 346,831,034 36.0 11,011 3.6 9,966 35,994 358,716,204 36.0 11,401 3.6 9,969 37,723 376,060,587 36.3 11,556 3.3 10,069 38,477 387,417,617 36.3 11,647 2.7 Sources: (1) (2) (3) (4) (5) (6) 2018 Enrollment numbers are based off of Independent School District No. 621, Mounds View from the Minnesota Department of Education website. Median age is from www.city-data.com website. Per capita personal income is obtained from the Metropolitan Council website. 2018 is estimated by city staff. Rate (2) Population data is obtained from the Metropolitan Council website. 2018 is estimated by city staff. 2013 Personal income is calculated based on the population and per capita personal income. Fiscal Year 2014 Unemployment rate information is from DEED for Ramsey County. 2010 2011 2012 2017 2015 CITY OF ARDEN HILLS Demographic and Economic Statistics Last Ten Fiscal Years 2016 2009 Unemployment -91- THIS PAGE INTENTIONALLY LEFT BLANK Employees Rank Employees Rank Boston Scientific 2,200 1 19.5 % 2,000 1 15.4 % Land O’Lakes, Inc.1,147 2 10.2 800 2 6.2 Bethel University 970 3 8.6 – – – University of Northwestern 960 4 8.5 – – – Presbyterian Homes of Arden Hills 500 5 4.4 500 4 3.8 Delkor 160 6 1.4 – – – Mounds View Public Schools 143 7 1.3 – – – PACE Industries 130 8 1.2 – – – International Paper 120 9 1.1 – – – Country and MSI Insurance – – – 640 3 4.9 Fair Isaac & Co.– – – 500 4 3.8 Smiths Medical M.D., Inc.– – – 500 4 3.8 Total 6,330 56.1 % 4,940 38.0 % Total city employees 11,275 12,990 (1) (2)Information only readily available for the top six employers. Source: Information only readily available for the top nine employers. City staff research; Metropolitan Council. 2018 (1) CITY OF ARDEN HILLS Principal Employers Current Year and Nine Years Ago Employees of Total City 2009 (2) Percentage of Total City Percentage Employer Employees -92- 2009 2010 2011 2012 Function Towed vehicles – 2 3 7 117 138 96 140 Driving impaired/alcohol 21 9 13 15 Traffic stops 281 332 328 17 Traffic investigations 19 11 24 33 Total calls for service N/A N/A N/A N/A Fire 214 452 559 522 1.43 1.80 1.93 5.20 250 325 250 250 Sanitation (residential) Refuse collected (tons/day)8.05 7.95 7.85 7.90 Recyclables collected (tons/day)2.05 2.34 2.01 2.20 Recycling clean up days N/A N/A N/A N/A Tons collected during clean up days N/A N/A N/A N/A Parks and recreation Athletic field permits issued 25 25 20 19 Water New connections 3 3 2 31 Water main breaks 5 7 2 12 Average daily consumption (thousands of gallons)1,323 1,162 1,135 1,269 Note 1:Indicators are not available for the general city functions. Note 2: Note 3: Note 4: Source:Various city departments Fire information provided by Lake Johanna Fire Department, which is contracted out by the City. Street resurfacing (miles) Number of calls answered Potholes repaired Highways and streets Information provided by the Ramsey County Sheriff’s Department. Starting in 2015,the Sheriff changed reporting standards, and information is no longer easily broken down. Total number of calls is now provided. Recyclables – numbers based off of yearly tonnage total divided into 365 days in the year. Starting in 2018, the refuse collected information is no longer being provided as it is not readily available. Instead, information on recycling clean up days is being provided. Last Ten Fiscal Years Operating Indicators by Function CITY OF ARDEN HILLS Traffic accidents Police (see Note 2) Fiscal Year -93- 2013 2014 2015 2016 2017 2018 2 1 N/A N/A N/A N/A 149 144 N/A N/A N/A N/A 23 18 N/A N/A N/A N/A 78 20 N/A N/A N/A N/A 78 40 N/A N/A N/A N/A N/A N/A 4,892 4,413 5,152 5,331 561 651 804 930 986 1,039 4.40 – 2.84 0.25 0.20 1.00 250 250 600 600 700 800 8.05 8.65 8.76 8.75 8.80 N/A 2.20 2.21 2.16 2.06 2.22 2.17 N/A N/A N/A N/A N/A 2 N/A N/A N/A N/A N/A 73.7 30 22 22 22 30 25 10 2 7 8 8 6 6 2 10 6 7 8 1,162 983 857 812 853 869 -94- 2009 2010 2011 2012 Function General government 6.57 7.18 6.89 7.47 Public safety General public safety 2.72 2.72 2.74 2.70 Highways and streets General highways and streets 2.39 2.44 2.20 2.72 Community development 0.02 – – – Parks and recreation 8.32 6.95 8.88 6.51 Water 3.40 3.29 3.50 3.67 Sewer 4.01 3.91 4.05 4.42 Recycling 0.14 0.17 0.21 0.21 Surface water management 1.57 2.25 2.54 2.66 Total 29.14 28.90 31.01 30.36 Note: Source: Finance and Administration Seasonal staff are calculated by total hours worked (2,080 hours per year), added together to total an equivalent. Seasonal hours fluctuate throughout the year. CITY OF ARDEN HILLS Full-Time Equivalent City Government Employees by Function Last Ten Fiscal Years Fiscal Year -95- 2013 2014 2015 2016 2017 2018 7.50 6.73 6.76 5.00 4.08 4.64 2.66 2.61 2.74 2.42 2.34 2.39 2.04 3.11 2.93 2.42 2.41 2.51 – – – – – – 6.92 7.77 7.31 6.78 6.52 6.74 4.42 4.18 4.07 3.56 3.62 3.51 4.92 5.06 4.85 4.31 4.30 4.15 0.21 0.20 0.19 0.17 0.21 0.23 2.56 3.01 2.95 2.64 2.70 2.60 31.22 32.67 31.80 27.30 26.18 26.77 -96- 2009 2010 2011 2012 Function Highways and streets Streets (miles)57 57 57 57 Streetlights 250 250 250 250 Traffic signals 18 18 18 18 Parks and recreation* Parks acreage 111 111 111 111 Parks 14 14 14 14 Trails acreage 53 54 54 54 Trails (miles)13 15 15 15 Tennis courts 4 4 4 4 Softball/baseball fields 6 6 6 6 Basketball courts 10 10 10 10 Hockey/skating rinks 5 5 5 5 Permanent restrooms 2 3 3 3 Water Water mains (miles)43 43 43 43 Fire hydrants 520 520 520 520 Maximum daily capacity (thousands of gallons)1,500 1,500 1,500 1,500 Sewer Sanitary sewers (miles)44 44 44 44 Storm sewers (miles)20 20 20 20 * Note: Source: CITY OF ARDEN HILLS Capital Asset Statistics by Function Last Ten Fiscal Years Various city departments No capital asset indicators are available for the general city functions. Fiscal Year Information used for the parks and recreation section was taken from the Arden Hills Parks and Trails Guide from the Parks and Recreation Department. -97- 2013 2014 2015 2016 2017 2018 57 57 57 57 57 57 250 250 250 250 252 252 18 18 18 18 18 18 111 111 111 111 111 111 14 14 14 14 14 14 54 54 54 54 54 54 15 21 21 21 21 22 5 6 6 5 5 5 8 8 8 8 7 7 10 10 10 10 10 10 6 6 6 6 6 6 2 3 3 3 3 3 43 43 43 43 43 44 537 537 537 537 537 537 1,500 1,500 1,500 1,500 1,500 1,500 49 52 52 52 52 52 20 25 25 25 25 25 -98- THIS PAGE INTENTIONALLY LEFT BLANK CITY OF ARDEN HILLS RAMSEY COUNTY, MINNESOTA Special Purpose Audit Reports Year Ended December 31, 2018 THIS PAGE INTENTIONALLY LEFT BLANK Page Independent Auditor’s Report on Internal Control Over Financial Reporting and on Compliance and Other Matters Based on an Audit of Financial Statements Performed in Accordance With Government Auditing Standards 1–2 Independent Auditor’s Report on Minnesota Legal Compliance 3 Schedule of Findings and Responses 4 Table of Contents CITY OF ARDEN HILLS Year Ended December 31, 2018 RAMSEY COUNTY, MINNESOTA Special Purpose Audit Reports THIS PAGE INTENTIONALLY LEFT BLANK C E R T I F I E D A C C O U N T A N T S P UBLIC PRINCIPALS Thomas A. Karnowski, CPA Paul A. Radosevich, CPA William J. Lauer, CPA James H. Eichten, CPA Aaron J. Nielsen, CPA Victoria L. Holinka, CPA/CMA Jaclyn M. Huegel, CPA Malloy, Montague, Karnowski, Radosevich & Co., P.A. 5353 Wayzata Boulevard • Suite 410 • Minneapolis, MN 55416 • Phone: 952-545-0424 • Fax: 952-545-0569 • www.mmkr.com -1- INDEPENDENT AUDITOR’S REPORT ON INTERNAL CONTROL OVER FINANCIAL REPORTING AND ON COMPLIANCE AND OTHER MATTERS BASED ON AN AUDIT OF FINANCIAL STATEMENTS PERFORMED IN ACCORDANCE WITH GOVERNMENT AUDITING STANDARDS To the City Council and Management City of Arden Hills, Minnesota We have audited, in accordance with auditing standards generally accepted in the United States of America and the standards applicable to financial audits contained in Government Auditing Standards, issued by the Comptroller General of the United States, the financial statements of the governmental activities, the business-type activities, each major fund, and the aggregate remaining fund information of the City of Arden Hills, Minnesota (the City) as of and for the year ended December 31, 2018, and the related notes to the financial statements, which collectively comprise the City’s basic financial statements, and have issued our report thereon dated May 2, 2019. INTERNAL CONTROL OVER FINANCIAL REPORTING In planning and performing our audit of the financial statements, we considered the City’s internal control over financial reporting (internal control) to determine the audit procedures that are appropriate in the circumstances for the purpose of expressing our opinions on the financial statements, but not for the purpose of expressing an opinion on the effectiveness of the City’s internal control. Accordingly, we do not express an opinion on the effectiveness of the City’s internal control. A deficiency in internal control exists when the design or operation of a control does not allow management or employees, in the normal course of performing their assigned functions, to prevent, or detect and correct, misstatements on a timely basis. A material weakness is a deficiency, or a combination of deficiencies, in internal control such that there is a reasonable possibility that a material misstatement of the City’s financial statements will not be prevented, or detected and corrected, on a timely basis. A significant deficiency is a deficiency, or a combination of deficiencies, in internal control that is less severe than a material weakness, yet important enough to merit attention by those charged with governance. Our consideration of internal control was for the limited purpose described in the first paragraph of this section and was not designed to identify all deficiencies in internal control that might be material weaknesses or significant deficiencies and, therefore, material weaknesses or significant deficiencies may exist that have not been identified. We did identify one deficiency in internal control, described in the accompanying Schedule of Findings and Responses as item 2018-001, which we consider to be a material weakness. (continued) -2- COMPLIANCE AND OTHER MATTERS As part of obtaining reasonable assurance about whether the City’s financial statements are free from material misstatement, we performed tests of its compliance with certain provisions of laws, regulations, contracts, and grant agreements, noncompliance with which could have a direct and material effect on the determination of financial statement amounts. However, providing an opinion on compliance with those provisions was not an objective of our audit and, accordingly, we do not express such an opinion. The results of our tests disclosed no instances of noncompliance or other matters that are required to be reported under Government Auditing Standards. CITY’S RESPONSE TO FINDING The City’s response to the finding identified in our audit is described in the accompanying Schedule of Findings and Responses. The City’s response was not subjected to the auditing procedures applied in the audit of the financial statements and, accordingly, we express no opinion on it. PURPOSE OF THIS REPORT The purpose of this report is solely to describe the scope of our testing of internal control and compliance and the results of that testing, and not to provide an opinion on the effectiveness of the City’s internal control or on compliance. This report is an integral part of an audit performed in accordance with Government Auditing Standards in considering the City’s internal control and compliance. Accordingly, this report is not suitable for any other purpose. Minneapolis, Minnesota May 2, 2019 C E R T I F I E D A C C O U N T A N T S P UBLIC PRINCIPALS Thomas A. Karnowski, CPA Paul A. Radosevich, CPA William J. Lauer, CPA James H. Eichten, CPA Aaron J. Nielsen, CPA Victoria L. Holinka, CPA/CMA Jaclyn M. Huegel, CPA Malloy, Montague, Karnowski, Radosevich & Co., P.A. 5353 Wayzata Boulevard • Suite 410 • Minneapolis, MN 55416 • Phone: 952-545-0424 • Fax: 952-545-0569 • www.mmkr.com -3- INDEPENDENT AUDITOR’S REPORT ON MINNESOTA LEGAL COMPLIANCE To the City Council and Management City of Arden Hills, Minnesota We have audited, in accordance with auditing standards generally accepted in the United States of America, and the standards applicable to financial audits contained in Government Auditing Standards, issued by the Comptroller General of the United States, the financial statements of the governmental activities, the business-type activities, each major fund, and the aggregate remaining fund information of the City of Arden Hills, Minnesota (the City) as of and for the year ended December 31, 2018, and the related notes to the financial statements, which collectively comprise the City’s basic financial statements, and have issued our report thereon dated May 2, 2019. MINNESOTA LEGAL COMPLIANCE The Minnesota Legal Compliance Audit Guide for Cities, promulgated by the State Auditor pursuant to Minnesota Statutes § 6.65, contains seven categories of compliance to be tested: contracting and bidding, deposits and investments, conflicts of interest, public indebtedness, claims and disbursements, miscellaneous provisions, and tax increment financing. Our audit considered all of the listed categories. In connection with our audit, nothing came to our attention that caused us to believe that the City failed to comply with the provisions of the Minnesota Legal Compliance Audit Guide for Cities. However, our audit was not directed primarily toward obtaining knowledge of such noncompliance. Accordingly, had we performed additional procedures, other matters may have come to our attention regarding the City’s noncompliance with the above referenced provisions. PURPOSE OF THIS REPORT The purpose of this report is solely to describe the scope of our testing of compliance and the results of that testing, and not to provide an opinion on compliance. Accordingly, this report is not suitable for any other purpose. Minneapolis, Minnesota May 2, 2019 THIS PAGE INTENTIONALLY LEFT BLANK CITY OF ARDEN HILLS Schedule of Findings and Responses Year Ended December 31, 2018 -4- FINDINGS – MATERIAL WEAKNESS IN INTERNAL CONTROL OVER FINANCIAL REPORTING 2018-001 SEGREGATION OF DUTIES Criteria – Internal control over financial reporting. Condition – The City of Arden Hills, Minnesota (the City) has limited segregation of duties in a number of areas. Context – This is a current year and prior year finding. Cause – The limited segregation of duties is primarily caused by the limited size of the City’s finance department staff. Effect – One important element of internal accounting controls is an adequate segregation of duties such that no one individual should have responsibility to execute a transaction, have physical access to the related assets, and have responsibility or authority to record the transaction. A lack of segregation of duties subjects the City to a higher risk that errors or fraud could occur and not be detected in a timely manner in the normal course of business. Recommendation – This condition is common to organizations of your size. We recommend that the City segregate duties as best it can within the limits of the staff available. Any modifications in internal control in this area should be viewed from a cost-benefit perspective. Management Response – There is no disagreement with the audit finding. The City reviews and makes improvements to its internal control structure on an ongoing basis and attempts to maximize the segregation of duties in all areas within the limits of the staff available. However, the City does not consider it cost-beneficial at this time to increase the size of its staff in order to further segregate accounting functions. THIS PAGE INTENTIONALLY LEFT BLANK Page 1 of 1 STAFF COMMENTS – 5A MEMORANDUM DATE: May 13, 2019 TO: Honorable Mayor and City Councilmembers FROM: Dave Perrault, City Administrator SUBJECT: Rice Creek Commons (TCAAP) and Joint Development Authority (JDA) Update Budgeted Amount: Actual Amount: Funding Source: $ $ $ A verbal update will be provided at the City Council meeting. Page 1 of 1 STAFF COMMENTS – 5B MEMORANDUM DATE: May 13, 2019 TO: Honorable Mayor and City Councilmembers Dave Perrault, City Administrator FROM: Sue Polka, Public Works Director/City Engineer SUBJECT: Transportation Update Budgeted Amount: Actual Amount: Funding Source: $ $ $ A verbal update will be provided at the City Council meeting. Background The Spring Clean Up Day event is scheduled for Saturday, May 18th from 7:00 a.m. to 12:00 p.m at the Ramsey County Public Works Facility at 1425 Paul Kirkwold Drive. The event is co- sponsored by Arden Hills and Shoreview and is open to residents of both cities. Residents that participate in the event will pay a fee based on vehicle type and load. Standard vehicles (cars, SUVs, minivans) will be charged $30 and small trailers will be charged $45. Oversized loads, such as rented U-Haul vehicles will be subject to extra charges. The minimum charge for an oversized vehicle will be $75. Proof of residency, such as a driver’s license or utility bill, is required. Payment will only be accepted in the form of cash or check. No credit cards will be accepted. Notice of the Clean Up Day event is advertised on the City’s website and Facebook page, and a flyer was included in the May issue of Arden Hills Notes. STAFF COMMENTS – 5C MEMORANDUM DATE: May 13, 2019 TO: Honorable Mayor and City Councilmembers Dave Perrault, City Administrator FROM: Mike Mrosla, City Planner SUBECT: Community Clean Up Day Update Budgeted Amount: Actual Amount: Funding Source: N/A N/A N/A Approved: May 13, 2019 CITY OF ARDEN HILLS, MINNESOTA CITY COUNCIL WORK SESSION APRIL 15, 2019 5:00 P.M. - ARDEN HILLS CITY COUNCIL CHAMBERS CALL TO ORDER/ROLL CALL Pursuant to due call and notice thereof, Mayor David Grant called to order the City Council Work Session at 5:02 p.m. Present: Mayor David Grant, Councilmembers Brenda Holden, Dave McClung and Steve Scott Absent: Councilmember Fran Holmes (excused) Also present: City Administrator Dave Perrault, Deputy Clerk Jolene Trauba, Ramsey County Sheriff Commander Tony Waldo, Undersheriff Jeff Ramacher, CTV Executive Director Dana Healy and CTV Public and Government Coordinator Jared Wiedmeyer 1. AGENDA ITEMS A. Ramsey County Sheriff’s Office Update Commander Waldo gave a brief history of his background with the Sheriff’s Department. Undersheriff Ramacher discussed the dedicated traffic deputies and the possibility of bringing retired Deputy Kevin Otto back for six months. August 1st will start the new hands-free driving law, road construction will push more traffic to the city and State Fair parking were reasons given to consider another traffic deputy. After discussion, Councilmembers agreed they would like to see the Deputies more visible and spend more time in individual neighborhoods. B. CTV Update CTV Executive Director Healy and Public and Government Coordinator Wiedmeyer presented an overview of new opportunities and services available from CTV including installation of new equipment, production services, webcasting, neighborhood network videos, quarterly updates, new analytics capabilities and features of CTV’s new website. An audit will be done to see Arden Hills’ equipment needs and CTV will present those findings at a future work session. ARDEN HILLS CITY COUNCIL WORK SESSION – April 15, 2019 2 C. Part-time Customer Service Specialist City Administrator Perrault explained the request to change the current full time Customer Service Specialist position to a job share position. The position would be 1 FTE total, with each person working an average of 20 hours per week. Insurance benefits would not be offered, but PTO would be accrued. He mentioned the flexibility of having two staff trained for the position that can cover for each other. Councilmember Holden asked about management of the position. City Administrator Perrault responded that it would be handled like any supervisory relationship. He also mentioned that moving the position to a job share wouldn’t cost the City any more money in total, but potentially less by not paying insurance benefits. Councilmember McClung said it did not matter to him if the position was filled by one or two people. After further discussion, Council directed staff to bring the item forward to the next Council meeting. D. Council Request Tracker City Administrator Perrault and staff reviewed the Council Request Tracker with the City Council. It was requested to add a Timeline column, and Cummings Park Shelter Sheriff Patrol was added. 2. COUNCIL COMMENTS AND STAFF UPDATES Councilmember McClung stated that he had no issue with the old City Hall site being used for construction staging, but didn’t want to see equipment there over the winter. City Administrator Perrault noted that the second regular Council meeting in May might be cancelled. Public Works Director/City Engineer interviews will be scheduled for May 29. A list of questions will be sent to Council. ADJOURN M ayor Grant adjourned the City Council Work Session at 7:01 p.m. __________________________ __________________________ Jolene Trauba David Grant Deputy Clerk Mayor Approved: May 13, 2019 CITY OF ARDEN HILLS, MINNESOTA SPECIAL CITY COUNCIL MEETING APRIL 15, 2019 IMMEDIATELY FOLLOWING CITY COUNCIL WORK SESSION ARDEN HILLS CITY COUNCIL CHAMBERS CALL TO ORDER/ROLL CALL Pursuant to due call and notice thereof, Mayor David Grant called to order the Special City Council meeting at 7:02 p.m. Present: Mayor David Grant, Councilmembers Brenda Holden, Dave McClung and Steve Scott Absent: Councilmember Fran Holmes (excused) Also present: City Administrator Dave Perrault and Deputy Clerk Jolene Trauba 1. APPROVAL OF AGENDA Mayor Grant noted the agenda could not be changed and as such was approved. 2. CONSENT CALENDAR A. Motion to Approve Appointment of Public Works Maintenance Workers MOTION: Councilmember Holden moved and Councilmember McClung seconded a motion to approve the Consent Calendar and authorize execution of all necessary documents contained therein. The motion carried unanimously (4- 0). 3. PULLED CONSENT ITEMS None. 4. NEW BUSINESS None. ARDEN HILLS SPECIAL CITY COUNCIL – APRIL 15, 2019 2 5. UNFINISHED BUSINESS None. 6. COUNCIL COMMENTS Councilmember Holden requested the TCAAP timeline that was published in the newsletter be put on the CTV carousel. Councilmember Scott said he would like to look into an upgrade of our current AV equipment and would like to see surge protection placed in the building. ADJOURN MOTION: Mayor Grant moved and Councilmember McClung seconded a motion to adjourn. The motion carried unanimously (4-0). Mayor Grant adjourned the Special City Council Meeting at 7:04 p.m. __________________________ __________________________ Jolene Trauba David Grant Deputy Clerk Mayor Approved: May 13, 2019 CITY OF ARDEN HILLS, MINNESOTA REGULAR CITY COUNCIL MEETING APRIL 22, 2019 7:00 P.M. - ARDEN HILLS CITY COUNCIL CHAMBERS CALL TO ORDER/ROLL CALL Pursuant to due call and notice thereof, Mayor David Grant called to order the regular City Council meeting at 7:00 p.m. Present: Mayor David Grant, Councilmembers Brenda Holden (arrived at 7:30 p.m.), Dave McClung and Steve Scott Absent: Councilmembers Fran Holmes (excused) Also present: City Administrator Dave Perrault; Interim Public Works Director/City Engineer Sue Polka; Finance Director Gayle Bauman; City Planner Mike Mrosla; Assistant City Attorney James Monge; and City Clerk Julie Hanson PLEDGE OF ALLEGIANCE 1. APPROVAL OF AGENDA MOTION: Councilmember McClung moved and Councilmember Scott seconded a motion to approve the meeting agenda as presented. The motion carried unanimously (3-0). 2. PUBLIC INQUIRIES/INFORMATIONAL Gregg Larson, 3377 North Snelling Avenue, stated the proposed Council minutes from March 25 should have a minor correction changing ingenious to disingenuous within his comment. He then discussed affordable housing and the housing crisis in the metro area. He explained everyone was trying to address this concern, except the Arden Hills City Council. He commented there were three reasons people opposed increased housing density on TCAAP. The first concern was the fear of others that don’t look like them. The second concern was the fear of others that don’t earn as much as the rest. He encouraged the Council to not have these fears. He stated the final fear was having the wrong kind of homes or apartments in the community. He discussed a housing development that occurred at the St. Paul Ford plant. He noted TCAAP would be three times larger yet would have 2.5 times fewer housing units than the St. Paul site. He indicated TCAAP ARDEN HILLS CITY COUNCIL – A PRIL 22 , 2019 2 had more than enough space for affordable housing units. He questioned what scared the City of Arden Hills from more affordable housing. Greg Strandmark, 5101 570th Street in Pine City, provided the Council with a handout. He stated he was present to discuss the TCAAP site. He explained he feared Native American (Dakota) burials had occurred on the TCAAP property. He recommended an archeologist be brought in to survey the site. Chuck Kachel, 1520 Arden Place, stated he was also known as Ten Bears. He reported his friend Josie Wales tried to talk some sense into the City Council regarding the Tobacco 21 issue. He indicated 12 years ago the Council approved a smoke-free policy in its parks but with no Ordinance in place this issue could not be enforced. He commented on the Tobacco 21 Ordinance that was recently approved by the City of Arden Hills. He feared that the City had passed a “boiler plate” Ordinance and discussed further how this Ordinance would impact local business owners. He was of the opinion the Ordinance would not stop minors from using tobacco. He suggested that the City consider limiting the purchase of sugary sodas for youth in the community as this could reduce obesity and childhood diabetes. He recommended the City make its own mind up on issues and not follow what other communities are doing. He reported cigarette use among adults was down from 17% to 11%. He discussed how e-cigarette use was assisting adults to stop smoking conventional cigarettes. He believed that the only thing the Tobacco 21 Ordinance would do, would be to inconvenience Arden Hills’ residents trying to legally purchase flavored tobacco. 3. RESPONSE TO PUBLIC INQUIRIES A. Public Inquiry Responses from March 25, 2019 City Council Meeting City Administrator Perrault provided the Council with a response to the inquiries addressed at the March 25 City Council meeting regarding the Lindey’s Park backstop and fence as well as TCAAP questions. 4. PRESENTATION A. 35W MnPASS Project Update Mark Lindeberg, MnDOT, provided the Council with a presentation on the 35W MnPASS project. He explained this project would take three years to complete and would impact 35W from Highway 36 to Sunset Boulevard in Blaine. In addition, he noted five bridges would be replaced. He commented on the staging overview for the portion of the project that would be completed in 2019. He stated a great deal of work would be completed in the overnight hours. The traffic impacts that would occur in the coming year were reviewed with the Council. He reviewed the location of the noise walls in Arden Hills and noted these walls would be painted upon completion of the project. He encouraged the public to visit MnDOT’s website to stay informed on this project. Mayor Grant asked if the closure of southbound Snelling Avenue to southbound Hamline Avenue was permanent or temporary. ARDEN HILLS CITY COUNCIL – A PRIL 22 , 2019 3 Mr. Lindeberg explained this would be a temporary closure for this construction season. He stated MnDOT does have safety concerns with this roadway. Councilmember McClung discussed the high levels of traffic along Highway 96 and encouraged MnDOT to be monitoring this. Councilmember Holden encouraged MnDOT to also monitor the traffic along Hamline Avenue. B. Proclamation Recognizing May 19-25, 2019 as National Public Works Week Mayor Grant read a proclamation in full for the record declaring May 19-25, 2019 as National Public Works Week in the City of Arden Hills. C. Proclamation Recognizing May 12-18, 2019 as National Police Week Mayor Grant read a proclamation in full for the record declaring May 12-18, 2019 as National Police Week in the City of Arden Hills. 5. STAFF COMMENTS A. Rice Creek Commons (TCAAP) and Joint Development Authority (JDA) Update City Administrator Perrault provided an update on TCAAP stating at the Ramsey County Board meeting on April 2 the County Commissioners authorized the County Manager to pursue all legal options to move the project forward. The County has requested the City voluntarily terminate the JPA. He stated the City’s position remains the same and believes it is best to continue to work under the confines of the JPA which was mutually agreed upon by the City and the County back in 2012. He noted the next scheduled JDA meeting was Monday, May 6. Councilmember Scott asked if the TCAAP development would be a 100% energy net neutral site. City Administrator Perrault commented it was his understanding the County was pursuing different options with Xcel Energy for sustainable and environmentally friendly energy options. Mayor Grant indicated the County has broken off all communication with the City regarding this development. Councilmember Holden reported the developer stated he was investigating geothermal options about nine months ago. She stated she received an email stating the County was telling people in its employment that the Arden Hills City Council never executed the JPA and therefore the County can walk away from this development. She clarified for the record; the City has an executed copy of the JPA available on the City’s website. B. Transportation Update ARDEN HILLS CITY COUNCIL – A PRIL 22 , 2019 4 Interim Public Works Director/City Engineer Polka thanked Mark Lindeberg for this update on the 35W MnPASS project. She noted she was working with WSB and would be sending a newsletter update to those living in the 2018 PMP project area. 6. APPROVAL OF MINUTES A. March 18, 2019, City Council Work Session B. March 18, 2019, Special Regular City Council C. March 25, 2019, Regular City Council Mayor Grant requested staff change the March 25 City Council minutes as was requested by Mr. Larson. MOTION: Councilmember Holden moved and Councilmember McClung seconded a motion to approve the March 18, 2019, City Council Work Session meeting minutes, March 18, 2019, Special Regular City Council meeting minutes; and March 25, 2019, Regular City Council meeting minutes as amended. The motion carried unanimously (4-0). 7. CONSENT CALENDAR A. Motion to Approve Consent Agenda Item - Claims and Payroll B. Motion to Approve First Quarter Financials C. Motion to Approve 2020 Budget Calendar D. Motion to Approve Springbrook Software Upgrade and Purchase of Licenses E. Motion to Authorize Posting for Part-Time Customer Service Specialist F. Motion to Authorize City Staff to Begin Summer Work Hours Beginning Tuesday, May 28, 2019 and Concluding on Friday, August 30, 2019 G. Motion to Approve Resolution 2019-017 Approving a Premise Permit Application for Minnesota Fastpitch Academy Foundation for Charitable Gambling at Welsch’s Big Ten Tavern H. Motion to Approve Planning Case 19-003 – 3900 Bethel Drive – Site Plan Review I. Motion to Accept Resignation of Matt Dixon from Planning Commission J. Motion to Approve Resolution 2019-012 Appointing Dan Dietz to the Parks, Trails and Recreation Committee (PTRC) K. Motion to Approve Resolut9ion 2019-013 Appointing Timothy Nelson to the Parks, Trail and Recreation Committee (PTRC) L. Motion to Approve Resolution 2019-014 Accepting a Donation from the Action Hills Foundation M. Motion to Approve Professional Services Agreement for Utility Monitoring and Control-Design Phase – HR Green N. Motion to Approve Purchase of Televising Camera Trailer O. Motion to Approve Professional Services Agreement for Construction Services – Highway 10 Watermain Replacement – TKDA P. Motion to Approve Resolution 2019-015 Approving County State Aid Highway (CSAH) 17 Designation with Ramsey County ARDEN HILLS CITY COUNCIL – A PRIL 22 , 2019 5 Q. Motion to Authorize Amendment to Professional Services Agreement for Construction Phase Services – Old Snelling Bridge Improvements – Kimley Horn MOTION: Councilmember Holden moved and Councilmember McClung seconded a motion to approve the Consent Calendar as presented and to authorize execution of all necessary documents contained therein. The motion carried unanimously (4-0). 8. PULLED CONSENT ITEMS None. 9. PUBLIC HEARINGS None. 10. NEW BUSINESS None. 11. UNFINISHED BUSINESS None. 12. COUNCIL COMMENTS Councilmember Scott stated he met with Jason Isaacson and received an update from the legislature. Councilmember Scott reported he attended the City-sponsored Easter egg hunt. He thanked Roberts Management for their sponsorship of this event. Councilmember Scott stated on Wednesday, April 24 the USAF Jazz Band Ensemble would be providing a free concert at the Benson Great Hall at Bethel University. Councilmember Scott explained he would be attending a kid’s gala sponsored by the Lions on Friday, April 26 at the Shoreview Community Center. Councilmember Scott reported the Scoops for Troops Ice Cream Social would be held on Sunday, April 28 beginning at 10:00 a.m. at the Army Readiness Center. Councilmember Scott stated on Monday he would be attending a course called Expert Insights on Inclusionary Zoning at the Federal Reserve Bank. Councilmember Scott indicated he would be attending the NYFS Leadership Luncheon on Wednesday, May 1 at Midland Hills Country Club in Roseville. ARDEN HILLS CITY COUNCIL – A PRIL 22 , 2019 6 Councilmember Scott reported on Friday, May 3 he would be attending a webinar for budgeting for municipal officials. Councilmember McClung explained he read the majority leader of the United States Senate, Mitch McConnell is going to be introducing a bill to raise the tobacco age to 21 nationally. Councilmember Holden stated the playground equipment had been torn out of Cummings Park and the new equipment should be installed mid-May. Councilmember Holden commented the Council met with the Sheriff’s Department at a recent worksession meeting. She encouraged residents to contact the Council with any questions they may have for the Sheriff’s Department. Councilmember Holden reported Boston Scientific is going to have another 400 to 500 employees moving to their campus in Arden Hills. Councilmember Holden stated the City of Arden Hills had not heard from Blake Huffman for 146 days noting the City received a comment from Commissioner Huffman on February 4. She reported it had been an additional 77 days that the City had not heard from Commissioner Huffman. Mayor Grant commented Boston Scientific was shutting down its Minnetonka facility and would be moving those employees to Arden Hills. He discussed the renovations Boston Scientific was proposing to make to their corporate campus. Mayor Grant stated he presented to the North Chamber recently and updated this organization on the Red Bulls and Boston Scientific. He was pleased to report the economy was in a positive place right now. Mayor Grant commented on the percentage of affordable housing in Arden Hills at this time, noting this was 46.5%. He stated this was a leading percent in the metro area. ADJOURN MOTION: Councilmember McClung moved and Councilmember Holden seconded a motion to adjourn. The motion carried unanimously (4-0). Mayor Grant adjourned the Regular City Council Meeting at 8:02 p.m. __________________________ __________________________ Julie Hanson David Grant City Clerk Mayor Page 1 of 1   CONSENT ITEM 7A MEMORANDUM DATE: May 13, 2019 TO: Honorable Mayor and City Councilmembers Dave Perrault, City Administrator FROM: Gayle Bauman, Finance Director Pang Silseth, Accounting Analyst SUBJECT: Claims & Payroll Budgeted Amount: Actual Amount: Funding Source: NA NA NA Council Should Consider the Following Options: A. Approve Claims and Payroll Or B. Reject Claims and Payroll Supporting Documents: Payroll 2019 Payroll #9 ……………………………………………………………. $102,381.76   Total Payroll $102,381.76   Accounts Payable Claims Through 05/10/2019 Paid Claims---04/19/2019 through 05/10/2019 (Check Nos. 48365-48431and ACH Checks) ……………………………... $645,997.06   Total Accounts Payable $645,997.06   Total Claims $748,378.82 CITY OF ARDEN HILLS PAYROLL # 9 CHECKS DATED:05/03/19 Biweekly:04/13/19 - 04/26/19 EMPLOYEE DEDUCTIONS AMT.Payment Method FIT 6,866.47 EFT SIT 3,065.32 EFT FICA Oasdi 4,222.57 EFT FICA Medicare 987.51 EFT TOTAL TAXES 15,141.87 Health Premium 1,655.66 A/P Check* Dental Premium 168.81 A/P Check* FSA Health Care Reimb.0.00 A/P Check* FSA Dependent Care Reimb.208.33 A/P Check* TOTAL FLEXIBLE SPENDING 2,032.80 HSA Health Saving 293.33 Health Care Savings Plan-Retirement 0.00 EFT Health Care Savings Plan-2%350.42 EFT Health Care Savings Plan-4%413.74 EFT TOTAL HEALTH SAVINGS 1,057.49 PERA 3,875.34 EFT ICMA 2,111.46 EFT Central Pension Fund-Union 566.40 A/P Check* MN State Retirement System 0.00 EFT TOTAL RETIREMENT 6,553.20 IUOE 49 Dues (Union)140.00 A/P Check* LTD/STD Insurance 1,153.35 A/P Check* PERA Life Insurance 32.00 A/P Check* Life/Addl/Dep Life 76.55 A/P Check* Life/Addl 25.20 UNUM 19.51 A/P Check* AFLAC 53.18 EFT TOTAL VOLUNTARY 1,499.79 Total Employee Deductions 26,285.15 Net Payroll 0.00 Direct Deposit 44,880.41 EFT Gross Payroll Tie-Out 71,165.56 Plus City Paid Benefit 31,216.20 TOTAL PAYROLL COST 102,381.76 FICA TIE-OUT Gross Payroll 71,165.56 Less Total FSA 2,032.80 Less Total HAS 1,057.49 Less Voluntary Ins 78.38 Plus ICMA Employer 378.42 Net P/R Subject to FICA 68,375.31 FICA Oasdi @ 6.20%4,222.57 FICA Medicare @ 1.45%987.51 Note: Federal and State Payroll Tax obligations are satisfied by means of utilizing the US Bank Easy Tax Deposit Service. Transfers are typically made up to two days after the payroll date. * A/P Checks can be found on the ACCOUNTS PAYABLE Check Approval report. Checks may be paid this week or the following week. 103.20 103.20 1,578.13 4,471.55 378.42 4,849.97 19,474.82 1,578.13 5,210.08 18,856.28 618.54 CITY BENEFIT 4,222.57 987.51 Accounts Payable User: Printed: pang.silseth 5/8/2019 1:49 PM Checks by Date - Detail by Check Date Check No Check DateVendor NameVendor No Check Amount Invoice No ReferenceDescription 0243 Metropolitan Council-Waste Water 04/19/2019ACH 0001094769 May 2019 Wastewater May 2019 Wastewater 63,477.00 63,477.00Total for this ACH Check for Vendor 0243: 0292 Oxygen Service Company, Inc.04/19/2019ACH 03431806 March 2016 Rental March 2016 Rental 24.18 24.18Total for this ACH Check for Vendor 0292: 0320 Health Partners Inc.04/19/2019ACH 89048560 Dental May 2019 Dental May 2019 -36.84 89048560 Dental May 2019 Dental May 2019 904.47 867.63Total for this ACH Check for Vendor 0320: 0382 ICMA Retirement Trust - 106944 04/19/2019ACH PR Batch 00200.04.2019 ICMA Employee Percent 401PR Batch 00200.04.2019 ICMA 327.96 PR Batch 00200.04.2019 ICMA Employer Percent 401PR Batch 00200.04.2019 ICMA 378.42 706.38Total for this ACH Check for Vendor 0382: 0387 ICMA Retirement Trust- #302482 04/19/2019ACH PR Batch 00200.04.2019 ICMA Employee PercentPR Batch 00200.04.2019 ICMA 311.56 PR Batch 00200.04.2019 ICMA Employee DeductionPR Batch 00200.04.2019 ICMA 1,561.54 1,873.10Total for this ACH Check for Vendor 0387: 0922 North Suburban Access Corporation 04/19/2019ACH 2019-042 March 2019 Service March 2019 Service 552.80 552.80Total for this ACH Check for Vendor 0922: 1785 EcoEnvelopes LLC 04/19/2019ACH 1756 April 2019 UB Processing April 2019 UB Processing 290.46 1756 April 2019 UB Processing April 2019 UB Processing 290.47 1756 April 2019 UB Processing April 2019 UB Processing 290.46 871.39Total for this ACH Check for Vendor 1785: 8029 MMKR & Corp, PA 04/19/2019ACH 45755 2018 Audit Services 573.00 45755 2018 Audit Services 459.00 45755 2018 Audit Services 401.00 45755 2018 Audit Services 2,560.00 45755 2018 Audit Services 459.00 45755 2018 Audit Services 2,484.00 45755 2018 Audit Services 2,560.00 45755 2018 Audit Services 2,560.00 45755 2018 Audit Services 2,560.00 45755 2018 Audit Services 2,559.00 Page 1AP Checks by Date - Detail by Check Date (5/8/2019 1:49 PM) Check No Check DateVendor NameVendor No Check Amount Invoice No ReferenceDescription 17,175.00Total for this ACH Check for Vendor 8029: 8371 Alliant Engineering, Inc 04/19/201948365 PC17-012 PC 17-012 Escrow Release PC 17-012 Escrow Release 433.97 433.97Total for Check Number 48365: 5593 American Legal Publishing Corp. 04/19/201948366 0127689 Internet Renewal to May 2020 Internet Renewal to May 2020 495.00 495.00Total for Check Number 48366: 0131 Beisswenger's How-To Store 04/19/201948367 149057 Garage Supplies Garage Supplies 21.40 149108 Garage Supplies Garage Supplies 21.99 43.39Total for Check Number 48367: 0719 City of St. Paul 04/19/201948368 IN34227 Asphalt Mix Asphalt Mix 1,397.70 1,397.70Total for Check Number 48368: 10270 Collins Electrical Construction Corp 04/19/201948369 5833 Hazelnut Electrical Connection Hazelnut Electrical Connection 913.38 913.38Total for Check Number 48369: 1033 Comcast 04/19/201948370 44271.0419 Service 4/21-5/20 Service 4/21-5/20 6.29 6.29Total for Check Number 48370: 1081 Copperhead Innovations LLC 04/19/201948371 11674 EZ T-Probe EZ T-Probe 627.36 627.36Total for Check Number 48371: DEED Dept of Employment & Econ Dev 04/19/201948372 12641389 Q1 2019 Expense Q1 2019 Expense 647.23 12641389 Q1 2019 Expense Q1 2019 Expense 43.15 12641389 Q1 2019 Expense Q1 2019 Expense 647.23 12641389 Q1 2019 Expense Q1 2019 Expense 862.97 12641389 Q1 2019 Expense Q1 2019 Expense 388.34 12641389 Q1 2019 Expense Q1 2019 Expense 862.97 3,451.89Total for Check Number 48372: 0841 Ehlers & Associates, Inc.04/19/201948373 79795 TCAAP March 2019 TCAAP March 2019 245.00 245.00Total for Check Number 48373: 10218 HR Green Inc.04/19/201948374 125728 Service Through Mar 29, 2019 Service Through Mar 29, 2019 1,924.50 125729 Utility Monitoring & Control through Mar 29, 2019Service Through Mar 29, 2019 590.62 125729 Utility Monitoring & Control through Mar 29, 2019Service Through Mar 29, 2019 590.63 3,105.75Total for Check Number 48374: 0447 I.U.O.E Local 49 Benefit Fund-Insurance 04/19/201948375 4172019 April 2019 Insurance April & May 2019 Premiums 1,240.00 Page 2AP Checks by Date - Detail by Check Date (5/8/2019 1:49 PM) Check No Check DateVendor NameVendor No Check Amount Invoice No ReferenceDescription 4172019 May 2019 Insurance April & May 2019 Premiums 1,240.00 2,480.00Total for Check Number 48375: 0811 Ramsey County 04/19/201948376 FLEET-000467 March 2019 Fuel Purchase March 2019 Fuel Purchase 2,419.68 PUBW-017767 Q1 2019 Brine Solution March 2019 Fuel Purchase 382.74 PUBW-017774 Q1 2019 Road Salt Q1 2019 Road Salt 27,061.95 29,864.37Total for Check Number 48376: 6748 Reliance Standard 04/19/201948377 GL154938.0419 May 2019 Premium May 2019 Premium 1,475.03 1,475.03Total for Check Number 48377: 10238 Roadkill Animal Control 04/19/201948378 04152019 Jan 2019 Service Jan 2019 Service 119.00 119.00Total for Check Number 48378: 10301 Nate Short 04/19/201948379 04112019 Mailbox Repair Mailbox Repair 85.00 85.00Total for Check Number 48379: 3099 Tri-State Bobcat, Inc.-Little Canada 04/19/201948380 S24871 24" Planer-Milling Attachment 24" Planer-Milling Attachment 15,469.30 15,469.30Total for Check Number 48380: 145,759.91Total for 4/19/2019: 0192 Grainger, Inc 04/26/2019ACH 9147691282 Garage Supplies Garage Supplies 95.92 9148558209 Park Supplies Garage Supplies 386.10 482.02Total for this ACH Check for Vendor 0192: 0319 City of Roseville 04/26/2019ACH 0225947 Adobe Acrobat Subscription-JF Adobe Acrobat Subscription 52.00 0225964 Adobe Acrobat Subscription-TH Adobe Acrobat Subscription 52.00 104.00Total for this ACH Check for Vendor 0319: 0576 TimeSaver Off Site Secretarial Inc. 04/26/2019ACH M24628 April 3rd Planning Commission Meeting April 3rd Planning Commission Meeting 155.75 155.75Total for this ACH Check for Vendor 0576: 0750 Verizon Wireless 04/26/2019ACH 9827925945 Service 4/11-5/10 Service 4/11-5/10 1,177.85 1,177.85Total for this ACH Check for Vendor 0750: 0772 ESS Brothers & Sons, Inc.04/26/2019ACH ZZ1472 Aqua Seal Tubes Aqua Seal Tubes 470.00 470.00Total for this ACH Check for Vendor 0772: 1125 Bolton & Menk, Inc.04/26/2019ACH Page 3AP Checks by Date - Detail by Check Date (5/8/2019 1:49 PM) Check No Check DateVendor NameVendor No Check Amount Invoice No ReferenceDescription 0222670 Aug 2018 Planning Services Aug 2018 Planning Services 7,405.20 0222670 Aug 2018 Planning Services Aug 2018 Planning Services 462.83 0222670 Aug 2018 Planning Services Aug 2018 Planning Services 462.82 0222670 Aug 2018 Planning Services Aug 2018 Planning Services 925.65 9,256.50Total for this ACH Check for Vendor 1125: 1223 Adam's Pest Control, Inc. 04/26/2019ACH 2773948 Pest Control April 2019 Pest Control April 2019 66.29 66.29Total for this ACH Check for Vendor 1223: CANON Canon Financial Services Inc. 04/26/2019ACH 19951692 Copier May 2019 Copier May 2019 214.42 19951692 Copier May 2019 Copier May 2019 1,215.08 1,429.50Total for this ACH Check for Vendor CANON: JOHC Johnson Controls Inc. 04/26/2019ACH 1-85794628565 Service Panic Alarm Service Panic Alarm 331.20 331.20Total for this ACH Check for Vendor JOHC: 0131 Beisswenger's How-To Store 04/26/201948382 150703 Garage Supplies Garage Supplies 52.76 52.76Total for Check Number 48382: 10300 Keri Bloyer 04/26/201948383 04182019 Refund: City Hall Room Rental Refund: City Hall Room Rental 45.00 45.00Total for Check Number 48383: 1193 Further Inc.04/26/201948384 1344917 Participant Fee April 2019 Participant Fee April 2019 55.65 55.65Total for Check Number 48384: 0477 Gathering Place Lutheran Ministries 04/26/201948385 1 Snowplowing 2018-2019 Snowplowing 2018-2019 1,500.00 1,500.00Total for Check Number 48385: 0447 I.U.O.E Local 49 Benefit Fund-Insurance 04/26/201948386 04242019 Insurance May 2019 Insurance April & May 2019 1,240.00 04242019 Insurance April 2019 Insurance April & May 2019 1,240.00 2,480.00Total for Check Number 48386: 8034 Municipals 04/26/201948387 04192019 2019 Spring Conference-S.Johnson 2019 Spring Conference-S.Johnson 70.00 70.00Total for Check Number 48387: 0155 Office of MN IT Services 04/26/201948388 W19030583 March 2019 Phone March 2019 Phone 777.24 777.24Total for Check Number 48388: 0811 Ramsey County 04/26/201948389 04042019 Q1 2019 Soil & Water Conservation Inspections Q1 2019 Soil & Water Conservation Inspections 1,524.98 04042019 Q1 2019 Soil & Water Conservation Inspections Q1 2019 Soil & Water Conservation Inspections 28.80 FLEET-000473 March 2019 Service & Parts March 2019 Service & Parts 3,960.00 Page 4AP Checks by Date - Detail by Check Date (5/8/2019 1:49 PM) Check No Check DateVendor NameVendor No Check Amount Invoice No ReferenceDescription FLEET-000473 March 2019 Service & Parts March 2019 Service & Parts 3,904.53 PRRRV-001099 Special Assessments Special Assessments 90.00 PRRRV-001099 Special Assessments Special Assessments 700.00 PRRRV-001099 Special Assessments Special Assessments 90.00 PRRRV-001099 Special Assessments Special Assessments 10.00 PRRRV-001099 Special Assessments Special Assessments 90.00 10,398.31Total for Check Number 48389: UB*00254 Roberts Development 04/26/201948390 Refund Check 10,623.51 10,623.51Total for Check Number 48390: 5576 Schindler Elevator Corp.04/26/201948391 7152913157 Elevator Service, Down Call Button Elevator Service, Down Call Button 195.48 195.48Total for Check Number 48391: 0327 Staples Business Advantage 04/26/201948392 3409909820 Office Supplies Office Supplies 61.99 3409909820 Office Supplies Office Supplies 14.09 76.08Total for Check Number 48392: 39,747.14Total for 4/26/2019: 0192 Grainger, Inc 05/03/2019ACH 9152981545 Truck Equipment Truck Equipment 521.73 9161796181 Truck Equipment Truck Equipment 457.80 979.53Total for this ACH Check for Vendor 0192: 0243 Metropolitan Council-Waste Water 05/03/2019ACH 0001095736 2019 Permit Fee 2019 Permit Fee 425.00 425.00Total for this ACH Check for Vendor 0243: 0319 City of Roseville 05/03/2019ACH 0225967 Q1 2019 Water Purchase IT Support April 2019 190,779.21 0225970 Phone Services April 2019 Phone Services April 2019 407.00 0226005 IT Support April 2019 IT Support April 2019 4,598.00 195,784.21Total for this ACH Check for Vendor 0319: 0382 ICMA Retirement Trust - 106944 05/03/2019ACH PR Batch 00100.05.2019 ICMA Employer Percent 401PR Batch 00100.05.2019 ICMA 378.42 PR Batch 00100.05.2019 ICMA Employee Percent 401PR Batch 00100.05.2019 ICMA 327.96 706.38Total for this ACH Check for Vendor 0382: 0387 ICMA Retirement Trust- #302482 05/03/2019ACH PR Batch 00100.05.2019 ICMA Employee DeductionPR Batch 00100.05.2019 ICMA 1,561.54 PR Batch 00100.05.2019 ICMA Employee PercentPR Batch 00100.05.2019 ICMA 221.96 1,783.50Total for this ACH Check for Vendor 0387: 0706 Certified Laboratories Inc.05/03/2019ACH 3522193 Park Supplies Park Supplies 1,659.75 3525162 temp/seasonals-safety/clothing temp/seasonals-safety/clothing 889.05 Page 5AP Checks by Date - Detail by Check Date (5/8/2019 1:49 PM) Check No Check DateVendor NameVendor No Check Amount Invoice No ReferenceDescription 2,548.80Total for this ACH Check for Vendor 0706: 1115 WSB & Associates, Inc.05/03/2019ACH 0-003455-200-25 2040 Comp Plan-March 2019 2040 Comp Plan-March 2019 487.50 R-010111-000-22 2018 Street&Utility-March 2019 2018 Street&Utility-March 2019 3,264.00 R-012452-000-8 Cummings Park Playground-March 2019 Cummings Park Playground-March 2019 495.00 R-013559-000-3 2019 GIS-March 2019 2019 GIS-March 2019 783.00 R-013782-000-1 Acting DPW/CE-March 2019 Acting DPW/CE-March 2019 112.50 R-013782-000-1 Acting DPW/CE-March 2019 Acting DPW/CE-March 2019 450.00 R-013782-000-1 Acting DPW/CE-March 2019 Acting DPW/CE-March 2019 187.50 R-013782-000-1 Acting DPW/CE-March 2019 Acting DPW/CE-March 2019 187.50 R-013782-000-1 Acting DPW/CE-March 2019 Acting DPW/CE-March 2019 750.00 R-013782-000-1 Acting DPW/CE-March 2019 Acting DPW/CE-March 2019 750.00 R-013782-000-1 Acting DPW/CE-March 2019 Acting DPW/CE-March 2019 375.00 R-013782-000-1 Acting DPW/CE-March 2019 Acting DPW/CE-March 2019 750.00 R-013782-000-1 Acting DPW/CE-March 2019 Acting DPW/CE-March 2019 187.50 R-013805-000-1 Cummings Park Volleyball-March 2019 Cummings Park Volleyball-March 2019 345.25 9,124.75Total for this ACH Check for Vendor 1115: 1252 Campbell Knutson - Attorneys at Law 05/03/2019ACH 3231G-0319 March Legal Services March Legal Services 261.50 3231G-0319 March Legal Services March Legal Services 1,576.10 3231G-0319 March Legal Services March Legal Services 248.00 3231G-0319 March Legal Services March Legal Services 2,375.80 4,461.40Total for this ACH Check for Vendor 1252: 2226 Sharrow Lifting Products 05/03/2019ACH 128148 Trailer Supplies Trailer Supplies 211.00 128153 Garage Supplies Garage Supplies 48.13 259.13Total for this ACH Check for Vendor 2226: 4889 Community Footworks 05/03/2019ACH 05012019 May 2019 Foot Clinic May 2019 Foot Clinic 224.00 224.00Total for this ACH Check for Vendor 4889: 5587 CES Imaging Inc.05/03/2019ACH INV099507 Paper Rolls Paper Rolls 14.95 14.95Total for this ACH Check for Vendor 5587: 5665 Metering & Technology Solution Inc. 05/03/2019ACH 14107 Backflow Preventer Backflow Preventer 1,078.92 1,078.92Total for this ACH Check for Vendor 5665: 6060 Batteries Plus 05/03/2019ACH P13841159 Sewer Supplies Sewer Supplies 47.90 47.90Total for this ACH Check for Vendor 6060: 7025 On Site Companies -OSSTC Inc. 05/03/2019ACH 0000743492 Restrooms May 2019 Restrooms May 2019 285.00 285.00Total for this ACH Check for Vendor 7025: 8870 Chet's Shoes Inc.05/03/2019ACH 41343 Boots-Joe F Boots-Joe F 175.00 Page 6AP Checks by Date - Detail by Check Date (5/8/2019 1:49 PM) Check No Check DateVendor NameVendor No Check Amount Invoice No ReferenceDescription 175.00Total for this ACH Check for Vendor 8870: 8884 Cascade Engineering Inc.05/03/2019ACH 30416486 Recycling Supplies Recycling Supplies 851.00 851.00Total for this ACH Check for Vendor 8884: JOHC Johnson Controls Inc.05/03/2019ACH 1-85889269913 City Hall Repair-Actuator/Thermostat City Hall Repair 1,686.00 1-85913487680 City Hall Repair-AV Room City Hall Repair-AV Room 486.50 2,172.50Total for this ACH Check for Vendor JOHC: TOII Tokle Inspections, Inc 05/03/2019ACH 05022019 April 2019 Electrical Inspections April 2019 Electrical Inspections 1,441.60 1,441.60Total for this ACH Check for Vendor TOII: 10303 All Furniture 05/03/201948393 42174 Lobby Furniture Lobby Furniture 2,580.00 2,580.00Total for Check Number 48393: 5593 American Legal Publishing Corp. 05/03/201948394 0127776 Code of Ordinances Supplement Pages Code of Ordinances Supplement Pages 54.00 54.00Total for Check Number 48394: 10302 ASDCO Construction Supply 05/03/201948395 530310 Paint Paint 33.00 530565 Concrete Mix Concrete Mix 370.83 403.83Total for Check Number 48395: 0131 Beisswenger's How-To Store 05/03/201948396 153362 Park Supplies Park Supplies 33.98 153853 Street Supplies Street Supplies 56.56 90.54Total for Check Number 48396: CPF1 Central Pension Fund 05/03/201948397 184503.0419 April 2019 Pension April 2019 Pension 921.60 921.60Total for Check Number 48397: 5901 Century Plumbing, Inc.05/03/201948398 3449 City Hall Repair City Hall Repair 850.00 850.00Total for Check Number 48398: 10305 Dan Dietz 05/03/201948399 05012019 Reimbursement-Floral Park Garden Reimbursement-Floral Park Garden 64.28 64.28Total for Check Number 48399: 4999 Hirshfield's Paint Mfg., Inc.05/03/201948400 0000608-IN Athletic Field Striping Athletic Field Striping 1,512.50 1,512.50Total for Check Number 48400: 10308 Timothy Horita 05/03/201948401 04252019 Escrow Refund: PC17-029, 3685 New Brighton RoadEscrow Refund: PC17-029, 3685 New Brighton Road 2,819.00 Page 7AP Checks by Date - Detail by Check Date (5/8/2019 1:49 PM) Check No Check DateVendor NameVendor No Check Amount Invoice No ReferenceDescription 2,819.00Total for Check Number 48401: 0447 I.U.O.E Local 49 Benefit Fund-Insurance 05/03/201948402 05152019.IUOE June 2019 Insurance June 2019 Insurance 1,402.00 05152019IUOE June 2019 Insurance June 2019 Insurance 9,920.00 11,322.00Total for Check Number 48402: 8081 Kimley-Horn and Associates, Inc 05/03/201948403 13518008 TCAAP Service March 2019 TCAAP Service March 2019 6,905.89 6,905.89Total for Check Number 48403: 10306 Judy & Howard McDermott 05/03/201948404 04302019 Mailbox Repair Mailbox Repair 73.89 73.89Total for Check Number 48404: 10236 Minnesota Petroleum Service 05/03/201948405 0000055420 Lift Inspection Lift Inspection 90.00 90.00Total for Check Number 48405: 1900 Mounds View Public School District 05/03/201948406 7467 Facility Rental-VH Elementary Facility Rental-VH Elementary 29.70 7468 Facility Rental-VH Elementary Facility Rental-VH Elementary 29.70 7469 Facility Rental-VH Elementary Facility Rental-VH Elementary 29.70 7471 Facility Rental-VH Elementary Facility Rental-VH Elementary 29.70 7511 Facility Rental-Chippewa MS Facility Rental-Chippewa MS 99.00 217.80Total for Check Number 48406: 0600 NCPERS Group Life Ins 05/03/201948407 315800052019 May 2019 Premium May 2019 Premium 64.00 64.00Total for Check Number 48407: 10307 Northridge Landscapes 05/03/201948408 04262019 Escrow Refund: GE2018-01156, 1482 Bussard CourtEscrow Refund: GE2018-01156, 1482 Bussard Court 3,675.00 3,675.00Total for Check Number 48408: 10304 Playpower LT Farmington 05/03/201948409 1400231609 Cummings Park Play Structure Cummings Park Play Structure 60,000.00 60,000.00Total for Check Number 48409: 3100 Provident Life and Accident Ins Co 05/03/201948410 E0471136.0419 April 2019 Premium April 2019 Premium 39.02 39.02Total for Check Number 48410: 0811 Ramsey County 05/03/201948411 EMCOM-007641 Fleet Support April 2019 Fleet Support April 2019 24.96 EMCOM-007677 911 Dispatch April 2019 911 Dispatch April 2019 3,552.56 EMCOM-007694 CAD Services April 2019 CAD Services April 2019 728.15 4,305.67Total for Check Number 48411: 0282 Republic Services Inc. #899 05/03/201948412 0899-003371977 Recycling April 2019 Recycling April 2019 8,062.08 Page 8AP Checks by Date - Detail by Check Date (5/8/2019 1:49 PM) Check No Check DateVendor NameVendor No Check Amount Invoice No ReferenceDescription 8,062.08Total for Check Number 48412: 5576 Schindler Elevator Corp.05/03/201948413 8105056487 Annual Elevator Inspection Annual Elevator Inspection 1,082.16 1,082.16Total for Check Number 48413: 0327 Staples Business Advantage 05/03/201948414 3410743646 Office Supplies Office Supplies 55.46 3411167207 Office Supplies Office Supplies 62.09 3411305775 Office Supplies Office Supplies 55.49 3411305776 Office Supplies Office Supplies 16.99 190.03Total for Check Number 48414: 0336 T.A. Schifksy & Sons, Inc.05/03/201948415 64301 Asphat Mix Asphat Mix 63.05 63.05Total for Check Number 48415: 6555 TKDA Inc.05/03/201948416 002019001180 Highway 10 Watermain March 2019 Highway 10 Watermain March 2019 17.35 17.35Total for Check Number 48416: 327,767.26Total for 5/3/2019: 0189 Gopher State One-Call, Inc.05/10/2019ACH 9040183 April 2019 Locates April 2019 Locates 107.10 9040183 April 2019 Locates April 2019 Locates 107.10 9040183 April 2019 Locates April 2019 Locates 107.10 321.30Total for this ACH Check for Vendor 0189: 0225 Lillie Suburban Newspapers Inc. 05/10/2019ACH 173.0419 Ordinance 2019-003 April 2019 Publication 34.50 173.0419 PC 18-014 April 2019 Publication 60.38 94.88Total for this ACH Check for Vendor 0225: 0285 Xcel Energy 05/10/2019ACH 635945318 3/18/2019-4/16/2019 1,800.87 635945318 3/18/2019-4/16/2019 46.52 635945318 3/18/2019-4/16/2019 1,265.51 635945318 3/18/2019-4/16/2019 1,470.71 635945318 3/18/2019-4/16/2019 214.93 635945318 3/18/2019-4/16/2019 1,722.71 635945318 3/18/2019-4/16/2019 948.79 7,470.04Total for this ACH Check for Vendor 0285: 0319 City of Roseville 05/10/2019ACH 0226048 Phone Services May 2019 Phone Services May 2019 407.00 0226083 IT Support May 2019 IT Support May 2019 4,598.00 5,005.00Total for this ACH Check for Vendor 0319: 0478 Truck Utilities Mfg. Company Inc. 05/10/2019ACH 5337931 Strobe Lights for 2019 F150 Strobe Lights for 2019 F150 1,430.00 Page 9AP Checks by Date - Detail by Check Date (5/8/2019 1:49 PM) Check No Check DateVendor NameVendor No Check Amount Invoice No ReferenceDescription 1,430.00Total for this ACH Check for Vendor 0478: 0549 Able Hose & Rubber LLC Inc.05/10/2019ACH 213953-001 Sewer Supplies Sewer Supplies 88.54 88.54Total for this ACH Check for Vendor 0549: 0576 TimeSaver Off Site Secretarial Inc. 05/10/2019ACH M24674 April 22 Council Meeting April 22 Council Meeting 145.00 145.00Total for this ACH Check for Vendor 0576: 0761 Electric Pump, Inc 05/10/2019ACH 0065308-IN Impellar for FLYGT Repair Impellar for FLYGT Repair 3,334.00 3,334.00Total for this ACH Check for Vendor 0761: 0772 ESS Brothers & Sons, Inc.05/10/2019ACH ZZ1600 Street Supplies Street Supplies 296.00 296.00Total for this ACH Check for Vendor 0772: 1125 Bolton & Menk, Inc.05/10/2019ACH 0231854 Colleen Avenue Drainage Colleen Avenue Drainage 7,932.50 0231855 Hazelnut Park Hazelnut Park 10,413.50 18,346.00Total for this ACH Check for Vendor 1125: 1330 MN CLN SERVICES Inc.05/10/2019ACH 0519NN01 Janitorial Services-April 2019 Janitorial Services-April 2019 1,554.58 1,554.58Total for this ACH Check for Vendor 1330: 1408 Supply Solutions LLC 05/10/2019ACH 22845 City Hall Supplies City Hall Supplies 171.89 171.89Total for this ACH Check for Vendor 1408: 5587 CES Imaging Inc.05/10/2019ACH INV100207 April 2019 Supplies April 2019 Rental 2.10 INV100207 April 2019 Rental April 2019 Rental 60.00 62.10Total for this ACH Check for Vendor 5587: 7025 On Site Companies -OSSTC Inc. 05/10/2019ACH 0000749241 Restorooms 4/29-5/17 Restorooms 4/29-5/17 198.16 198.16Total for this ACH Check for Vendor 7025: 7501 Kelly & Lemmons, P.A.05/10/2019ACH 50891 April 2019 Prosecution April 2019 Prosecution 2,675.30 2,675.30Total for this ACH Check for Vendor 7501: 8032 Pace Analytical Field Svc Inc.05/10/2019ACH 1219-1761 April 2019 Drinking Water Survey April 2019 Drinking Water Survey 711.75 711.75Total for this ACH Check for Vendor 8032: MRPA Minnesota Recreation & Park Association 05/10/2019ACH 05072019 Adult Summer Softball League Fee Adult Summer Softball League Fee 154.00 Page 10AP Checks by Date - Detail by Check Date (5/8/2019 1:49 PM) Check No Check DateVendor NameVendor No Check Amount Invoice No ReferenceDescription 154.00Total for this ACH Check for Vendor MRPA: 2597 AARP 05/10/201948417 05072019 May 2019 Driver Safety Class May 2019 Driver Safety Class 130.00 130.00Total for Check Number 48417: 0131 Beisswenger's How-To Store 05/10/201948418 158552 Garage Supplies Garage Supplies 71.72 71.72Total for Check Number 48418: 10310 Brenda Goldman 05/10/201948419 05022019 Reimbursement: Fence Post Damage Reimbursement: Fence Post Damage 10.70 10.70Total for Check Number 48419: 9045 Happy Feet Dance Company LLC 05/10/201948420 05022019 Winter/Spring Dance Lessons Winter/Spring Dance Lessons 3,315.50 3,315.50Total for Check Number 48420: IDAI Ideal Advertising, Inc 05/10/201948421 47181 Track T-Shirts/Sweatshirts Track T-Shirts/Sweatshirts 332.00 332.00Total for Check Number 48421: 10309 Yung Le 05/10/201948422 2019-00285 Refund: Permit 2019-00285 Cancelled Refund: Permit 2019-00285 Cancelled 2.00 2019-00285 Refund: Permit 2019-00285 Cancelled Refund: Permit 2019-00285 Cancelled 87.25 89.25Total for Check Number 48422: 10286 Minnesota Occupational Health 05/10/201948423 314156 Drug Screening Drug Screening 252.00 314156 Drug Screening Drug Screening 124.00 376.00Total for Check Number 48423: 10279 Neofunds Inc.05/10/201948424 6418.042019 Postage Postage 1,000.00 1,000.00Total for Check Number 48424: 6252 Office Depot 05/10/201948425 2299355657 Office Supplies Office Supplies 40.73 40.73Total for Check Number 48425: 0811 Ramsey County 05/10/201948426 PUBW-017797 Salt Purchase April 2019 Salt Purchase April 2019 580.59 SHRF CREDIT Law Enforcement Credit 2018 Law Enforcement Credit 2018 -30,599.00 SHRF CREDIT Law Enforcement Credit 2018 Law Enforcement Credit 2018 -32,032.00 SHRF CREDIT Law Enforcement Credit 2018 Law Enforcement Credit 2018 -45,561.00 SHRF CREDIT Law Enforcement Credit 2018 Law Enforcement Credit 2018 -15,086.00 SHRFL-001754 Law Enforcement Services-March 2019 Law Enforcement-March 2019 103,437.74 SHRFL-001779 Law Enforcement Services-April 2019 Law Enforcement-April 2019 103,437.74 84,178.07Total for Check Number 48426: 0327 Staples Business Advantage 05/10/201948427 3411675142 Desk Desk 308.17 Page 11AP Checks by Date - Detail by Check Date (5/8/2019 1:49 PM) Check No Check DateVendor NameVendor No Check Amount Invoice No ReferenceDescription 3411877253 Office Supplies Desk 9.19 3411877253 Office Supplies Desk 53.70 3411877256 Office Supplies Office Supplies 9.96 3412150973 Office Supplies Office Supplies 30.09 411.11Total for Check Number 48427: 0925 T-Mobile 05/10/201948428 841463567.0419 Service 4/2-5/1 Service 4/2-5/1 28.70 28.70Total for Check Number 48428: 3099 Tri-State Bobcat, Inc.-Little Canada 05/10/201948429 A57044 Safety Equipment-Hard Hats Safety Equipment-Hard Hats 103.90 103.90Total for Check Number 48429: 1300 UniFirst Corporation 05/10/201948430 090 0481088 May 2019 Mat Service May 2019 Mat Service 126.53 126.53Total for Check Number 48430: 10277 Williams Scotsman, Inc.05/10/201948431 6713647 Hazelnut May 2019 Hazelnut May 2019 450.00 450.00Total for Check Number 48431: 132,722.75Total for 5/10/2019: Report Total (118 checks): 645,997.06 Page 12AP Checks by Date - Detail by Check Date (5/8/2019 1:49 PM) CONSENT ITEM – 7B MEMORANDUM DATE: May 13, 2019 TO: Honorable Mayor and City Councilmembers Dave Perrault, City Administrator FROM: Gayle Bauman, Finance Director SUBJECT: Approve 2018 City Financial Statements & Audit Budgeted Amount: Actual Amount: Funding Source: N/A N/A N/A Council Should Consider Motion to accept the 2018 City of Arden Hills financial report and audit results as presented. Background/Discussion The 2018 financial statements and audit results are completed and a presentation is scheduled to be made to the City Council by the City’s auditor, Aaron Neilson of MMKR, as previously noted in a preceding agenda item. DATE: May 13, 2019 TO: Honorable Mayor and City Councilmembers FROM: Dave Perrault, City Administrator SUBJECT: Ramsey County Sheriff Expenditures Budgeted Amount: Estimated Amount: Funding Source: $0 $22,902 General Fund Council Should Consider Council should consider approving the additional expenditures requested by the Ramsey County Sheriff’s Department. Background The Ramsey County Sheriff has submitted three additional cost requests for the 2019 budget year. The background information is attached and a summary of the items and their costs for the City is below. -Body Camera Implementation ($13,793) – The Sheriff is planning on rolling out body cameras in July of 2019, this was not originally planned for until 2020. The total cost to the Sheriff for the contract cities is $239,699; the Sheriff’s office is proposing additional cost sharing, which would reduce the cities’ cost to $100,164, or $13,793 for Arden Hills. The cities will be responsible for the ongoing costs in 2020 and beyond, which is estimated to be $170,000 in 2020, or approximately $23,400 for Arden Hills. -Automatic External Defibrillators (AEDs) ($5,728) – The Sheriff is proposing to replace their outdated or end of life AEDs (the AEDs are approximately fifteen years old) in the contract cities, which equates to approximately twenty units. -Ballistic Tactical Shields ($3,381) – The Sheriff is requesting eight additional shields for the contract cities to improve response time in the case of critical events. None of these items are included in the 2019 budget, but it is anticipated that they will have minimal, if any, impact on the 2019 budget. For the past two years, expenditures have come in under budget by at least $32,000. We are expecting similar results in 2019. Attachment Attachment A: Ramsey County Sheriff Memo – Body Cameras Attachment B: Ramsey County Sheriff Memo – AED Replacement Attachment C: Ramsey County Sheriff Memo – Ballistic Tactical Shields CONSENT ITEM – 7C MEMORANDUM CONSENT ITEM – 7D City of Arden Hills City Council Meeting for May 13, 2019 P:\Planning\Recycling & Garbage\2019\JPA Renewal Page 1 of 2 MEMORANDUM DATE: May 13, 2019 TO: Honorable Mayor and City Councilmembers Dave Perrault, City Administrator FROM: Mike Mrosla, City Planner SUBJECT: Ramsey County Joint Powers Agreement for Recycling Funding Action Request Approve the Ramsey County Joint Powers Agreement for Recycling Funding for July 1, 2019, through December 31, 2024. Background In 1999, 2004, 2009, and 2014, the City of Arden Hills approved a Joint Powers Agreement (JPA) with Ramsey County for the collection of the residential recycling fee. The residential recycling fee is a special assessment on the property tax statement, which was set by the City at $51.50 per participating household in 2019. The County collects this revenue and transfers it to the City for deposit into the recycling enterprise fund. The revenue is only used for the residential recycling and community cleanup program. The recycling program is entirely funded by this fee and the SCORE Grant from Ramsey County. The existing JPA was approved in 2014 and is set to expire on June 30, 2019. The County has the same JPA with the cities of Lauderdale, New Brighton, North Oaks, St. Paul, and Shoreview. The proposed JPA is also a five year agreement that would begin on July 1, 2019, and expire on December 31, 2024. The notable changes to the new JPA include: •The City shall comply with all requirements as laid out in the 2019 SCORE grant agreement and all forthcoming SCORE grant agreements through the duration of this Agreement. CONSENT ITEM – 7D City of Arden Hills City Council Meeting for May 13, 2019 P:\Planning\Recycling & Garbage\2019\JPA Renewal Page 2 of 2 If the City determines that there is a better method for collecting the fee prior to the expiration of the proposed JPA in 2024, the City can terminate the JPA without cause with 180 days notice to the County. In the future, the City could consider applying the recycling fee to utility bills; however, the City would want to weigh the County administrative fee against the cost of additional City staff time. The City Attorney has reviewed the JPA and did not have any changes. Recommendation Motion to approve the Ramsey County Joint Powers Agreement for Recycling Funding for July 1, 2019, through December 31, 2024. Attachment A.Existing Joint Powers Agreement with Ramsey County B.Proposed Joint Powers Agreement with Ramsey County 1 JOINT POWERS AGREEMENT FOR RECYCLING FUNDING This Agreement is between the County of Ramsey, (“County”), and the City of Arden Hills (“City”). WHEREAS, Ramsey County requires municipalities to assure recycling service is available to all residents at their place of residence; and, WHEREAS, Ramsey County requires each municipality to be responsible for developing a long- term financing mechanism to fund its residential recycling program; and, WHEREAS, the County has authority, pursuant to Minnesota Statutes §§ 473.811 and 400.08, to collect just and reasonable rates and charges for solid waste management services provided by the County or by others under contract with the County; and, WHEREAS, the City desires to finance its recycling program by assessing individual property owners within the City for the costs of its program utilizing the County’s solid waste management service charge authority under contract with the County; NOW, THEREFORE, IT IS AGREED: I. CITY OBLIGATIONS A. The City shall comply with all requirements as laid out in the 2019 SCORE grant agreement and all forthcoming SCORE grant agreements through the duration of this Agreement. B. The City shall comply with Minnesota Statutes §§ 115A.46 and 115A.471 when arranging for the management of mixed municipal solid waste (MSW), including MSW from City-owned, operated or leased properties, and assure delivery of such waste to a waste processing facility for resource recovery. C. The City shall apply funds collected by the County on behalf of the City, pursuant to this Agreement, hereafter described as recycling service charge funds, to residential recycling and related activities. Recycling service charge funds may be used for the recycling portion of residential clean-up events and curbside collections, recycled product procurement, recycling collection bins, costs of providing a recyclable material drop-off center, management of tree and shrub waste, source-separated organics collection and associated costs, educational materials, or other costs consistent with the County’s Solid Waste Management Master Plan and approved by Saint Paul – Ramsey County Public Health (“the Department”). Administrative costs associated with the City’s solid waste and recycling program are eligible, but must first be approved by the Department. 2 The City may apply recycling service charge funds collected by the County on behalf of the City, pursuant to this Agreement, to non-residential recycling costs so long as fees are charged to non-residential properties for this service. Recycling service charge funds may be used for non-residential recycling costs, source-separated compostable material collection and associated costs, or other costs consistent with the County’s Solid Waste Management Master Plan and approved by Saint Paul – Ramsey County Public Health. D. On or before December 1 of each year the City shall provide the Department with a recycling budget which details eligible costs for the subsequent year. The budget shall show how all SCORE funds to be distributed to the City by the County for recycling service are proposed to be used. E. The City shall pay the County the actual costs of administering the City’s recycling service charge. The County’s actual costs will include but are not limited to the costs of computer programming and the Ramsey County Property Tax, Records and Election Services Department’s direct overhead costs attributable to providing these services. The City shall pay the County within thirty (30) days of receipt of the County’s invoice. F. On or before December 1 of each year, or on such other date as may be agreeable to the parties during the term of this Agreement, the City shall provide the County with a spreadsheet identifying property identification numbers (PINS), parcel types, recycling service charge rates and other requested information to be applied to each property. II. COUNTY OBLIGATIONS After receipt of the recycling service charge rates from the City, the County shall list the City’s recycling charge on the property owners’ tax statements, and shall label the charge as “Recycling.” III. TERM The Term of this Agreement is July 1, 2019 through December 31, 2024. IV. TERMINATION A. FOR CAUSE. In the event that the City fails to comply with the terms of this Agreement, or any statutory requirements, ordinances and/or plans related to this Agreement, the County may terminate this Agreement. In the event that the County exercises its right to terminate this Agreement for cause, the County shall submit written 3 notice to the City specifying the reasons for termination and the date upon which the termination becomes effective. B. WITHOUT CAUSE. This Agreement may be terminated by either party without cause, on one hundred-eighty (180) days written notice to the other party. C. OTHER EVENTS. In the event of a loss in funding or that the County’s authority to provide the services contemplated in this Agreement is modified or repealed this Agreement immediately terminates. V. ACCESS TO DOCUMENTS Until the expiration of six years after this Agreement terminates, the City shall make available to the County, the State Auditor or the County’s ultimate funding source, a copy of this Agreement and books, documents, records and accounting procedures and practices of the City relating to this Agreement. VI. HOLD HARMLESS Each party agrees to defend, indemnify and hold the other party harmless from any costs, claims, demands, actions or causes of action, including reasonable attorneys’ fees, arising out of any act or omission on the part of the party or any of its agents or employees in the performance of or with relation to any of the work or services provided by the party under the terms of this Agreement. Nothing in this Agreement shall constitute a waiver by either party of any limitations or exceptions of liability under Minnesota Statutes Chapter 466. VII. EQUAL EMPLOYMENT OPPORTUNITY Each party agrees to comply with all federal, state and local laws, resolutions, ordinances, rules, regulations and executive orders pertaining to unlawful discrimination on account of race, color, creed, religion, national origin, sex, sexual preference, marital status, status with regard to public assistance, disability or age. When required by law and requested by the other party, each party shall furnish a written affirmative action plan to the other party. VIII. DATA PRACTICES All data collected, created, received, maintained or disseminated for any purpose in the course of either party’s performance of this Agreement is governed by the Minnesota Government Data 4 Practices Act, Minnesota Statutes Chapter 13, and rules adopted to implement the Act. The parties agree to abide strictly by these statutes, rules and regulations. WHEREFORE, this Agreement is duly executed on the last date written below. RAMSEY COUNTY CITY OF ARDEN HILLS By: Jim McDonough, Chair Print Name: Ramsey County Board of Commissioners Title: _______________________________ ____________________________________ Janet M. Guthrie, Chief Clerk Ramsey County Board of Commissioners Date: _______________________________ Date: _______________________________ Approved as to form and insurance: Assistant County Attorney CONSENT ITEM - 7E DATE: May 13, 2019 TO: Honorable Mayor and City Councilmembers Dave Perrault, City Administrator FROM: Sara Knoll, Parks and Recreation Coordinator Sue Polka, Public Works Director / City Engineer SUBJECT: Accepting Donation from the Arden Hills Foundation Background The Arden Hills Foundation has been established as a 501c3 organization. Pursuant to Minnesota Statutes Section 465.03 for the benefit of its citizens, cities are authorized to accept gifts and bequests for the benefits of recreational services. Discussion The Arden Hills Foundation has donated $650.00 to the City of Arden Hills for a new park bench and plaque. This donation was given to the Arden Hills Foundation from Roberts Management Group (Roberts Family Foundation). To comply with State Statutes, the City needs to acknowledge the donation and issue receipt of the donation to the Arden Hills Foundation. Staff Recommendation Motion to Approve Resolution 2019-016 Accepting a Donation from the Arden Hills Foundation in the Amount of $650.00. Attachment Attachment A: Resolution 2019-016 MEMORANDUM CITY OF ARDEN HILLS COUNTY OF RAMSEY STATE OF MINNESOTA RESOLUTION NO. 2019-016 A RESOLUTION ACCEPTING DONATION WHEREAS, Arden Hills (“City”) is generally authorized to accept donations of real and personal property pursuant to Minnesota Statutes Section 465.03 for the benefit of its citizens, and is specifically authorized to accept gifts and bequests for the benefit of recreational services pursuant to Minnesota Statutes Section 471.17; and WHEREAS, The following entity has offered to contribute the cash amount set forth below to the city: Name of Donor Amount Arden Hills Foundation $650.00 WHEREAS, All such donations have been contributed to assist the City in the establishment and operation of recreational facilities and programs either alone or in cooperation with others, as allowed by law; and WHEREAS, The City Council finds that it is appropriate to accept the donations offered. NOW, THEREFORE, BE IT RESOLVED BY THE CITY COUNCIL OF THE CITY OF ARDEN HILLS, MINNESOTA, THAT: 1. The donation described above is accepted and shall be used to establish recreational facilities either alone or in cooperation with others, as allowed by law. 2. The city clerk is hereby directed to issue receipts to each donor acknowledging the City’s receipt of the donor’s donation. PASSED AND ADOPTED on this 13th day of May, 2019. _______________________________ David Grant, Mayor ATTEST: ______________________________________ Julie Hanson, City Clerk Page 1 of 1 DATE: May 13, 2019 TO: Honorable Mayor and City Councilmembers David Perrault, City Administrator FROM: Sue Polka, Interim Public Works Director/City Engineer SUBJECT: State of Minnesota Income Contract – Institution Community Work Crew Budgeted Amount: Actual Amount: Funding Sources: N/A General Fund Council Should Consider Entering into a contract with the State of Minnesota for the Institution Community Work Crew (ICWC) program (Attachment A). Background/Discussion Staff has met with the Department of Corrections regarding the ICWC program. The program provides for a crew leader and up to ten (10) offender crewmembers for ten (10) hours/day to complete a predetermined work plan. This program is utilized by several cities in the metro area including Shoreview, Blaine, Minnetonka and others ranging from full-time crews, crew sharing between cities, and a part-time, overtime basis. To determine how the program will work for the City of Arden Hills, staff is proposing to utilize the crew on a part-time, overtime basis. Staff has compiled an initial work plan consisting of the following projects listed below and shown on Attachment B: • Clear buckthorn at Hazelnut and Cummings Park • Re-roof picnic shelters at Hazelnut and Cummings Park • Weed and re-plant medians on Highway 96 • Remove old chain link fences at Freeway and Perry Parks The crew will complete the work on Friday, Saturday and Sunday at a cost of $75/hour, which is the part-time, overtime rate. As the crew completes the tasks listed above, staff will determine if additional tasks are available. Please note that there will also be overtime staff costs to transport the buckthorn and fencing from the parks to disposal sites, roofing materials for the picnic shelters, and landscaping items as needed for the Highway 96 medians. Attachments Attachment A – Contract Attachment B – Maps CONSENT ITEM – 7F MEMORANDUM Income Contract No. __________ (Provided by Department of Administration) STATE OF MINNESOTA INCOME CONTRACT This contract is between the State of Minnesota, acting through its Commissioner of Corrections, Institution Community Work Crew (“State”), and the City of Arden Hills, 1245 West Highway 96, Arden Hills, MN 55112 (Purchaser"). Recitals 1. Under Minn. Stat. §241.278 the State is empowered to enter into income contracts. 2. The Purchaser is in need of an Institution Community Work Crew (ICWC). 3. The State represents that it is duly qualified and agrees to provide the services described in this contract. Contract 1 Term of Contract 1.1 Effective date: March 1, 2019, or the date the State obtains all required signatures under Minnesota Statutes Section 16C.05, subdivision 2, whichever is later. 1.2 Expiration date: April 30, 2020, or until all obligations have been satisfactorily fulfilled, whichever occurs first. 2 State’s Duties The State will: 2.1 Provide crew leader(s) who will supervise up to ten (10) offender crewmembers per ten (10) hour days of work on dates mutually agreed between parties, including the hour’s crew leaders spend for daily preparation and communication. 2.2 In coordination with the Purchaser, train each work crew in safety principles and techniques set forth by the Purchaser and applicable federal, state and local agency requirements. Purchaser agrees that the State has the responsibility and authority to refuse selected projects if it considers the projects beyond the skill level of the crewmembers and/or unsafe to perform. 2.3 Provide required personal safety equipment and clothing needed for specific work. 2.4 Screen projects to ensure that appropriate staff are assigned. 3 Purchaser’s Duties The Purchaser will 3.1 Obtain all necessary permits or licenses or special authority for all projects that utilize ICWC labor. 3.2 Assign all work and coordinate material purchases and delivery through the ICWC crew leader for projects to be performed by the State. 3.3 Hire any subcontractors utilized in the project. 3.4 Provide utilities at the work site and set up accounts for the purchase of materials and rental of specialized tools or equipment needed for the work. 3.5 Meet with the State as necessary to provide project information needed by the State in the performance of its’ duties. 4 Payment 4.1 The Purchaser agrees to pay Seventy-Five dollars and 00/100 ($75.00) for each overtime hour worked by the ICWC crew, as its share of the cost of providing a crew leader and placing the work crew into service on the ICWC program during the term of this agreement. Payment will be made no later than the 23rd day following the last day of the billing period. Revised 9/02 1 5 Authorized Representatives The State's Authorized Representative is Scott Miller, ICWC Supervisor or his successor. The Purchaser’s Authorized Representative is Sue Polka, Public Works Director/City Eng or her successor. 6 Liability Each party will be responsible for its own acts and omissions and the results thereof. 7 Amendments, Waiver, and Contract Complete 7.1 Amendments. Any amendment to this contract must be in writing and will not be effective until it has been executed and approved by the same parties who executed and approved the original contract, or their successors in office. 7.2 Waiver. If the State fails to enforce any provision of this contract, that failure does not waive the provision or its right to enforce it. 7.3 Contract Complete. This contract contains all negotiations and agreements between the State and the Purchaser. No other understanding regarding this contract, whether written or oral, may be used to bind either party. 8 Government Data Practices The Purchaser must comply with the Minnesota Government Data Practices Act, Minn. Stat. Ch. 13, as it applies to all data provided by the State under this contract. The civil remedies of Minn. Stat. § 13.08 apply to the release of the data referred to in this clause by either the Purchaser or the State. If the Purchaser receives a request to release the data referred to in this Clause, the Purchaser must immediately notify the State. The State will give the Purchaser instructions concerning the release of the data to the requesting party before the data is released. 9 Publicity Any publicity regarding the subject matter of this contract must not be released without prior written approval from the State’s Authorized Representative. 10 Audit Under Minn. Stat. Section 16C.05, subd. 5, the Purchaser’s books, records, documents, and accounting procedures and practices relevant to this contract are subject to examination by the State and/or the State Auditor or Legislative Auditor, as appropriate, for a total of six years. 11 Governing Law, Jurisdiction, and Venue Minnesota law, without regard to its choice-of-law provisions, governs this contract. Venue for all legal proceedings out of this contract, or its breach, must be in the appropriate state or federal court with competent jurisdiction in Ramsey County, Minnesota. 12 Termination Either party may terminate this agreement at any time, with or without cause, upon 30 days’ written notice to the other party. Revised 9/02 2 1. PURCHASER The Purchaser certifies that the appropriate person(s) have executed the contract on behalf of the Purchaser as required by applicable articles, bylaws, resolutions, or ordinances. By Title Date By Title Date 2. STATE AGENCY With delegated authority By Title Date 3. Commissioner of Administration As delegated to Materials Management Division By Date Distribution DOC Financial Services Unit – Original (fully executed) contract Purchaser State’s Authorized Representative Budget Officer of Authorized Representative Department of Administration – Materials Management Division Revised 9/02 3 Freeway Park Fence Removal Legend Municipal Boundary City Mask May 7, 2019 Map Powered by DataLink from WSB & Associates 1 in = 47 ft ± FENCE REMOVAL Freeway Park Fence Removal Legend Municipal Boundary City Mask May 7, 2019 Map Powered by DataLink from WSB & Associates 1 in = 94 ft ± Page 1 of 1 DATE: May 13, 2019 TO: Honorable Mayor and City Councilmembers David Perrault, City Administrator FROM: Sue Polka, Interim Public Works Director/City Engineer SUBJECT: 2018 Street and Utility Improvement Project – Payment No. 8 Budgeted Amount: Actual Amount: Funding Sources: $3,300,000 $2,573,644.39 PIR, Special Assessments, Utility Funds Council Should Consider The City Council is requested to approve Payment No. 8 for the 2018 Street and Utility Improvement Project to Northwest Asphalt, Inc.in the amount of $3,705.00. Background/Discussion On March 26, 2018, the City Council adopted Resolution 2018-034 Awarding the 2018 Street and Utility Improvement Project to Northwest Asphalt, Inc. in the amount of $2,491,595.86. On June 25, 2018, the City Council approved the first payment in the amount of $83,641.23. On August 13, 2018, the City Council approved the second payment in the amount of $323,681.84. On September 10, 2018, the City Council approved the third payment in the amount of $415,613.28. On October 8, 2018, the City Council approved the fourth payment in the amount of $500,053.88. On November 13, 2018, the City Council approved the fifth payment in the amount of $701,522.89. On December 10, 2018, the City Council approved the sixth payment in the amount of $97,754.92. On January 14, 2019, the City Council approved the seventh payment in the amount of $66,787.38. The project is approximately 90% complete with all work complete except for final wear course paving and final restoration items. Five percent is being withheld from the work completed in accordance with the contract documents. The eighth payment is in the amount of $3,705.00. WSB has provided a recommendation to pay the eighth voucher (Attachment A). Staff recommends that Council approve Payment No. 8 (Attachment B). Attachments Attachment A: WSB Letter Attachment B: Payment No. 8 CONSENT ITEM – 7G MEMORANDUM K:\010111-000\Admin\Construction Admin\Pay Vouchers\R-010111-000 CST LTR VO 8 CTY-s polka-041519.docx April 15, 2019 Ms. Sue Polka, PE Public Works Director/City Engineer City of Arden Hills 1245 West Highway 96 Arden Hills, MN 55112 Re: Construction Pay Voucher No. 8 2018 Street and Utility Improvement Project City Project No. PW-17-0102 City of Arden Hills, MN WSB Project No. R-010111-000 Dear Ms. Polka: Please find enclosed Construction Pay Voucher No. 8 in the amount of $3,705.00 for the above- referenced project. The quantities completed to date have been reviewed and agreed upon by the contractor, and we hereby recommend that the City of Arden Hills approve Construction Pay Voucher No. 8 in the amount of $3,705.00 for Northwest Asphalt, Inc. Once processed, please keep one copy for your records and return two copies to our office, one for the contractor and one for our files. If you have any questions or comments regarding the enclosed, please contact me at 763.762.2801. Thank you. Sincerely, WSB Kelsey Gelhar, EIT Project Engineer Attachments srb 701 XENIA AVENUE S | SUITE 300 | MINNEAPOLIS, MN | 55416 | 763.541.4800 | WSBENG.COM 1 06/04/2018 06/15/2018 $88,043.40 $4,402.17 $83,641.23 2 06/16/2018 07/27/2018 $340,717.73 $17,035.89 $323,681.84 3 07/28/2018 08/24/2018 $437,487.66 $21,874.38 $415,613.28 4 08/25/2018 09/21/2018 $526,372.50 $26,318.62 $500,053.88 5 09/22/2018 10/27/2018 $738,445.15 $36,922.26 $701,522.89 6 10/28/2018 12/05/2018 $102,899.92 $5,145.00 $97,754.92 7 12/06/2018 01/04/2019 $70,302.50 $3,515.12 $66,787.38 8 01/05/2019 04/15/2019 $3,900.00 $195.00 $3,705.00 Totals: $2,308,168.86 $115,408.44 $2,192,760.42 R-010111-000 Payment Summary No. From Date To Date Work Certified Per Pay Voucher Amount Retained Per Pay Voucher Amount Paid Per Pay Voucher UNF 2,308,168.86 115,408.44 2,189,055.42 3,705.00 2,192,760.42 Totals: $2,308,168.86 $115,408.44 $2,189,055.42 $3,705.00 $2,192,760.42 R-010111-000 Funding Category Report Funding Category No. Work Certified To Date Less Amount Retained Less Previous Payments Amount Paid This Pay Voucher Total Amount Paid To Date UNF Unfunded 3,705.00 2,573,644.39 2,491,595.86 2,192,760.42 Totals: $3,705.00 $2,573,644.39 $2,491,595.86 $2,192,760.42 R-010111-000 Funding Source Report Accounting No. Funding Source Amount Paid This Pay Voucher Revised Contract Amount Funds Encumbered To Date Paid To Contractor To Date CITY OF ARDEN HILLS 1245 West Highway 96 Arden Hills, MN 55112 Project No. R-010111-000 Pay Voucher No. 8 Page 2 SCHEDULE A. SURFACE IMPROVEMENTS - FULL RECONSTRUCTION AREA 1 2021.501 MOBILIZATION LS $144,317.00 1 0 $0.00 1 $144,317.00 2 2101.502 CLEARING TREE $250.00 16 0 $0.00 25 $6,250.00 3 2101.507 GRUBBING TREE $310.00 16 0 $0.00 22 $6,820.00 4 2104.501 REMOVE CONCRETE CURB L F $4.00 420 0 $0.00 205 $820.00 5 2104.503 REMOVE CONCRETE WALK S F $1.00 160 0 $0.00 66 $66.00 6 2104.505 REMOVE BITUMINOUS PAVEMENT S Y $0.95 18030 0 $0.00 17880 $16,986.00 7 2104.505 REMOVE BITUMINOUS DRIVEWAY PAVEMENT S Y $5.00 750 0 $0.00 789.3 $3,946.50 8 2104.505 REMOVE CONCRETE DRIVEWAY PAVEMENT S Y $7.50 840 0 $0.00 1017.4 $7,630.50 9 2104.509 REMOVE SIGN EACH $35.00 12 0 $0.00 6 $210.00 10 2104.513 SAWING BIT PAVEMENT (FULL DEPTH) L F $2.50 190 0 $0.00 206 $515.00 11 2104.601 SALVAGE AND REINSTALL LANDSCAPE STRUCTURES LS $5,000.00 1 0 $0.00 0 $0.00 12 2104.602 SALVAGE AND REINSTALL MAILBOX EACH $80.00 58 0 $0.00 58 $4,640.00 13 2104.603 SALVAGE & REINSTALL RETAINING WALL S F $20.00 60 0 $0.00 0 $0.00 14 2104.618 SALVAGE AND REINSTALL BRICK PAVERS S F $10.00 550 0 $0.00 220 $2,200.00 15 2105.501 COMMON EXCAVATION (CV) (P) C Y $16.45 5400 0 $0.00 5400 $88,830.00 16 2105.507 SUBGRADE EXCAVATION (CV)C Y $16.45 6200 0 $0.00 6147.45 $101,125.55 17 2105.522 SELECT GRANULAR BORROW (CV) C Y $25.50 6200 0 $0.00 5822.45 $148,472.48 18 2105.604 GEOTEXTILE FABRIC TYPE V S Y $1.25 18400 0 $0.00 17372 $21,715.00 19 2112.501 SUBGRADE PREPARATION RDST $200.00 42 0 $0.00 42 $8,400.00 20 2123.610 STREET SWEEPER (WITH HOUR $135.00 30 0 $0.00 198.25 $26,763.75 R-010111-000 Project Material Status Line Item Description Units Unit Price Contract Quantity Quantity This Pay Voucher Amount This Pay Voucher Quantity To Date Amount To Date CITY OF ARDEN HILLS 1245 West Highway 96 Arden Hills, MN 55112 Project No. R-010111-000 Pay Voucher No. 8 Page 3 PICKUP BROOM) 21 2130.501 WATER MGAL $35.00 70 0 $0.00 0 $0.00 22 2131.502 CALCIUM CHLORIDE SOLUTION GAL $1.50 5361 0 $0.00 0 $0.00 23 2211.501 AGGREGATE BASE CLASS 5 TON $14.03 8070 0 $0.00 9244.15 $129,695.42 24 2331.607 HAUL BIT PAVEMENT RECLAMATION (LV) C Y $11.37 180 0 $0.00 581 $6,605.97 25 2357.502 BITUMINOUS MATERIAL FOR TACK COAT GAL $2.50 750 0 $0.00 80 $200.00 26 2360.501 TYPE SP 9.5 WEARING COURSE MIX (2,B) TON $56.01 1260 0 $0.00 17 $952.17 27 2360.501 TYPE SP 9.5 WEARING COURSE MIX (2,B) (3.0" THICK)-BIT D/W S Y $29.55 750 0 $0.00 665.7 $19,671.44 28 2360.502 TYPE SP 12.5 NON WEAR COURSE MIX (2,B) TON $52.56 1680 0 $0.00 1703 $89,509.68 29 2360.505 TYPE SP 12.5 BIT MIXTURE FOR PATCHING TON $100.00 70 0 $0.00 15.58 $1,558.00 30 2504.602 IRRIGATION SYSTEM REPAIR EACH $300.00 12 0 $0.00 20 $6,000.00 31 2505.601 UTILITY COORDINATION LS $500.00 1 0 $0.00 0.5 $250.00 32 2521.501 4" CONCRETE WALK S F $4.75 160 0 $0.00 68 $323.00 33 2531.501 CONCRETE CURB & GUTTER DESIGN B618 L F $12.00 9190 0 $0.00 9276 $111,312.00 34 2531.507 6" CONCRETE DRIVEWAY PAVEMENT S Y $56.15 1950 0 $0.00 1647.8 $92,523.97 35 2531.604 7" CONCRETE VALLEY GUTTER S Y $62.50 83 0 $0.00 0 $0.00 36 2563.601 TRAFFIC CONTROL LS $3,900.00 1 0 $0.00 0.75 $2,925.00 37 2540.602 MAIL BOX (TEMPORARY)EACH $35.00 58 0 $0.00 69 $2,415.00 38 2564.531 SIGN PANELS TYPE C S F $45.00 38 0 $0.00 0 $0.00 39 2564.602 INSTALL SIGN TYPE SPECIAL EACH $150.00 6 0 $0.00 0 $0.00 R-010111-000 Project Material Status Line Item Description Units Unit Price Contract Quantity Quantity This Pay Voucher Amount This Pay Voucher Quantity To Date Amount To Date CITY OF ARDEN HILLS 1245 West Highway 96 Arden Hills, MN 55112 Project No. R-010111-000 Pay Voucher No. 8 Page 4 40 2572.502 CLEAN ROOT CUTTING L F $8.00 150 0 $0.00 0 $0.00 41 2573.502 SILT FENCE, TYPE MS L F $1.90 1370 0 $0.00 36 $68.40 42 2573.530 STORM DRAIN INLET PROTECTION EACH $95.00 48 0 $0.00 54 $5,130.00 43 2573.533 SEDIMENT CONTROL LOG TYPE WOOD FIBER L F $3.00 3723 0 $0.00 740 $2,220.00 44 2573.533 SEDIMENT CONTROL LOG TYPE ROCK L F $7.50 150 0 $0.00 0 $0.00 45 2573.535 STABILIZED CONSTRUCTION EXIT LS $5,000.00 1 0 $0.00 1 $5,000.00 46 2574.508 FERTILIZER TYPE 3 LB $0.75 460 0 $0.00 550 $412.50 47 2574.525 BOULEVARD TOPSOIL BORROW C Y $21.00 1230 0 $0.00 1098 $23,058.00 48 2575.505 SODDING TYPE LAWN S Y $4.15 10040 0 $0.00 12389 $51,414.35 49 2575.523 EROSION CONTROL BLANKETS CATEGORY 3 S Y $1.65 2508 0 $0.00 500 $825.00 50 2575.535 WATER (TURF ESTABLISHMENT)MGAL $15.00 170 0 $0.00 0 $0.00 51 2575.560 HYDRAULIC MULCH MATRIX LB $0.50 5700 0 $0.00 2200 $1,100.00 52 2582.502 4" SOLID LINE EPOXY L F $1.00 20 0 $0.00 0 $0.00 53 2582.502 4" DBLE SOLID LINE EPOXY L F $1.00 20 0 $0.00 0 $0.00 54 2582.503 CROSSWALK EPOXY S F $3.41 275 0 $0.00 0 $0.00 Totals For Section SCHEDULE A. SURFACE IMPROVEMENTS - FULL RECONSTRUCTION AREA:$0.00 $1,142,877.68 SCHEDULE B. SANITARY SEWER IMPROVEMENTS - FULL RECONSTRUCTION AREA 55 2104.501 REMOVE SEWER PIPE (SANITARY)L F $10.00 60 0 $0.00 86 $860.00 56 2104.501 REMOVE SANITARY SERVICE PIPE L F $3.00 200 0 $0.00 11 $33.00 57 2104.509 REMOVE MANHOLE EACH $400.00 2 0 $0.00 0 $0.00 58 2104.509 REMOVE CASTING EACH $75.00 29 0 $0.00 21 $1,575.00 R-010111-000 Project Material Status Line Item Description Units Unit Price Contract Quantity Quantity This Pay Voucher Amount This Pay Voucher Quantity To Date Amount To Date CITY OF ARDEN HILLS 1245 West Highway 96 Arden Hills, MN 55112 Project No. R-010111-000 Pay Voucher No. 8 Page 5 59 2105.601 DEWATERING LS $0.01 1 0 $0.00 0 $0.00 60 2123.610 UTILITY CREW HOUR $750.00 5 0 $0.00 1.36 $1,020.00 61 2503.602 CONNECT TO EXISTING SANITARY SEWER EACH $768.00 3 0 $0.00 4 $3,072.00 62 2503.602 CONNECT TO EXISTING SANITARY SEWER SER EACH $508.50 10 0 $0.00 1 $508.50 63 2503.602 8"X4" PVC WYE EACH $616.00 5 0 $0.00 1 $616.00 64 2503.602 12"X4" PVC WYE EACH $806.00 5 0 $0.00 0 $0.00 65 2503.603 8" PVC PIPE SEWER - SDR 35 L F $83.25 60 0 $0.00 86 $7,159.50 66 2503.603 4" PVC PIPE SEWER - SDR 26 L F $30.60 260 0 $0.00 11 $336.60 67 2503.603 8" CURED-IN- PLACE PIPE SYSTEM L F $26.90 640 0 $0.00 0 $0.00 68 2503.603 12" CURED-IN- PLACE PIPE SYSTEM L F $52.90 690 0 $0.00 814 $43,060.60 69 2503.602 LATERAL CONNECTION HAT EACH $3,105.30 20 0 $0.00 7 $21,737.10 70 2503.603 TELEVISE SANITARY SEWER L F $1.20 2745 0 $0.00 1464 $1,756.80 71 2506.502 RECONSTRUCT SANITARY SEWER MANHOLE L F $390.00 104 0 $0.00 39.25 $15,307.50 72 2506.516 CASTING ASSEMBLY EACH $900.00 29 0 $0.00 21 $18,900.00 73 2506.603 CONSTRUCT 48" DIA SANITARY MANHOLE L F $381.00 50 0 $0.00 0 $0.00 Totals For Section SCHEDULE B. SANITARY SEWER IMPROVEMENTS - FULL RECONSTRUCTION AREA:$0.00 $115,942.60 SCHEDULE C. WATER MAIN IMPROVEMENTS - FULL RECONSTRUCTION AREA 74 2104.501 REMOVE WATER MAIN L F $6.00 3220 0 $0.00 3009 $18,054.00 75 2104.501 REMOVE WATER SERVICE PIPE L F $3.00 2500 0 $0.00 2264 $6,792.00 76 2104.509 REMOVE CURB STOP & BOX EACH $50.00 68 0 $0.00 68 $3,400.00 77 2104.509 REMOVE GATE VALVE & BOX EACH $75.00 8 0 $0.00 8 $600.00 78 2104.509 REMOVE HYDRANT EACH $150.00 14 0 $0.00 14 $2,100.00 79 2104.603 ABANDON WATER MAIN L F $6.00 1210 0 $0.00 1190 $7,140.00 R-010111-000 Project Material Status Line Item Description Units Unit Price Contract Quantity Quantity This Pay Voucher Amount This Pay Voucher Quantity To Date Amount To Date CITY OF ARDEN HILLS 1245 West Highway 96 Arden Hills, MN 55112 Project No. R-010111-000 Pay Voucher No. 8 Page 6 80 2105.601 DEWATERING LS $0.01 1 0 $0.00 0 $0.00 81 2123.610 UTILITY CREW HOUR $750.00 10 0 $0.00 1.3 $975.00 82 2504.601 TEMPORARY WATER SERVICE - A LS $5,700.00 1 0 $0.00 1 $5,700.00 83 2504.601 TEMPORARY WATER SERVICE - B LS $5,700.00 1 0 $0.00 1 $5,700.00 84 2504.602 CONNECT TO EXISTING WATER MAIN EACH $1,265.00 5 0 $0.00 5 $6,325.00 85 2504.602 CONNECT TO EXISTING WATER SERVICE EACH $350.00 68 0 $0.00 69 $24,150.00 86 2504.602 1" CORPORATION STOP EACH $306.00 68 0 $0.00 69 $21,114.00 87 2504.602 1" CURB STOP & BOX EACH $415.00 68 0 $0.00 68 $28,220.00 88 2504.602 INSTALL HYDRANT EACH $3,580.00 14 0 $0.00 14 $50,120.00 89 2504.602 6" GATE VALVE & BOX EACH $1,405.00 14 0 $0.00 14 $19,670.00 90 2504.602 8" GATE VALVE & BOX EACH $1,866.00 13 0 $0.00 13 $24,258.00 91 2504.602 CURB BOX CASTING EACH $130.00 5 0 $0.00 2 $260.00 92 2504.603 1" TYPE K COPPER PIPE L F $29.62 2610 0 $0.00 2601 $77,041.62 93 2504.603 6" WATERMAIN DUCTILE IRON CL 52 L F $36.10 190 0 $0.00 170 $6,137.00 94 2504.603 8" PVC C900 WATER MAIN L F $31.61 4470 0 $0.00 4391 $138,799.51 95 2504.603 8" PVC WATERMAIN (DIRECTIONAL DRILLED) L F $209.50 60 0 $0.00 60 $12,570.00 96 2504.604 4" POLYSTYRENE INSULATION S Y $41.91 70 0 $0.00 52 $2,179.32 97 2504.608 DUCTILE IRON FITTINGS LB $3.73 6130 0 $0.00 5529 $20,623.17 Totals For Section SCHEDULE C. WATER MAIN IMPROVEMENTS - FULL RECONSTRUCTION AREA:$0.00 $481,928.62 SCHEDULE D. DRAINAGE IMPROVEMENTS - FULL RECONSTRUCTION AREA 98 2104.501 REMOVE SEWER PIPE (STORM)L F $8.00 810 0 $0.00 922 $7,376.00 99 2104.509 REMOVE DRAINAGE STRUCTURE EACH $400.00 7 0 $0.00 8 $3,200.00 R-010111-000 Project Material Status Line Item Description Units Unit Price Contract Quantity Quantity This Pay Voucher Amount This Pay Voucher Quantity To Date Amount To Date CITY OF ARDEN HILLS 1245 West Highway 96 Arden Hills, MN 55112 Project No. R-010111-000 Pay Voucher No. 8 Page 7 100 2104.509 REMOVE PIPE APRON EACH $150.00 3 0 $0.00 2 $300.00 101 2104.525 ABANDON MANHOLE EACH $400.00 1 0 $0.00 0 $0.00 102 2104.603 ABANDON STORM SEWER L F $15.00 140 0 $0.00 304 $4,560.00 103 2105.601 DEWATERING LS $0.01 1 0 $0.00 0 $0.00 104 2123.610 UTILITY CREW HOUR $750.00 10 0 $0.00 0 $0.00 105 2501.515 12" RC PIPE APRON EACH $776.00 2 0 $0.00 2 $1,552.00 106 2501.515 15" RC PIPE APRON EACH $1,015.00 2 0 $0.00 2 $2,030.00 107 2501.515 18" RC PIPE APRON EACH $1,145.00 1 0 $0.00 1 $1,145.00 108 2501.515 15" GS PIPE APRON EACH $261.00 1 0 $0.00 0 $0.00 109 2501.515 24" GS PIPE APRON EACH $457.00 1 0 $0.00 0 $0.00 110 2501.525 22" SPAN RC PIPE-ARCH APRON EACH $1,273.00 2 0 $0.00 3 $3,819.00 111 2502.541 4" PERF PE PIPE DRAIN L F $12.85 1150 0 $0.00 1194 $15,342.90 112 2502.602 8" PVC PIPE DRAIN CLEANOUT EACH $247.00 1 0 $0.00 0 $0.00 113 2501.521 22" SPAN RC PIPE-ARCH CULV CL IIA L F $66.60 310 0 $0.00 401 $26,706.60 114 2503.511 12" RC PIPE SEWER CLASS V L F $38.01 630 0 $0.00 597 $22,691.97 115 2503.511 15" RC PIPE SEWER CLASS V L F $38.40 1170 0 $0.00 1267 $48,652.80 116 2503.511 18" RC PIPE SEWER CLASS III L F $41.61 520 0 $0.00 420 $17,476.20 117 2503.511 21" RC PIPE SEWER CLASS III L F $47.86 72 0 $0.00 40 $1,914.40 118 2503.511 24" RC PIPE SEWER CLASS III L F $51.32 29 0 $0.00 29 $1,488.28 119 2503.602 CONNECT TO EXISTING STORM SEWER EACH $750.00 2 0 $0.00 3 $2,250.00 120 2503.603 8" HDPE PIPE SEWER L F $29.89 103 0 $0.00 79.45 $2,374.76 121 2503.603 15" HDPE PIPE SEWER L F $32.80 192 0 $0.00 192 $6,297.60 122 2503.603 24" HDPE PIPE SEWER L F $43.19 375 0 $0.00 331 $14,295.89 CONST DRAINAGE R-010111-000 Project Material Status Line Item Description Units Unit Price Contract Quantity Quantity This Pay Voucher Amount This Pay Voucher Quantity To Date Amount To Date CITY OF ARDEN HILLS 1245 West Highway 96 Arden Hills, MN 55112 Project No. R-010111-000 Pay Voucher No. 8 Page 8 123 2506.501 STRUCTURE DESIGN N L F $274.00 14.3 0 $0.00 19.1 $5,233.40 124 2506.501 CONST DRAINAGE STRUCTURE DES 48-4020 L F $320.00 134.4 0 $0.00 135 $43,200.00 125 2506.501 CONST DRAINAGE STRUCTURE DES 60-4020 L F $567.00 42.6 0 $0.00 39.8 $22,566.60 126 2502.502 CONSTRUCT DRAINAGE STRUCTURE DESIGN SPECIAL 1 EACH $6,741.00 2 0 $0.00 2 $13,482.00 127 2506.502 CONSTRUCT DRAINAGE STRUCTURE DESIGN SPECIAL (2'X3') EACH $1,491.00 16 0 $0.00 14 $20,874.00 128 2506.516 CASTING ASSEMBLY EACH $500.00 41 0 $0.00 41 $20,500.00 129 2506.601 ORIFICE PLATE EACH $850.00 2 0 $0.00 3 $2,550.00 130 2506.602 CHIMNEY SEALS EACH $225.00 59 0 $0.00 59 $13,275.00 131 2511.501 RANDOM RIPRAP CLASS III C Y $75.00 29.9 0 $0.00 13.6 $1,020.00 132 2511.501 RANDOM RIPRAP CLASS IV C Y $75.00 29.9 0 $0.00 26.9 $2,017.50 133 2571.507 PERENNIAL 1 GAL CONT PLT $20.88 41 0 $0.00 0 $0.00 134 2571.507 PERENNIAL PLUGS PLT $7.00 123 0 $0.00 0 $0.00 135 2573.533 SEDIMENT CONTROL LOG TYPE STRAW L F $2.95 400 0 $0.00 0 $0.00 136 2573.533 SEDIMENT CONTROL LOG TYPE WOOD FIBER L F $3.75 400 0 $0.00 0 $0.00 137 2574.508 FERTILIZER TYPE 4 LB $2.08 12 0 $0.00 0 $0.00 138 2575.501 SEEDING ACRE $2,500.00 0.1 0 $0.00 0 $0.00 139 2575.502 SEED MIXTURE 34-261 LB $19.33 5 0 $0.00 0 $0.00 140 2575.502 SEED MIXTURE 35-241 LB $12.46 5 0 $0.00 0 $0.00 141 2575.523 EROSION CONTROL BLANKETS CATEGORY 3 S Y $1.35 350 0 $0.00 0 $0.00 R-010111-000 Project Material Status Line Item Description Units Unit Price Contract Quantity Quantity This Pay Voucher Amount This Pay Voucher Quantity To Date Amount To Date CITY OF ARDEN HILLS 1245 West Highway 96 Arden Hills, MN 55112 Project No. R-010111-000 Pay Voucher No. 8 Page 9 Totals For Section SCHEDULE D. DRAINAGE IMPROVEMENTS - FULL RECONSTRUCTION AREA:$0.00 $328,191.90 SCHEDULE E. SURFACE IMPROVEMENTS - RECLAMATION AREA 142 2021.501 MOBILIZATION LS $2,000.00 1 0 $0.00 1 $2,000.00 143 2104.501 REMOVE CONCRETE CURB L F $6.00 330 0 $0.00 424 $2,544.00 144 2104.509 REMOVE CASTING EACH $50.00 8 0 $0.00 9 $450.00 145 2104.509 REMOVE GATE VALVE & BOX EACH $300.00 2 0 $0.00 1 $300.00 146 2104.513 SAWING BIT PAVEMENT (FULL DEPTH) L F $2.50 210 0 $0.00 200 $500.00 147 2104.523 SALVAGE SIGN EACH $35.00 4 0 $0.00 0 $0.00 148 2104.602 SALVAGE AND REINSTALL MAILBOX EACH $80.00 8 0 $0.00 0 $0.00 149 2105.501 COMMON EXCAVATION (CV) (P) C Y $15.00 440 0 $0.00 440 $6,600.00 150 2105.507 SUBGRADE EXCAVATION (CV)C Y $16.45 510 0 $0.00 259 $4,260.55 151 2105.522 SELECT GRANULAR BORROW (CV) C Y $25.50 510 0 $0.00 261 $6,655.50 152 2123.610 STREET SWEEPER (WITH PICKUP BROOM) HOUR $135.00 20 0 $0.00 25 $3,375.00 153 2130.501 WATER MGAL $35.00 30 0 $0.00 0 $0.00 154 2131.502 CALCIUM CHLORIDE SOLUTION GAL $1.50 1730 0 $0.00 0 $0.00 155 2215.501 FULL DEPTH RECLAMATION S Y $1.35 7030 0 $0.00 6660 $8,991.00 156 2357.502 BITUMINOUS MATERIAL FOR TACK COAT GAL $2.50 360 0 $0.00 350 $875.00 157 2360.501 TYPE SP 9.5 WEARING COURSE MIX (2,B) TON $56.65 600 0 $0.00 680 $38,522.00 158 2360.502 TYPE SP 12.5 NON WEAR COURSE MIX (2,B) TON $52.43 800 0 $0.00 840.82 $44,084.19 159 2504.602 ADJUST GATE VALVE & BOX EACH $350.00 5 0 $0.00 3 $1,050.00 160 2504.602 6" GATE VALVE & BOX EACH $3,501.67 1 0 $0.00 0 $0.00 161 2506.516 CASTING ASSEMBLY EACH $900.00 7 0 $0.00 8 $7,200.00 R-010111-000 Project Material Status Line Item Description Units Unit Price Contract Quantity Quantity This Pay Voucher Amount This Pay Voucher Quantity To Date Amount To Date CITY OF ARDEN HILLS 1245 West Highway 96 Arden Hills, MN 55112 Project No. R-010111-000 Pay Voucher No. 8 Page 10 162 2531.501 CONCRETE CURB & GUTTER (HAND- FORMED) L F $18.10 240 0 $0.00 397 $7,185.70 163 2540.602 MAIL BOX (TEMPORARY)EACH $35.00 8 0 $0.00 0 $0.00 164 2563.601 TRAFFIC CONTROL LS $1,950.00 1 0 $0.00 1 $1,950.00 165 2564.602 REINSTALL SIGN EACH $150.00 4 0 $0.00 0 $0.00 166 2573.502 SILT FENCE, TYPE MS L F $2.00 290 0 $0.00 0 $0.00 167 2575.505 SODDING TYPE LAWN S Y $9.50 140 0 $0.00 418 $3,971.00 168 2573.530 STORM DRAIN INLET PROTECTION EACH $95.00 12 0 $0.00 12 $1,140.00 169 2573.533 SEDIMENT CONTROL LOG TYPE WOOD FIBER L F $3.55 730 0 $0.00 60 $213.00 170 2574.525 BOULEVARD TOPSOIL BORROW C Y $40.00 20 0 $0.00 32 $1,280.00 171 2575.535 WATER (TURF ESTABLISHMENT)MGAL $40.00 10 0 $0.00 7 $280.00 Totals For Section SCHEDULE E. SURFACE IMPROVEMENTS - RECLAMATION AREA:$0.00 $143,426.94 SCHEDULE F. DRAINAGE IMPROVEMENTS - RECLAMATION AREA 172 2104.509 REMOVE DRAINAGE STRUCTURE EACH $400.00 2 0 $0.00 2 $800.00 173 2506.516 CASTING ASSEMBLY EACH $500.00 7 0 $0.00 7 $3,500.00 174 2506.501 CONST DRAINAGE STRUCTURE DES 48-4020 L F $680.00 9 0 $0.00 9 $6,120.00 175 2506.502 CONSTRUCT DRAINAGE STRUCTURE DESIGN SPECIAL (2'X3') EACH $3,016.00 2 0 $0.00 0 $0.00 176 2506.503 RECONSTRUCT DRAINAGE STRUCTURE L F $700.00 1 0 $0.00 1 $700.00 177 2506.602 ADJUST FRAME AND RING CASTING (CATCH BASIN) EACH $200.00 7 0 $0.00 7 $1,400.00 178 2506.602 CHIMNEY SEALS EACH $225.00 9 0 $0.00 9 $2,025.00 Totals For Section SCHEDULE F. DRAINAGE IMPROVEMENTS - R-010111-000 Project Material Status Line Item Description Units Unit Price Contract Quantity Quantity This Pay Voucher Amount This Pay Voucher Quantity To Date Amount To Date CITY OF ARDEN HILLS 1245 West Highway 96 Arden Hills, MN 55112 Project No. R-010111-000 Pay Voucher No. 8 Page 11 RECLAMATION AREA:$0.00 $14,545.00 Change Order 1 179 2504.602 6" GATE VALVE & BOX EACH $4,808.58 1 0 $0.00 1 $4,808.58 180 2504.602 6" GATE VALVE & BOX EACH $2,896.00 1 0 $0.00 1 $2,896.00 181 2504.602 8" GATE VALVE & BOX EACH $5,470.18 1 0 $0.00 1 $5,470.18 182 2504.602 RECONSTRUCT EXISTING WATERMAIN EACH $5,082.27 1 0 $0.00 1 $5,082.27 183 2502.503 4" PE PIPE DRAIN L F $20.00 200 0 $0.00 158 $3,160.00 184 2105.607 1 1/2" CLEAR ROCK TON $35.30 144 0 $0.00 184.3 $6,505.79 185 2105.507 PEAT REMOVAL & DISPOSAL C Y $17.78 735 0 $0.00 735 $13,068.30 Totals For Change Order 1:$0.00 $40,991.12 Change Order 2 186 2104.521 SALVAGE FENCE L F $10.00 163 0 $0.00 163 $1,630.00 187 2557.603 INSTALL SALVAGED FENCE L F $25.00 163 156 $3,900.00 156 $3,900.00 Totals For Change Order 2:$3,900.00 $5,530.00 Change Order 3 188 2501.515 21" RC PIPE APRON EACH $2,104.55 1 0 $0.00 1 $2,104.55 189 2104.501 REMOVE SEWER PIPE (STORM)L F $42.50 106 0 $0.00 106 $4,505.00 190 2104.509 REMOVE PIPE APRON EACH $500.00 1 0 $0.00 1 $500.00 191 2104.507 REMOVE RIPRAP C Y $10.00 8 0 $0.00 8 $80.00 192 2503.603 18" HDPE PIPE SEWER L F $76.89 205 0 $0.00 205 $15,762.45 193 2501.602 18" PIPE APRON EACH $628.00 1 0 $0.00 1 $628.00 194 2506.602 CONST DRAINAGE STRUCTURE DESIGN SPECIAL EACH $2,230.00 1 0 $0.00 1 $2,230.00 195 2105.607 1 1/2" CLEAR ROCK TON $40.00 30 0 $0.00 0 $0.00 196 2511.501 RANDOM RIPRAP CLASS III C Y $150.00 8 0 $0.00 8 $1,200.00 Totals For Change Order 3:$0.00 $27,010.00 Change Order 4 197 2105.601 SITE GRADING LS $4,597.00 1 0 $0.00 1 $4,597.00 Totals For Change Order 4:$0.00 $4,597.00 R-010111-000 Project Material Status Line Item Description Units Unit Price Contract Quantity Quantity This Pay Voucher Amount This Pay Voucher Quantity To Date Amount To Date CITY OF ARDEN HILLS 1245 West Highway 96 Arden Hills, MN 55112 Project No. R-010111-000 Pay Voucher No. 8 Page 12 Change Order 5 198 2101.511 CLEARING & GRUBBING LS $2,750.00 1 0 $0.00 1 $2,750.00 199 2503.601 CLEAN STORM SEWER LS $378.00 1 0 $0.00 1 $378.00 Totals For Change Order 5:$0.00 $3,128.00 Project Totals: $3,900.00 $2,308,168.86 R-010111-000 Project Material Status Line Item Description Units Unit Price Contract Quantity Quantity This Pay Voucher Amount This Pay Voucher Quantity To Date Amount To Date CO1 Change Order 7/18/2018 Change Order No. 1 (see change order document for detailed description)$40,408.53 $40,991.12 CO2 Change Order 8/24/2018 Change Order No. 2 (see change order document for detailed description)$5,705.00 $5,530.00 CO3 Change Order 9/21/2018 Change Order No. 3 (see change order document for detailed description)$28,210.00 $27,010.00 CO4 Change Order 12/5/2018 Change Order No. 4 (see change order document for detailed description)$4,597.00 $4,597.00 CO5 Change Order 1/4/2019 Change Order No. 5 (see change order document for detailed description)$3,128.00 $3,128.00 Contract Change Totals: $82,048.53 $81,256.12 R-010111-000 Contract Changes No. Type Date Explanation Estimated Amount Amount Paid To Date CITY OF ARDEN HILLS 1245 West Highway 96 Arden Hills, MN 55112 Project No. R-010111-000 Pay Voucher No. 8 Page 13 Page 1 of 1 DATE: May 13, 2019 TO: Honorable Mayor and City Councilmembers David Perrault, City Administrator FROM: Sue Polka, Interim Public Works Director/City Engineer SUBJECT: Water System Model Update – Professional Services Agreement with AE2S Budgeted Amount: Actual Amount: Funding Sources: N/A $32,000.00 Water Utility Council Should Consider Authorize a professional services agreement with AE2S for the City’s water system model update in the amount of $32,000.00 (Attachment A). Background/Discussion Staff has been working with Ramsey County to update the Emergency Operations Plan. In addition, the City of Roseville has updated their water model to identify areas of improvement and potential added connections within the St. Paul Regional Water System. The City’s water model is used in emergency operations planning in which we work closely with Roseville as the City’s water supplier. AE2S has provided scope and fees for the water model calibration and update in the amount of $32,000. The three project phases are as follows: 1. Hydraulic Model Development 2. Water Distribution System Field Testing (includes staff training) 3. Hydraulic Model Calibration AE2S is currently completing the design of the City’s utility monitoring system and has provided modeling service for the Old Snelling watermain loop. Staff recommends approval of a professional services agreement with AE2S in the amount of $32,000. Attachments Attachment A – AE2S Letter and Proposal CONSENT ITEM – 7H MEMORANDUM Page 1 of 1 DATE: May 13, 2019 TO: Honorable Mayor and City Councilmembers David Perrault, City Administrator FROM: Sue Polka, Interim Public Works Director/City Engineer SUBJECT: Cummings Park Playground Redevelopment Project – Payment No. 1 and Change Order No. 1 Budgeted Amount: Actual Amount: Funding Sources: $180,000 (Cummings & $107,201 Park Capital Equipment Floral) Council Should Consider 1) Approve Payment No. 1 for the Cummings Park Playground Redevelopment Project to Odessa II.in the amount of $35,720.95. 2) Approve Change Order No. 1 in the amount of $9,600.00 for repaving 300 feet of trail in Cummings Park. Background/Discussion On March 25, 2019, the City Council awarded the Cummings Park Playground Project to Odessa II in the amount of $37,601 and the purchase and installation of playground structures from Little Tikes in the amount of $60,000. Odessa II’s portion of the project is complete with punch list items and potential change order items remaining. Five percent is being withheld from the work completed in accordance with the contract documents. The first payment is in the amount of $35,720.95. WSB has provided a recommendation to pay the first voucher (Attachment A). Staff recommends that Council approve Payment No. 1. The trail in Cummings Park was in poor condition prior to playground reconstruction. With this in mind, staff allowed the contractor to utilize the trail for access to the site versus driving over field which would have required turf restoration and potential irrigation repairs. Odessa II has provided Change Order No. 1 in the amount of $9,600.00 to regrade and repave the trail from Wyncrest Court to the playground site, approximately 300 feet. Staff recommends that the Council approve Change Order No. 1. Attachments Attachment A: WSB Letter and Payment No. 1 Attachment B: Change Order No. 1 CONSENT ITEM – 7I MEMORANDUM K:\012452-000\Admin\Construction Admin\Site Work\Pay Application\Pay Application #1 701 XENIA AVENUE S | SUITE 300 | MINNEAPOLIS, MN | 55416 | 763.541.4800 | WSBENG.COM May 6, 2019 Ms. Sue Polka Public Works Director/City Engineer City of Arden Hills 1245 Highway 96 W Arden Hills, MN 55112 Re: Construction Pay Application #1 Cummings Park Playground Redevelopment Project City of Arden Hills Project No. 19-PARK-003 WSB Project No. 012452-000 Dear Ms. Polka: Please find enclosed Construction Pay Application No. 1 for the above referenced project in the amount of $35,720.95. The quantities completed to date have been reviewed and agreed upon by the contractor, and we hereby recommend that the City of Arden Hills approve Construction Pay Application No. 1 for Odesa II. Note, drain tile was installed and paid for in lieu of the rock construction entrance and existing bench removals which is of equal value for this work. The amount indicated above reflects work certified to date through April 26, 2019, with a 5% retainage applied. Please include one executed copy with the payment to Odesa II and return one executed copy to our office for our file. If you have any questions or comments regarding this voucher, please contact me at (763) 231-4865. Thank you. Sincerely, WSB & Associates, Inc. Steven Foss, RLA Enclosures cc: Jim Jansen, Odesa II K:\012452-000\Admin\Construction Admin\Site Work\Pay Application\Pay Application #1 701 XENIA AVENUE S | SUITE 300 | MINNEAPOLIS, MN | 55416 | 763.541.4800 | WSBENG.COM May 6, 2019 Mr. Jim Janson Odesa II 9003 Mayhew Lake Road NE Sauk Rapids, MN 56379 Re: Change Order #1 – Trail Replacement Cummings Park Playground Redevelopment Project City of Arden Hills Project No. 19-PARK-003 WSB Project No. 012452-000 Dear Mr. Janson: Attached you will find a copy of Change Order #1 which I have prepared for signature and formal execution. Please review and, if acceptable to you, sign and forward to me. I will forward to Sue Polka for her review and signature once received from you. Sincerely, WSB Steven Foss, RLA Attachments: Change Order #1 Supporting Documents cc: Sue Polka Page 1 of 1 DATE: May 13, 2019 TO: Honorable Mayor and City Councilmembers David Perrault, City Administrator FROM: Sue Polka, Interim Public Works Director/City Engineer SUBJECT: Court Improvements at Royal Hills Park, Hazelnut Park and Cummings Park – Professional Services Agreement with WSB for Design, Construction and Geotechnical Services Budgeted Amount: Actual Amount: Funding Sources: $175,000 (2019) $45,320.00 PIR $125,000 (2021) Council Should Consider Authorize a professional services agreement with WSB for geotechnical, design and construction services for reconstruction of the tennis and basketball courts at Hazelnut Park and Royal Hills Park and the resurfacing of the tennis and basketball courts at Cummings Park in the amount of $45,320.00. Background/Discussion The Capital Improvement Plan (CIP) identifies hard court reconstruction for Hazelnut and Royal Hills Park in 2019 and Cummings Park in 2021 (Attachment A). Upon inspection of Cummings Park, it has been determined that resurfacing of the tennis court will prolong the life of the court and delay the reconstruction of the court for at least 5 to 7 more years. WSB has provided scope and fees for design and construction services in the amount of $39,420 and geotechnical services in the amount of $5,900. Borings are recommended at the Hazelnut and Royal Hills Parks to determine an adequate design section and subgrade at each location. Staff recommends approval of a professional services agreement with WSB in the amount of $45,320. Attachments Attachment A – Capital Improvement Plan Attachment B – WSB Proposals CONSENT ITEM – 7J MEMORANDUM Capital Improvement Plan City of Arden Hills, Minnesota Contact Public Works Director 2019 2023thru Department Parks Department Description Hazelnut Tennis Court/Basketball Court – Reconstruct 2019฀฀ $87,500 Royal Hills Tennis Court/Basketball Court – Reconstruct 2019 $87,500 Cummings Park Tennis Courts/Basketball Court – Reconstruct 2021 $125,000 Project #19-Park-001 Priority 3 Important Justification The cracks at some parks cannot be resolved with a basic resurface. Having a maintenance schedule that includes reconstruction and resurfacing of the courts will keep the costs down for years to come. The court life with the proper maintenance is 25-30 years. Resurfacing should take place every 5-7 years to keep the courts in good shape before they need to be completely reconstructed. Budget Impact/Other Useful Life 20-25 Project Name Hard Court Reconstruction Category Park Capital Improvements Type Improvement TCAAP No Total Project Cost:$420,000 Total20192020202120222023Expenditures 420,000175,000 125,000 120,000Construction/Maintenance 175,000 125,000 120,000 420,000Total Total20192020202120222023Funding Sources 420,000175,000 125,000 120,000Capital Improvement Funds (PIR) 175,000 125,000 120,000 420,000Total Thursday, January 10, 2019Produced Using the Plan-It Capital Planning Software 131 G:\Group Data\Materials\Mark\PROPOSAL - MARKETING\Arden Hills - Hazelnut Park - Tennis Courts\Hazelnut Park - Pro.docx 540 GATEWAY BLVD | BURNSVILLE, MN | 55337 | 952.737.4660 | WSBENG.COM April 24, 2019 Sue Polka Interim Public Works Director/City Engineer City of Arden Hills 1245 West Highway 96 Arden Hills, MN 55112 Re: Proposal for: A Geotechnical Evaluation Hazelnut Park – Tennis Courts Reconstruction Arden Hills, Minnesota Thank you for the opportunity to provide professional services for a geotechnical evaluation for the above referenced project. This lump sum fee proposal is in response to the request for proposal email we received from Steve Foss with WSB. In this proposal, we present a description of our understanding of the project, an outline of the scope of work we are to provide, and a fee schedule and estimate of charges for our services. It is our understanding that this project consists of reconstruction of the tennis court located in Hazelnut Park in Arden Hills, Minnesota. We understand that the location and elevation of the tennis court will remain similar to existing conditions. We understand the City of Arden Hills (City) is considering full replacement of the pavement section including subgrade improvements, or reclamation of the pavement section. WSB is a professional consulting and design firm providing surveying, engineering (civil/site/environmental/geotechnical/transportation), landscape architecture, planning, environmental, and construction services. A. Project Objectives Based upon our experience with similar projects the objectives of our geotechnical services are to perform subsurface borings, classify and analyze the soil samples, discuss groundwater issues, and prepare recommendations for subgrade improvements and tennis court pavement sections. B. Scope of Basic Services Based on our understanding of the project, we proposed the following scope of services: 1. Site Access Based on a review of the site from online aerial maps, it appears that the site can be accessed with our CME-55 truck mounted auger drill. It should be noted that access to the tennis courts may require driving across landscape areas, sidewalks, or curbs, and could cause rutting and tearing of sod, or cracking of concrete. Repair costs for these City of Arden Hills April 24, 2019 Page 2 G:\Group Data\Materials\Mark\PROPOSAL - MARKETING\Arden Hills - Hazelnut Park - Tennis Courts\Hazelnut Park - Pro.docx are not included in this proposal, and shall not be the responsibility of WSB. Removal of the fence to allow access to the tennis courts will be by others. 2. Bore Hole Locating and Gopher State One Call WSB will stake the proposed bore hole locations using existing aerial maps and structures as guides. If approximate bore hole locations are not acceptable and more precise locations are required by the design team we recommend the use of GPS (Global Positioning System) technology to aid in staking the borings. The borings will not be elevated. Prior to sending a drill rig to the site WSB will contact Gopher State One Call (GSOC) and have them request public underground utility owners mark and clear our proposed bore hole locations of their utilities. If there are private underground utilities that are not located by GSOC, you must notify WSB immediately. WSB will take reasonable precautions to avoid underground facilities. 3. Subsurface Test Borings We propose to complete 2 standard penetration test borings to depths of 10 feet below grade. In the standard penetration test borings we will sample and record blow counts at 2½ foot intervals to the boreholes termination depth. If unsuitable soils (existing fill, organic soils, etc…) are encountered at the proposed boring termination depth(s), it will be necessary to extend the borings into more competent materials. This will allow us to better evaluate potential construction issues. An additional charge of $20 per lineal foot will be assessed for borings extended beyond their proposed termination depths. If the added work requires an additional mobilization to the site it will be charged at $500 per day. In Minnesota, a boring that is deeper than 15 feet is considered an environmental well and requires Well Sealing Notification and Sealing Records be submitted to the Minnesota Department of Health, along with a Notification fee. The borings are planned to depths of less than 15 feet, but if they are extended due to the presence of unsuitable soils at planned termination, than additional fees will be incurred. WSB will fill out the MDH notification and sealing record forms and sign on behalf of the owner unless directed otherwise. 4. Schedule, Bore Hole Samples and Laboratory Testing Based on our current drilling backlog, we anticipate that we can mobilize our truck mounted auger drill to the site in about 4 weeks from the time that written authorization is provided. Laboratory work and report preparation will take about 2 weeks following completion of the field work. It should be noted that this schedule may change based on timing of authorization, site conditions and other factors. Should our anticipated schedule change we will let you know. This estimate is based on work being completed during normal daylight business hours, Monday through Friday. Additional charges will apply to night or weekend drilling. Samples retrieved during drilling will be returned to our laboratory where they will be reviewed, classified using the Unified Soil Classification System (USCS) and logged under the direction of a geotechnical engineer. Select samples will be set aside for laboratory testing. We may perform routine laboratory tests on selected soil samples City of Arden Hills April 24, 2019 Page 3 G:\Group Data\Materials\Mark\PROPOSAL - MARKETING\Arden Hills - Hazelnut Park - Tennis Courts\Hazelnut Park - Pro.docx obtained from the exploration. This may include determinations of natural moisture content and unconfined compressive strength with a calibrated penetrometer if cohesive soils are encountered and gradations on select sand samples from the borings. Such tests will aid in determining soil classification and properties and potential behavior characteristics to help guide our recommendations. 5. Geotechnical Engineering Report Information gathered for this project will be used to prepare a geotechnical report. The report will summarize our findings and provide a discussion of subsurface soil and groundwater conditions encountered in our borings and how they may affect the proposed construction of tennis court pavements. The report will also provide estimates of ground water depths/elevations and a discussion of site grading and soils for use as structural fill and site fill. We will provide you and any identified members of your design/project team with a PDF copy of our geotechnical report. If requested, we will also provide you with an original hard copy. This geotechnical proposal is presented for engineering services to determine the structural properties of the soil at the specified site. It does not cover an environmental assessment of the site, or environmental testing of the soil or groundwater. 6. Fee Our lump sum fee is provided below. Services Estimated Cost 2 Standard Penetration Borings to about 10 foot depths, Mobilization/Demobilization, Project Management and Administration, Gopher State Utility Clearance, Soil Classification, Boring Logs, Laboratory Testing, Geotechnical Report, Consumables $2,950.00 LUMP SUM COST $2,950.00 If additional borings or deeper borings are needed, or if engineering and testing are requested beyond that necessary for preparation of our report (post-report consultation, report revision due to changes in tennis court design or location, specification review, or pre-construction meetings), the increase in our fees will be in accordance with the rates previously indicated or at the unit prices shown on the enclosed Rate Schedule for hourly services. If you have any questions regarding our scope of services or how they may be modified to meet your project needs please feel free to give us a call to discuss. City of Arden Hills April 24, 2019 Page 4 G:\Group Data\Materials\Mark\PROPOSAL - MARKETING\Arden Hills - Hazelnut Park - Tennis Courts\Hazelnut Park - Pro.docx C. Closure This letter represents our complete understanding of the proposed scope of services. If you are in agreement with the scope of services, proposed fee and attached General Contract Provisions please sign in the appropriate space below and return one copy to my attention. If you have any questions about this proposal, please feel free to call me at (952) 737-4660 or email at mosborn@wsbeng.com. This fee proposal is valid for ninety (90) days from the creation date noted in the header. WSB may reissue a revised Proposal upon request if the indicated time period has lapsed. Should the scope of work change in nature or be expanded to include additional services, we reserve the right to renegotiate the fees with you. However, once we begin work on this project any counteroffers will not be accepted. WSB appreciates the opportunity of being considered for this project and we look forward to providing our professional services to you. Sincerely, WSB Mark Osborn, PE Darin Hyatt, PE Geotechnical Project Engineer Senior Project Engineer Attachments: WSB 2019 Rate Schedule WSB Exhibit A General Contract Provisions 11.01.16 ACCEPTED BY: Name (print) _______________________ Signature _______________________________ Company _______________________________ Title Date 5DWH6FKHGXOH :6%(1*&20      %LOOLQJ5DWH+RXU  35,1&,3$/    $662&,$7(_65352-(&70$1$*(5_65352-(&7(1*,1((5    352-(&70$1$*(5    352-(&7(1*,1((5    *5$'8$7((1*,1((5    65/$1'6&$3($5&+,7(&7_653/$11(5_65*,663(&,$/,67    /$1'6&$3($5&+,7(&7_3/$11(5_*,663(&,$/,67    (1*,1((5,1*63(&,$/,67_65(19,5210(17$/6&,(17,67    (1*,1((5,1*7(&+1,&,$1_(19,5210(17$/6&,(17,67    &216758&7,212%6(59(5    6859(< 2QH3HUVRQ&UHZ 7ZR3HUVRQ&UHZ 7KUHH3HUVRQ&UHZ  2)),&(7(&+1,&,$1    &RVWVDVVRFLDWHGZLWKZRUGSURFHVVLQJFHOOSKRQHVUHSURGXFWLRQRIFRPPRQFRUUHVSRQGHQFHDQGPDLOLQJDUHLQFOXGHGLQWKH DERYHKRXUO\UDWHV9HKLFOHPLOHDJHLVLQFOXGHGLQRXUELOOLQJUDWHV>H[FOXGLQJJHRWHFKQLFDODQGFRQVWUXFWLRQPDWHULDOVWHVWLQJ &07  VHUYLFHUDWHV@0LOHDJHFDQEHFKDUJHGVHSDUDWHO\LIVSHFLILFDOO\RXWOLQHGE\FRQWUDFW_5HLPEXUVDEOHH[SHQVHVLQFOXGHFRVWVDVVR FLDWHGZLWKSODQVSHFLILFDWLRQDQGUHSRUWUHSURGXFWLRQSHUPLWIHHVGHOLYHU\FRVWVHWF_0XOWLSOHUDWHVLOOXVWUDWHWKHYDU\LQJOHYHOVRI H[SHULHQFHZLWKLQHDFKFDWHJRU\_5DWH6FKHGXOHLVDGMXVWHGDQQXDOO\ ([KLELW$±*HQHUDO&RQWUDFW3URYLVLRQV 3DJH :6% $662&,$7(6,1& (;+,%,7$ *(1(5$/&2175$&73529,6,216 $57,&/(±3(5)250$1&(2)7+(:25. &RQVXOWDQWVKDOOSHUIRUPWKHVHUYLFHVXQGHUWKLV $JUHHPHQWLQDFFRUGDQFHZLWKWKHFDUHDQGVNLOO RUGLQDULO\H[HUFLVHGE\PHPEHUVRI&RQVXOWDQW ¶V SURIHVVLRQ SUDFWLFLQJ XQGHU VLPLODU FLUFXPVWDQFHVDWWKHVDPHWLPHDQGLQWKHVDPH ORFDOLW\ &RQVXOWDQW PDNHV QR ZDUUDQWLHV H[SUHVV RU LPSOLHG XQGHU WKLV $JUHHPHQW RU RWKHUZLVHLQFRQQHFWLRQZLWKLWVVHUYLFHV $57,&/(±$'',7,21$/6(59,&(6 ,IWKH&OLHQWUHTXHVWVWKDWWKH&RQVXOWDQWSHUIRUP DQ\VHUYLFHVZKLFKDUHEH\RQGWKHVFRSHDVVHW IRUWK LQ WKH $JUHHPHQW RU LI FKDQJHG RU XQIRUHVHHQFRQGLWLRQVUHTXLUHWKH&RQVXOWDQWWR SHUIRUP VHUYLFHV RXWVLGH RI WKH RULJLQDO VFRSH WKHQ&RQVXOWDQWVKDOOSURPSWO\QRWLI\WKH&OLHQW RI FDXVH DQG QDWXUH RI WKH DGGLWLRQDO VHUYLFHV UHTXLUHG8SRQQRWLILFDWLRQ&RQVXOWDQWVKDOOEH HQWLWOHG WR DQ HTXLWDEOH DGMXVWPHQW LQ ERWK FRPSHQVDWLRQDQGWLPHWRSHUIRUP $57,&/(±6&+('8/( 8QOHVV VSHFLILF SHULRGV RI WLPH RU GDWHV IRU SURYLGLQJ VHUYLFHV DUH VSHFLILHG LQ D VHSDUDWH ([KLELW &RQVXOWDQW¶V REOLJDWLRQ WR UHQGHU VHUYLFHV KHUHXQGHU ZLOO EH IRU D SHULRG ZKLFK PD\UHDVRQDEO\EHUHTXLUHGIRUWKHFRPSOHWLRQ RI VDLG VHUYLFHV  7KH &OLHQW DJUHHV WKDW &RQVXOWDQW LV QRW UHVSRQVLEOH IRU GDPDJHV DULVLQJGLUHFWO\RULQGLUHFWO\IURPDQ\GHOD\VIRU FDXVHV EH\RQG &RQVXOWDQW¶V FRQWURO  )RU SXUSRVHV RI WKLV $JUHHPHQW VXFK FDXVHV LQFOXGH EXW DUH QRW OLPLWHG WR VWULNHV RU RWKHU ODERU GLVSXWHV VHYHUH ZHDWKHU GLVUXSWLRQV RU RWKHU QDWXUDO GLVDVWHUV RU DFWV RI *RG ILUHV ULRWV ZDU RU RWKHU HPHUJHQFLHV DQ\ DFWLRQ RU IDLOXUH WR DFW LQ D WLPHO\ PDQQHU E\ DQ\ JRYHUQPHQWDJHQF\DFWLRQVRUIDLOXUHWRDFWE\ WKH &OLHQW RU WKH &OLHQW¶V FRQWUDFWRU RU FRQVXOWDQWV RU GLVFRYHU\ RI DQ\ KD]DUGRXV VXEVWDQFH RU GLIIHULQJ VLWH FRQGLWLRQV ,I WKH GHOD\VRXWVLGHRI&RQVXOWDQW¶VFRQWUROLQFUHDVH WKH FRVW RU WKH WLPH UHTXLUHG E\ &RQVXOWDQW WR SHUIRUP LWV VHUYLFHV LQ DFFRUGDQFH ZLWK SURIHVVLRQDOVNLOODQGFDUHWKHQ&RQVXOWDQWVKDOO EH HQWLWOHG WR D UHDVRQDEOH DGMXVWPHQW LQ VFKHGXOHDQGFRPSHQVDWLRQ $57,&/(±&216758&7,21 2%6(59$7,21 ,IUHTXHVWHGE\&OLHQW&RQVXOWDQWVKDOOYLVLWWKH SURMHFW GXULQJ FRQVWUXFWLRQ WR EHFRPH IDPLOLDU ZLWKWKHSURJUHVVDQGTXDOLW\RIWKHFRQWUDFWRUV¶ ZRUNDQGWRGHWHUPLQHLIWKHZRUNLVSURFHHGLQJ LQ JHQHUDO LQ DFFRUGDQFH ZLWK SODQV VSHFLILFDWLRQV RU RWKHU FRQWUDFW GRFXPHQWV SUHSDUHG E\ &RQVXOWDQW IRU WKH &OLHQW  7KH &OLHQWKDVQRWUHWDLQHGWKH&RQVXOWDQWWRPDNH GHWDLOHGLQVSHFWLRQVRUWRSURYLGHH[KDXVWLYHRU FRQWLQXRXV SURMHFW UHYLHZ DQG REVHUYDWLRQ VHUYLFHV &RQVXOWDQWQHLWKHUJXDUDQWHHVWKHSHUIRUPDQFH RI DQ\ &RQWUDFWRU UHWDLQHG E\ &OLHQW QRU DVVXPHV UHVSRQVLELOLW\ IRU DQ\ &RQWUDFWRU¶V IDLOXUH WR IXUQLVK DQG SHUIRUP WKH ZRUN LQ DFFRUGDQFH ZLWK WKH FRQVWUXFWLRQ GRFXPHQWV &OLHQW DFNQRZOHGJHV &RQVXOWDQW ZLOO QRW GLUHFW VXSHUYLVHRUFRQWUROWKH ZRUNRIFRQWUDFWRUVRU WKHLUVXEFRQWUDFWRUVQRUVKDOO &RQVXOWDQWKDYH DXWKRULW\ RYHU RU UHVSRQVLELOLW\ IRU WKH FRQWUDFWRUV¶PHDQVPHWKRGVRUSURFHGXUHVRI FRQVWUXFWLRQ &RQVXOWDQW¶V VHUYLFHV GR QRW LQFOXGH UHYLHZ RU HYDOXDWLRQ RI WKH &OLHQW¶V FRQWUDFWRU¶VRUVXEFRQWUDFWRU¶VVDIHW\PHDVXUHV RUMREVLWHVDIHW\-RE6LWH6DIHW\VKDOOEHWKH VROH UHVSRQVLELOLW\ RI WKH FRQWUDFWRU ZKR LV SHUIRUPLQJWKHZRUN )RU &OLHQWREVHUYHG SURMHFWV WKH &RQVXOWDQW VKDOO EH HQWLWOHG WR UHO\ XSRQ DQG DFFHSW UHSUHVHQWDWLRQVRIWKH&OLHQW¶VREVHUYHU,IWKH &OLHQW GHVLUHV PRUH H[WHQVLYH SURMHFW REVHUYDWLRQ RU IXOOWLPH SURMHFW UHSUHVHQWDWLRQ WKH &OLHQW VKDOO UHTXHVW VXFK VHUYLFHV EH SURYLGHG E\ WKH &RQVXOWDQW DV DQ $GGLWLRQDO 6HUYLFH&RQVXOWDQWDQG&OLHQWVKDOOWKHQHQWHU LQWR D 6XSSOHPHQWDO $JUHHPHQW GHWDLOLQJ WKH WHUPV DQG FRQGLWLRQV RI WKH UHTXHVWHG SURMHFW REVHUYDWLRQ $57,&/( ± 23,1,216 2) 352%$%/( &267 2SLQLRQVLIDQ\RISUREDEOHFRVWFRQVWUXFWLRQ FRVW ILQDQFLDO HYDOXDWLRQV IHDVLELOLW\ VWXGLHV HFRQRPLF DQDO\VHV RI DOWHUQDWH VROXWLRQV DQG XWLOLWDULDQ FRQVLGHUDWLRQV RI RSHUDWLRQV DQG PDLQWHQDQFH FRVWV FROOHFWLYHO\ UHIHUUHG WR DV ³&RVW(VWLPDWHV´SURYLGHGIRUDUHPDGHRUWREH PDGH RQ WKH EDVLV RI WKH &RQVXOWDQW V H[SHULHQFHDQGTXDOLILFDWLRQVDQGUHSUHVHQWWKH &RQVXOWDQW V EHVW MXGJPHQW DV DQ H[SHULHQFHG DQG TXDOLILHG SURIHVVLRQDO GHVLJQ ILUP  7KH SDUWLHV DFNQRZOHGJH KRZHYHU WKDW WKH &RQVXOWDQWGRHVQRWKDYHFRQWURORYHUWKHFRVW ([KLELW$±*HQHUDO&RQWUDFW3URYLVLRQV 3DJH RI ODERU PDWHULDO HTXLSPHQW RU VHUYLFHV IXUQLVKHGE\RWKHUVRURYHUPDUNHWFRQGLWLRQVRU FRQWUDFWRU VPHWKRGVRIGHWHUPLQLQJWKHLUSULFHV DQG DQ\ HYDOXDWLRQ RI DQ\ IDFLOLW\ WR EH FRQVWUXFWHG RU DFTXLUHG RU ZRUN WR EH SHUIRUPHG PXVW RI QHFHVVLW\ EH YLHZHG DV VLPSO\SUHOLPLQDU\$FFRUGLQJO\WKH&RQVXOWDQW DQG &OLHQW DJUHH WKDW WKH SURSRVDOV ELGV RU DFWXDOFRVWVPD\YDU\IURPRSLQLRQVHYDOXDWLRQV RUVWXGLHVVXEPLWWHGE\WKH&RQVXOWDQWDQGWKDW &RQVXOWDQW DVVXPHV QR UHVSRQVLELOLW\ IRU WKH DFFXUDF\ RI RSLQLRQV RI &RVW (VWLPDWHV DQG &OLHQWH[SUHVVO\ZDLYHVDQ\FODLPVUHODWHGWRWKH DFFXUDF\RIRSLQLRQVRI&RVW(VWLPDWHV,I&OLHQW ZLVKHVJUHDWHUDVVXUDQFHDVWR&RVW(VWLPDWHV &OLHQW VKDOO HPSOR\ DQ LQGHSHQGHQW FRVW HVWLPDWRUDVSDUWRILWV3URMHFWUHVSRQVLELOLWLHV $57,&/(±5(86($1'',6326,7,212) ,167580(1762)6(59,&( $OO GRFXPHQWV LQFOXGLQJ UHSRUWV GUDZLQJV FDOFXODWLRQV VSHFLILFDWLRQV &$'' PDWHULDOV FRPSXWHUVVRIWZDUH RUKDUGZDUHRU RWKHU ZRUN SURGXFWSUHSDUHGE\&RQVXOWDQWSXUVXDQWWRWKLV $JUHHPHQW DUH &RQVXOWDQW¶V ,QVWUXPHQWV RI 6HUYLFH DQG &RQVXOWDQW UHWDLQV DOO RZQHUVKLS LQWHUHVWV LQ ,QVWUXPHQWV RI 6HUYLFH LQFOXGLQJ FRS\ULJKWV7KH,QVWUXPHQWVRI6HUYLFHDUHQRW LQWHQGHGRUUHSUHVHQWHGWREHVXLWDEOHIRUUHXVH E\ WKH &OLHQW RU RWKHUV RQ H[WHQVLRQV RI WKH 3URMHFW RU RQ DQ\ RWKHU SURMHFW  &RSLHV RI GRFXPHQWVWKDWPD\EHUHOLHGXSRQE\&OLHQWDUH OLPLWHGWRWKHSULQWHGFRSLHV DOVRNQRZQDVKDUG FRSLHV WKDWDUHVLJQHGRUVHDOHGE\&RQVXOWDQW )LOHVLQHOHFWURQLFIRUPDWIXUQLVKHGWR&OLHQWDUH RQO\IRUFRQYHQLHQFHRI&OLHQW$Q\FRQFOXVLRQRU LQIRUPDWLRQ REWDLQHG RU GHULYHG IURP VXFK HOHFWURQLF ILOHV ZLOO EH DW WKH XVHU¶V VROH ULVN &RQVXOWDQWPDNHVQRUHSUHVHQWDWLRQVDVWRORQJ WHUP FRPSDWLELOLW\ XVDELOLW\ RU UHDGDELOLW\ RI HOHFWURQLFILOHV ,I UHTXHVWHG DW WKH WLPH RI FRPSOHWLRQ RU WHUPLQDWLRQ RI WKH ZRUN WKH &RQVXOWDQW PD\ PDNHDYDLODEOHWRWKH&OLHQWWKH,QVWUXPHQWVRI 6HUYLFH XSRQ L SD\PHQW RIDPRXQWVGXH DQG RZLQJ IRU ZRUN SHUIRUPHG DQG H[SHQVHV LQFXUUHGWRWKHGDWHDQGWLPHRIWHUPLQDWLRQDQG LL  IXOILOOPHQW RI WKH &OLHQW¶V REOLJDWLRQV XQGHU WKLV$JUHHPHQW$Q\XVHRUUHXVHRIVXFK ,QVWUXPHQWV RI 6HUYLFH E\ WKH &OLHQW RU RWKHUV ZLWKRXW ZULWWHQ FRQVHQW YHULILFDWLRQ RU DGDSWDWLRQ E\ WKH &RQVXOWDQW H[FHSW IRU WKH VSHFLILFSXUSRVHLQWHQGHGZLOOEHDWWKH&OLHQW¶V ULVN DQG IXOO OHJDO UHVSRQVLELOLW\ DQG &OLHQW H[SUHVVO\UHOHDVHVDOOFODLPVDJDLQVW&RQVXOWDQW DULVLQJIURPUHXVHRIWKH,QVWUXPHQWVRI6HUYLFH ZLWKRXW&RQVXOWDQW¶VZULWWHQFRQVHQWYHULILFDWLRQ RUDGDSWDWLRQ 7KH&OLHQWZLOOWRWKHIXOOHVWH[WHQWSHUPLWWHGE\ ODZLQGHPQLI\DQGKROGWKH&RQVXOWDQWKDUPOHVV IURP DQ\ FODLP OLDELOLW\ RU FRVW LQFOXGLQJ UHDVRQDEOHDWWRUQH\V IHHVDQGGHIHQVHFRVWV  DULVLQJ RU DOOHJHGO\ DULVLQJ RXW RI DQ\ XQDXWKRUL]HG UHXVH RU PRGLILFDWLRQ RI WKHVH ,QVWUXPHQWV RI 6HUYLFH E\ WKH &OLHQW RU DQ\ SHUVRQ RU HQWLW\ WKDW DFTXLUHV RU REWDLQV WKH UHSRUWVSODQVDQGVSHFLILFDWLRQVIURPRUWKURXJK WKH&OLHQWZLWKRXWWKHZULWWHQDXWKRUL]DWLRQRIWKH &RQVXOWDQW  8QGHU QR FLUFXPVWDQFHV VKDOO WUDQVIHURI,QVWUXPHQWVRI6HUYLFHEHGHHPHGD VDOH E\ &RQVXOWDQW DQG &RQVXOWDQW PDNHV QR ZDUUDQWLHV HLWKHU H[SUHVVHG RU LPSOLHG RI PHUFKDQWDELOLW\ DQG ILWQHVV IRU DQ\ SDUWLFXODU SXUSRVH  &RQVXOWDQW VKDOO EH HQWLWOHG WR FRPSHQVDWLRQ IRU DQ\ FRQVHQW YHULILFDWLRQ RU DGDSWLRQ RI WKH ,QVWUXPHQWV RI 6HUYLFH IRU H[WHQVLRQVRIWKH3URMHFWRUDQ\RWKHUSURMHFW $57,&/(±3$<0(176 3D\PHQWWR&RQVXOWDQWVKDOOEHRQDOXPSVXP RU KRXUO\ EDVLV DV VHW RXW LQ WKH $JUHHPHQW &RQVXOWDQW LV HQWLWOHG WR SD\PHQW RI DPRXQWV GXHSOXVUHLPEXUVDEOHH[SHQVHV&OLHQWZLOOSD\ WKHEDODQFHVWDWHGRQWKHLQYRLFHXQOHVV&OLHQW QRWLILHV &RQVXOWDQW LQ ZULWLQJ RI DQ\ GLVSXWHG LWHPV ZLWKLQ ILIWHHQ   GD\V IURP WKH GDWH RI LQYRLFH,QWKHHYHQWRIDQ\GLVSXWH&OLHQWZLOO SD\ DOO XQGLVSXWHG DPRXQWV LQ WKH RUGLQDU\ FRXUVHDQGWKH3DUWLHVZLOOHQGHDYRUWRUHVROYH DOO GLVSXWHG LWHPV  $OO DFFRXQWV XQSDLG DIWHU WKLUW\  GD\VIURPWKHGDWHRIRULJLQDOLQYRLFH VKDOOEHVXEMHFWWRDVHUYLFHFKDUJHRI SHUPRQWKRUWKHPD[LPXPDPRXQWDXWKRUL]HG E\ ODZ ZKLFKHYHU LV OHVV &RQVXOWDQW UHVHUYHV WKHULJKWWRUHWDLQLQVWUXPHQWVRIVHUYLFHXQWLODOO LQYRLFHVDUHSDLGLQIXOO&RQVXOWDQWZLOOQRWEH OLDEOHIRUDQ\FODLPVRIORVVGHOD\RUGDPDJHE\ &OLHQW IRU UHDVRQ RI ZLWKKROGLQJ VHUYLFHV RU LQVWUXPHQWVRIVHUYLFHXQWLODOOLQYRLFHVDUHSDLG LQIXOO&RQVXOWDQWVKDOOEHHQWLWOHGWRUHFRYHUDOO UHDVRQDEOH FRVWV DQG GLVEXUVHPHQWV LQFOXGLQJ UHDVRQDEOHDWWRUQH\IHHVLQFXUUHGLQFRQQHFWLRQ ZLWK FROOHFWLQJ DPRXQWV RZHG E\ &OLHQW  ,Q DGGLWLRQ&RQVXOWDQWPD\DIWHUJLYLQJVHYHQ   GD\V¶ZULWWHQQRWLFHWR&OLHQWVXVSHQGVHUYLFHV XQGHU WKLV $JUHHPHQW XQWLO LW UHFHLYHV IXOO SD\PHQWIRUDOODPRXQWVWKHQGXHIRUVHUYLFHV H[SHQVHV DQG FKDUJHV 3D\PHQW PHWKRGV H[SHQVHVDQGUDWHVPD\EHPRUHIXOO\GHVFULEHG LQ([KLELW&DQG([KLELW( ([KLELW$±*HQHUDO&RQWUDFW3URYLVLRQV 3DJH $57,&/( ± 68%0,77$/6 $1' 3$< $33/,&$7,216 ,I WKH 6FRSH RI :RUN LQFOXGHV WKH &RQVXOWDQW UHYLHZLQJ DQG FHUWLI\LQJ WKH DPRXQWV GXH WKH &RQWUDFWRU WKH &RQVXOWDQW¶V FHUWLILFDWLRQ IRU SD\PHQWVKDOOFRQVWLWXWHDUHSUHVHQWDWLRQWRWKH &OLHQW WKDW WR WKH EHVW RI WKH &RQVXOWDQW¶V NQRZOHGJHLQIRUPDWLRQDQGEHOLHIWKH:RUNKDV SURJUHVVHG WR WKH SRLQW LQGLFDWHG DQG WKDW WKH TXDOLW\RIWKH:RUNLVLQJHQHUDODFFRUGDQFHZLWK WKH 'RFXPHQWV LVVXHG E\ WKH &RQVXOWDQW 7KH LVVXDQFHRID&HUWLILFDWHIRU3D\PHQWVKDOOQRW EHDUHSUHVHQWDWLRQWKDWWKH&RQVXOWDQWKDV   PDGH H[KDXVWLYH RU FRQWLQXRXV RQVLWH LQVSHFWLRQVWRFKHFNWKHTXDOLW\RUTXDQWLW\RIWKH :RUN   UHYLHZHG FRQVWUXFWLRQ PHDQV PHWKRGVWHFKQLTXHVVHTXHQFHVRUSURFHGXUHV  UHYLHZHGFRSLHVRIUHTXLVLWLRQVUHFHLYHGIURP 6XEFRQWUDFWRUVDQGPDWHULDOVXSSOLHUVDQGRWKHU GDWDUHTXHVWHGE\WKH&OLHQWWRVXEVWDQWLDWHWKH &RQWUDFWRU¶VULJKWWRSD\PHQWRU  DVFHUWDLQHG KRZ RU IRU ZKDW SXUSRVH WKH &RQWUDFWRU KDV XVHGPRQH\SUHYLRXVO\SDLGRQDFFRXQWRIWKH &RQWUDFW 6XP  &RQWUDFWRU VKDOO UHPDLQ H[FOXVLYHO\UHVSRQVLEOHIRULWV:RUN ,I WKH 6FRSH RI :RUN LQFOXGHV &RQVXOWDQW¶V UHYLHZ DQG DSSURYDO RI VXEPLWWDOV IURP WKH &RQWUDFWRUVXFKUHYLHZVKDOOEHIRUWKHOLPLWHG SXUSRVH RI FKHFNLQJ IRU FRQIRUPDQFH ZLWK WKH LQIRUPDWLRQJLYHQDQGWKHGHVLJQFRQFHSW7KH UHYLHZRIVXEPLWWDOVLVQRWLQWHQGHGWRGHWHUPLQH WKHDFFXUDF\RIDOOFRPSRQHQWVWKHDFFXUDF\RI WKH TXDQWLWLHV RU GLPHQVLRQV RU WKH VDIHW\ SURFHGXUHV PHDQV RU PHWKRGV WR EH XVHG LQ FRQVWUXFWLRQ DQG WKRVH UHVSRQVLELOLWLHV UHPDLQ H[FOXVLYHO\ZLWKWKH&OLHQW¶VFRQWUDFWRU $57,&/(±+$=$5'2860$7(5,$/6 1RWZLWKVWDQGLQJ WKH 6FRSH RI 6HUYLFHV WR EH SURYLGHG SXUVXDQW WR WKLV $JUHHPHQW LW LV XQGHUVWRRGDQGDJUHHGWKDW&RQVXOWDQWLVQRWD XVHU KDQGOHU JHQHUDWRU RSHUDWRU WUHDWHU DUUDQJHU VWRUHU WUDQVSRUWHU RU GLVSRVHU RI KD]DUGRXV RU WR[LF VXEVWDQFHV SROOXWDQWV RU FRQWDPLQDQWVDVDQ\RIWKHIRUHJRLQJLWHPVDUH GHILQHGE\)HGHUDO6WDWHDQGRUORFDOODZUXOHV RU UHJXODWLRQV QRZ H[LVWLQJ RU KHUHDIWHU DPHQGHGDQGZKLFKPD\EHIRXQGRULGHQWLILHG RQ DQ\ 3URMHFW ZKLFK LV XQGHUWDNHQ E\ &RQVXOWDQW 7KH&OLHQWDJUHHVWRLQGHPQLI\&RQVXOWDQWDQG LWV RIILFHUV VXEFRQVXOWDQW V  HPSOR\HHV DQG DJHQWV IURP DQG DJDLQVW DQ\ DQG DOO FODLPV ORVVHV GDPDJHV OLDELOLW\ DQG FRVWV LQFOXGLQJ EXWQRWOLPLWHGWRFRVWVRIGHIHQVHDULVLQJRXWRI RU LQ DQ\ ZD\ FRQQHFWHG ZLWK WKH SUHVHQFH GLVFKDUJH UHOHDVH RU HVFDSH RI KD]DUGRXV RU WR[LFVXEVWDQFHVSROOXWDQWVRUFRQWDPLQDQWVRI DQ\NLQGH[FHSWWKDWWKLVFODXVHVKDOOQRWDSSO\ WRVXFKOLDELOLW\DVPD\DULVHRXWRI&RQVXOWDQW¶V VROHQHJOLJHQFHLQWKHSHUIRUPDQFHRIVHUYLFHV XQGHUWKLV$JUHHPHQWDULVLQJIURPRUUHODWLQJWR KD]DUGRXV RU WR[LF VXEVWDQFHV SROOXWDQWV RU FRQWDPLQDQWVVSHFLILFDOO\LGHQWLILHGE\WKH&OLHQW DQGLQFOXGHGZLWKLQ&RQVXOWDQW¶VVHUYLFHVWREH SURYLGHGXQGHUWKLV$JUHHPHQW $57,&/(±,1685$1&( &RQVXOWDQW KDV SURFXUHG JHQHUDO DQG SURIHVVLRQDO OLDELOLW\ LQVXUDQFH  2Q UHTXHVW &RQVXOWDQWZLOOIXUQLVKFOLHQWZLWKDFHUWLILFDWHRI LQVXUDQFHGHWDLOLQJWKHSUHFLVHQDWXUHDQGW\SH RILQVXUDQFHDORQJZLWKDSSOLFDEOHSROLF\OLPLWV $GGLWLRQDO ,QVXUDQFH UHTXLUHPHQWV DUH OLVWHG LQ ([KLELW' $57,&/( ±7(50,1$7,2125 6863(16,21 ,I &RQVXOWDQW¶V VHUYLFHV DUH GHOD\HG RU VXVSHQGHG LQ ZKROH RU LQ SDUW E\ &OLHQW RU LI &RQVXOWDQW¶VVHUYLFHVDUHGHOD\HGE\DFWLRQVRU LQDFWLRQVRIRWKHUVIRUPRUHWKDQVL[W\  GD\V WKURXJKQRIDXOWRI&RQVXOWDQW&RQVXOWDQWVKDOO EH HQWLWOHG WR HLWKHU WHUPLQDWH LWV DJUHHPHQW XSRQ VHYHQ   GD\V ZULWWHQ QRWLFH RU DW LWV RSWLRQDFFHSWDQHTXLWDEOHDGMXVWPHQWRIUDWHV DQG DPRXQWV RI FRPSHQVDWLRQ SURYLGHG IRU HOVHZKHUH LQ WKLV $JUHHPHQW WR UHIOHFW UHDVRQDEOH FRVWV LQFXUUHG E\ &RQVXOWDQW LQ FRQQHFWLRQZLWKDPRQJRWKHUWKLQJVVXFKGHOD\ RUVXVSHQVLRQDQGUHDFWLYDWLRQDQGWKHIDFWWKDW WKHWLPHIRUSHUIRUPDQFHXQGHUWKLV$JUHHPHQW KDVEHHQUHYLVHG 7KLV $JUHHPHQW PD\ EH WHUPLQDWHG E\ HLWKHU SDUW\XSRQVHYHQ  GD\VZULWWHQQRWLFHVKRXOG WKH RWKHU SDUW\ IDLO VXEVWDQWLDOO\ WR SHUIRUP LQ DFFRUGDQFHZLWKLWVWHUPVWKURXJKQRIDXOWRIWKH SDUW\ LQLWLDWLQJ WKH WHUPLQDWLRQ ,Q WKH HYHQW RI WHUPLQDWLRQ&RQVXOWDQWVKDOOEHFRPSHQVDWHGIRU VHUYLFHV SHUIRUPHG SULRU WR WHUPLQDWLRQ GDWH LQFOXGLQJFKDUJHVIRUH[SHQVHVDQGHTXLSPHQW FRVWVWKHQGXHDQGDOOWHUPLQDWLRQH[SHQVHV 7KLV $JUHHPHQW PD\ EH WHUPLQDWHG E\ HLWKHU SDUW\XSRQWKLUW\  GD\V¶ZULWWHQQRWLFHZLWKRXW FDXVH&RQVXOWDQWVKDOOXSRQWHUPLQDWLRQRQO\EH HQWLWOHGWRSD\PHQWIRUWKHZRUNSHUIRUPHGXSWR WKH 'DWH RI WHUPLQDWLRQ  ,Q WKH HYHQW RI WHUPLQDWLRQ FRSLHV RI SODQV UHSRUWV VSHFLILFDWLRQV HOHFWURQLF GUDZLQJGDWD ILOHV &$'' ILHOGGDWDQRWHVDQGRWKHUGRFXPHQWV ZKHWKHU ZULWWHQ SULQWHG RU UHFRUGHG RQ DQ\ PHGLXP ZKDWVRHYHU ILQLVKHG RU XQILQLVKHG ([KLELW$±*HQHUDO&RQWUDFW3URYLVLRQV 3DJH SUHSDUHG E\ WKH &RQVXOWDQW SXUVXDQW WR WKLV $JUHHPHQWDQGSHUWDLQLQJWRWKHZRUNRUWRWKH 3URMHFW KHUHLQDIWHU ,QVWUXPHQWV RI 6HUYLFH  VKDOO EH PDGH DYDLODEOH WR WKH &OLHQW XSRQ SD\PHQW RI DOO DPRXQWV GXH DV RI WKH GDWH RI WHUPLQDWLRQ  $OO SURYLVLRQV RI WKLV $JUHHPHQW DOORFDWLQJ UHVSRQVLELOLW\ RU OLDELOLW\ EHWZHHQ WKH &OLHQW DQG &RQVXOWDQW VKDOO VXUYLYH WKH FRPSOHWLRQRIWKHVHUYLFHVKHUHXQGHUDQGRUWKH WHUPLQDWLRQRIWKLV$JUHHPHQW $57,&/(±,1'(01,),&$7,21 7KH&RQVXOWDQWDJUHHVWRLQGHPQLI\DQGKROGWKH &OLHQW KDUPOHVV IURP DQ\ GDPDJH OLDELOLW\ RU FRVW WR WKH H[WHQW FDXVHG E\ WKH &RQVXOWDQW ¶V QHJOLJHQFHRUZLOOIXOPLVFRQGXFW 7KH &OLHQW DJUHHV WR LQGHPQLI\ DQG KROG WKH &RQVXOWDQWKDUPOHVVIURPDQ\GDPDJHOLDELOLW\ RU FRVW WR WKH H[WHQW FDXVHG E\ WKH &OLHQW¶V QHJOLJHQFHRUZLOOIXOPLVFRQGXFW $57,&/(±:$,9(52)&216(48(17,$/ '$0$*(6 7KH&RQVXOWDQWDQG&OLHQWZDLYHFODLPVDJDLQVW HDFK RWKHU IRU FRQVHTXHQWLDO GDPDJHV DULVLQJ RXWRIRUUHODWLQJWRWKLVFRQWUDFW7KLVPXWXDO ZDLYHULQFOXGHVGDPDJHVLQFXUUHGE\WKH&OLHQW IRU UHQWDO H[SHQVHV IRU ORVV RI XVH ORVV RI LQFRPH ORVW SURILW SURMHFW GHOD\V ILQDQFLQJ EXVLQHVV DQG UHSXWDWLRQ DQG IRU ORVV RI PDQDJHPHQWRUHPSOR\HHSURGXFWLYLW\RURIWKH VHUYLFHV RI VXFK SHUVRQV DQG   'DPDJHV LQFXUUHG E\ WKH &RQVXOWDQW IRU SULQFLSDO RIILFH H[SHQVHV LQFOXGLQJ WKH FRPSHQVDWLRQ IRU SHUVRQQHO VWDWLRQHG WKHUH IRU ORVVHV RI ILQDQFLQJEXVLQHVVDQGUHSXWDWLRQDQGIRUORVV RISURILWH[FHSWDQWLFLSDWHGSURILWDULVLQJGLUHFWO\ IURP WKH :RUN  7KH &RQVXOWDQW DQG &OLHQW IXUWKHU DJUHH WR REWDLQ D VLPLODU ZDLYHU IURP HDFK RI WKHLU FRQWUDFWRUV VXEFRQWUDFWRUV RU VXSSOLHUV $57,&/( ±:$,9(52)&/$,06)25 3(5621$//,$%,/,7< ,WLVLQWHQGHGE\WKHSDUWLHVWRWKLV$JUHHPHQW WKDW &RQVXOWDQW¶V VHUYLFHV VKDOO QRW VXEMHFW &RQVXOWDQW¶VHPSOR\HHVRIILFHUVRUGLUHFWRUVWR DQ\ SHUVRQDO OHJDO H[SRVXUH IRU WKH ULVNV DVVRFLDWHGZLWKWKLV$JUHHPHQW7KHUHIRUHDQG QRWZLWKVWDQGLQJ DQ\WKLQJ WR WKH FRQWUDU\ FRQWDLQHGKHUHLQWKH&OLHQWDJUHHVWKDWDVWKH &OLHQW¶VVROHDQGH[FOXVLYHUHPHG\DQ \ FODLP GHPDQGRUVXLWVKDOOEHGLUHFWHGDQGRUDVVHUWHG RQO\DJDLQVW&RQVXOWDQWDQGQRWDJDLQVWDQ\RI &RQVXOWDQW¶V LQGLYLGXDO HPSOR\HHV RIILFHUV RU GLUHFWRUV $57,&/(±$66,*10(17 1HLWKHU3DUW\WRWKLV$JUHHPHQWVKDOODVVLJQLWV LQWHUHVW LQ WKLV DJUHHPHQW DQ\ SURFHHGV GXH XQGHUWKH$JUHHPHQWQRU DQ\FODLPVWKDWPD\ DULVHIURPVHUYLFHVRUSD\PHQWVGXHXQGHUWKH $JUHHPHQW ZLWKRXW WKH ZULWWHQ FRQVHQW RI WKH RWKHU3DUW\$Q\DVVLJQPHQWLQYLRODWLRQRIWKLV SURYLVLRQ VKDOO EH QXOO DQG YRLG  1RWKLQJ FRQWDLQHG LQ WKLV $JUHHPHQW VKDOO FUHDWH D FRQWUDFWXDOUHODWLRQVKLSZLWKRUDFDXVHRIDFWLRQ LQ IDYRU RI D WKLUG SDUW\ DJDLQVW HLWKHU WKH &RQVXOWDQWRU&OLHQW7KLV$JUHHPHQWLVIRUWKH H[FOXVLYH EHQHILW RI &RQVXOWDQW DQG &OLHQW DQG WKHUHDUHQRRWKHULQWHQGHGEHQHILFLDULHVRIWKLV $JUHHPHQW $57,&/(±&21)/,&75(62/87,21 ,Q DQ HIIRUW WR UHVROYH DQ\ FRQIOLFWV WKDW DULVH GXULQJWKHGHVLJQRUFRQVWUXFWLRQRIWKHSURMHFW RU IROORZLQJ WKH FRPSOHWLRQ RI WKH SURMHFW WKH &OLHQW DQG &RQVXOWDQW DJUHH WKDW DOO GLVSXWHV EHWZHHQ WKHP DULVLQJ RXW RI RU UHODWLQJ WR WKLV $JUHHPHQW VKDOO EH VXEPLWWHG WR QRQELQGLQJ PHGLDWLRQDVDSUHFRQGLWLRQWRDQ\IRUPDOOHJDO SURFHHGLQJV $57,&/(±&21),'(17,$/,7< 7KH&RQVXOWDQWDJUHHVWRNHHSFRQILGHQWLDODQG QRW WR GLVFORVH WR DQ\ SHUVRQ RU HQWLW\ RWKHU WKDQ WKH &RQVXOWDQW¶V HPSOR\HHV VXEFRQVXOWDQWV DQG WKH JHQHUDO FRQWUDFWRU DQG VXEFRQWUDFWRUV LI DSSURSULDWH DQ\ GDWD DQG LQIRUPDWLRQ IXUQLVKHG WR WKH &RQVXOWDQW DQG PDUNHG &21),'(17,$/ E\ WKH &OLHQW  7KHVH SURYLVLRQV VKDOO QRW DSSO\ WR LQIRUPDWLRQ LQ ZKDWHYHU IRUP WKDW FRPHV LQWR WKH SXEOLF GRPDLQQRUVKDOOLWUHVWULFWWKH&RQVXOWDQWIURP JLYLQJQRWLFHVUHTXLUHGE\ODZRUFRPSO\LQJZLWK DQ RUGHU WR SURYLGH LQIRUPDWLRQ RU GDWD ZKHQ VXFKRUGHULVLVVXHGE\DFRXUWDGPLQLVWUDWLYH DJHQF\RURWKHUDXWKRULW\ZLWKSURSHUMXULVGLFWLRQ RULILWLVUHDVRQDEO\QHFHVVDU\IRUWKH &RQVXOWDQW WR FRPSOHWH VHUYLFHV XQGHU WKH $JUHHPHQW RU GHIHQG LWVHOI IURP DQ\ VXLW RU FODLP  ([KLELW$±*HQHUDO&RQWUDFW3URYLVLRQV 3DJH $57,&/( ± $9$,/$%/( ,1685$1&( 352&(('6$1'/,0,7$7,212)/,$%,/,7< &RQVXOWDQW PDLQWDLQV SURIHVVLRQDO OLDELOLW\ LQVXUDQFH ZLWK D OLDELOLW\ OLPLW RI QRW OHVV WKDQ  SHU FODLP 7KH &RQVXOWDQW¶V WRWDO OLDELOLW\ WR &OLHQW VKDOO QRW H[FHHG WKH WRWDO DYDLODEOH LQVXUDQFH SROLF\ OLPLWV SHU FODLP DYDLODEOH WR &RQVXOWDQW XQGHU LWV SURIHVVLRQDO OLDELOLW\LQVXUDQFHSROLF\ &OLHQWKHUHE\DJUHHV WKDW WR WKH IXOOHVW H[WHQW SHUPLWWHG E\ ODZ WKH &RQVXOWDQW¶VWRWDOOLDELOLW\WR&OLHQWIRUDQ\DQGDOO LQMXULHV FODLPV ORVVHV H[SHQVHV RU GDPDJHV ZKDWVRHYHUDULVLQJRXWRIRULQDQ\ZD\UHODWHG WR RU DULVLQJ IURP WKLV $JUHHPHQW IURP DQ\ FDXVH RU FDXVHV LQFOXGLQJ EXW QRW OLPLWHG WR &RQVXOWDQW¶VQHJOLJHQFHHUURUVRPLVVLRQVVWULFW OLDELOLW\EUHDFKRIFRQWUDFWRUEUHDFKRIZDUUDQW\ &OLHQW¶V&ODLPV VKDOOQRWH[FHHGWKHWRWDOSROLF\ OLPLWV DYDLODEOH WR &RQVXOWDQW XQGHU LWV SURIHVVLRQDO OLDELOLW\ LQVXUDQFH SROLF\ IRU VHWWOHPHQW RU VDWLVIDFWLRQ RI &OLHQW¶V &ODLPV XQGHU WKH WHUPV DQG FRQGLWLRQV RI WKH &RQVXOWDQW¶V SURIHVVLRQDO OLDELOLW\ LQVXUDQFH SROLF\DSSOLFDEOHKHUHWR 1RWZLWKVWDQGLQJ WKH ODQJXDJH DERYH &OLHQW DJUHHVWKDWZLWKUHJDUGWRDQ\FODLPDULVLQJIURP RUUHODWLQJWR &RQVXOWDQW¶V SURYLVLRQ RI JHRWHFKQLFDO HQJLQHHULQJ VHUYLFHV FRQVWUXFWLRQ PDWHULDOV WHVWLQJ VSHFLDO LQVSHFWLRQV DQGRU HQYLURQPHQWDO HQJLQHHULQJ VHUYLFHV LQFOXGLQJ EXW QRW OLPLWHG WR HQYLURQPHQWDO VLWH DVVHVVPHQWV WKDW &RQVXOWDQW¶V OLDELOLW\ IRU DQ\ FODLPV DVVHUWHG E\ RU WKURXJK &OLHQW VKDOO EH OLPLWHGWR &OLHQW DQG &RQVXOWDQW HDFK IXUWKHU DJUHH WKDW QHLWKHU ZLOO EH UHVSRQVLEOH IRU DQ\ LQFLGHQWDO LQGLUHFW RU FRQVHTXHQWLDO GDPDJHV LQFOXGLQJ ORVVRIXVHRUORVVRISURILWV VXVWDLQHGE\WKH RWKHU LWV VXFFHVVRUV RU DVVLJQV  7KLV PXWXDO ZDLYHU VKDOO DSSO\ HYHQ LI WKH GDPDJHV ZHUH IRUHVHHDEOH DQG UHJDUGOHVV RI WKH WKHRU\ RI UHFRYHU\SOHDGRUDVVHUWHG $57,&/(±&21752//,1*/$: 7KLV$JUHHPHQWLVWREHJRYHUQHGE\WKHODZVRI WKH 6WDWH RI 0LQQHVRWD  $Q\ FRQWURYHUV\ RU FODLPDULVLQJRXWRIRUUHODWLQJWRWKLV$JUHHPHQW RUWKHEUHDFKWKHUHRILQFOXGLQJEXWQRWOLPLWHGWR FODLPVIRUQHJOLJHQFHRUEUHDFKRIZDUUDQW\WKDW LVQRWVHWWOHGE\QRQELQGLQJPHGLDWLRQVKDOOEH VHWWOHGE\WKHODZRIWKHVWDWHRI0LQQHVRWD $57,&/( ± /2&$7,21 2) 81'(5*5281',03529(0(176 :KHUH UHTXHVWHG E\ &OLHQW &RQVXOWDQW ZLOO SHUIRUP FXVWRPDU\ UHVHDUFK WR DVVLVW &OLHQW LQ ORFDWLQJ DQG LGHQWLI\LQJ VXEWHUUDQHDQ VWUXFWXUHV RUXWLOLWLHV+RZHYHU&RQVXOWDQWPD\UHDVRQDEO\ UHO\ RQ LQIRUPDWLRQ IURP WKH &OLHQW DQG LQIRUPDWLRQ SURYLGHG E\ ORFDO XWLOLWLHV UHODWHG WR VWUXFWXUHV RU XWLOLWLHV DQG ZLOO QRW EH OLDEOH IRU GDPDJHV LQFXUUHG ZKHUH &RQVXOWDQW KDV FRPSOLHGZLWKWKHVWDQGDUGRIFDUHDQGDFWHGLQ UHOLDQFHRQWKDWLQIRUPDWLRQ7KH&OLHQWDJUHHVWR ZDLYHDOOFODLPVDQGFDXVHVRIDFWLRQDJDLQVWWKH &RQVXOWDQWIRUFODLPVE\&OLHQWRULWVFRQWUDFWRUV UHODWLQJWRWKHLGHQWLILFDWLRQUHPRYDOUHORFDWLRQ RU UHVWRUDWLRQ RI XWLOLWLHV RU GDPDJHV WR XQGHUJURXQG LPSURYHPHQWV UHVXOWLQJ IURP VXEVXUIDFHSHQHWUDWLRQORFDWLRQVHVWDEOLVKHGE\ WKH&RQVXOWDQW G:\Group Data\Materials\Mark\PROPOSAL - MARKETING\Arden Hills - Royal Hills Park - Tennis Courts\Royal Hills Park - Pro.docx 540 GATEWAY BLVD | BURNSVILLE, MN | 55337 | 952.737.4660 | WSBENG.COM April 24, 2019 Sue Polka Interim Public Works Director/City Engineer City of Arden Hills 1245 West Highway 96 Arden Hills, MN 55112 Re: Proposal for: A Geotechnical Evaluation Royal Hills Park – Tennis Courts Arden Hills, Minnesota Thank you for the opportunity to provide professional services for a geotechnical evaluation for the above referenced project. This lump sum fee proposal is in response to the request for proposal email we received from Steve Foss with WSB. In this proposal, we present a description of our understanding of the project, an outline of the scope of work we are to provide, and a fee schedule and estimate of charges for our services. It is our understanding that this project consists of reconstruction of the tennis court located in Royal Hills Park in Arden Hills, Minnesota. We understand that the location and elevation of the tennis court will remain similar to existing conditions. We understand the City of Arden Hills (City) is considering full replacement of the pavement section including subgrade improvements, or reclamation of the pavement section. WSB is a professional consulting and design firm providing surveying, engineering (civil/site/environmental/geotechnical/transportation), landscape architecture, planning, environmental, and construction services. A. Project Objectives Based upon our experience with similar projects the objectives of our geotechnical services are to perform subsurface borings, classify and analyze the soil samples, discuss groundwater issues, and prepare recommendations for subgrade improvements and tennis court pavement sections. B. Scope of Basic Services Based on our understanding of the project we proposed the following scope of services: 1. Site Access Based on a review of the site from online aerial maps, it appears that the site can be accessed with our CME-55 truck mounted auger drill. It should be noted that access to the tennis courts may require driving across landscape areas, sidewalks, or curbs, and could cause rutting and tearing of sod, or cracking of concrete. Repair costs for these City of Arden Hills April 24, 2019 Page 2 G:\Group Data\Materials\Mark\PROPOSAL - MARKETING\Arden Hills - Royal Hills Park - Tennis Courts\Royal Hills Park - Pro.docx are not included in this proposal, and shall not be the responsibility of WSB. Removal of the fence to allow for access to the tennis courts will be by others. 2. Bore Hole Locating and Gopher State One Call WSB will stake the proposed bore hole locations using existing aerial maps and structures as guides. If approximate bore hole locations are not acceptable and more precise locations are required by the design team we recommend the use of GPS (Global Positioning System) technology to aid in staking the borings. The borings will not be elevated. Prior to sending a drill rig to the site WSB will contact Gopher State One Call (GSOC) and have them request public underground utility owners mark and clear our proposed bore hole locations of their utilities. If there are private underground utilities that are not located by GSOC, you must notify WSB immediately. WSB will take reasonable precautions to avoid underground facilities. 3. Subsurface Test Borings We propose to complete 2 standard penetration test borings to depths of 10 feet below grade. In the standard penetration test borings we will sample and record blow counts at 2½ foot intervals to the boreholes termination depth. If unsuitable soils (existing fill, organic soils, etc…) are encountered at the proposed boring termination depth(s), it will be necessary to extend the borings into more competent materials. This will allow us to better evaluate potential construction issues. An additional charge of $20 per lineal foot will be assessed for borings extended beyond their proposed termination depths. If the added work requires an additional mobilization to the site it will be charged at $500 per day. In Minnesota, a boring that is deeper than 15 feet is considered an environmental well and requires Well Sealing Notification and Sealing Records be submitted to the Minnesota Department of Health, along with a Notification fee. The borings are planned to depths of less than 15 feet, but if they are extended due to the presence of unsuitable soils at planned termination, than additional fees will be incurred. WSB will fill out the MDH notification and sealing record forms and sign on behalf of the owner unless directed otherwise. 4. Schedule, Bore Hole Samples and Laboratory Testing Based on our current drilling backlog, we anticipate that we can mobilize our truck mounted auger drill to the site in about 4 weeks from the time that written authorization is provided. Laboratory work and report preparation will take about 2 weeks following completion of the field work. It should be noted that this schedule may change based on timing of authorization, site conditions and other factors. Should our anticipated schedule change we will let you know. This estimate is based on work being completed during normal daylight business hours, Monday through Friday. Additional charges will apply to night or weekend drilling. Samples retrieved during drilling will be returned to our laboratory where they will be reviewed, classified using the Unified Soil Classification System (USCS) and logged under the direction of a geotechnical engineer. Select samples will be set aside for laboratory testing. We may perform routine laboratory tests on selected soil samples City of Arden Hills April 24, 2019 Page 3 G:\Group Data\Materials\Mark\PROPOSAL - MARKETING\Arden Hills - Royal Hills Park - Tennis Courts\Royal Hills Park - Pro.docx obtained from the exploration. This may include determinations of natural moisture content and unconfined compressive strength with a calibrated penetrometer if cohesive soils are encountered and gradations on select sand samples from the borings. Such tests will aid in determining soil classification and properties and potential behavior characteristics to help guide our recommendations. 5. Geotechnical Engineering Report Information gathered for this project will be used to prepare a geotechnical report. The report will summarize our findings and provide a discussion of subsurface soil and groundwater conditions encountered in our borings and how they may affect the proposed construction of tennis court pavements. The report will also provide estimates of ground water depths/elevations and a discussion of site grading and soils for use as structural fill and site fill. We will provide you and any identified members of your design/project team with a PDF copy of our geotechnical report. If requested, we will also provide you with an original hard copy. This geotechnical proposal is presented for engineering services to determine the structural properties of the soil at the specified site. It does not cover an environmental assessment of the site, or environmental testing of the soil or groundwater. 6. Fee Our lump sum fee is provided below. Services Estimated Cost 2 Standard Penetration Borings to about 10 foot depths, Mobilization/Demobilization, Project Management and Administration, Gopher State Utility Clearance, Soil Classification, Boring Logs, Laboratory Testing, Geotechnical Report, Consumables $2,950.00 LUMP SUM COST $2,950.00 If additional borings or deeper borings are needed, or if engineering and testing are requested beyond that necessary for preparation of our report (post-report consultation, report revision due to changes in tennis court design or location, specification review, or pre-construction meetings), the increase in our fees will be in accordance with the rates previously indicated or at the unit prices shown on the enclosed Rate Schedule for hourly services. If you have any questions regarding our scope of services or how they may be modified to meet your project needs please feel free to give us a call to discuss. City of Arden Hills April 24, 2019 Page 4 G:\Group Data\Materials\Mark\PROPOSAL - MARKETING\Arden Hills - Royal Hills Park - Tennis Courts\Royal Hills Park - Pro.docx C. Closure This letter represents our complete understanding of the proposed scope of services. If you are in agreement with the scope of services, proposed fee and attached General Contract Provisions please sign in the appropriate space below and return one copy to my attention. If you have any questions about this proposal, please feel free to call me at (952) 737-4660 or email at mosborn@wsbeng.com. This fee proposal is valid for ninety (90) days from the creation date noted in the header. WSB may reissue a revised Proposal upon request if the indicated time period has lapsed. Should the scope of work change in nature or be expanded to include additional services, we reserve the right to renegotiate the fees with you. However, once we begin work on this project any counteroffers will not be accepted. WSB appreciates the opportunity of being considered for this project and we look forward to providing our professional services to you. Sincerely, WSB Mark Osborn, PE Darin Hyatt, PE Geotechnical Project Engineer Senior Project Engineer Attachments: WSB 2019 Rate Schedule WSB Exhibit A General Contract Provisions 11.01.16 ACCEPTED BY: Name (print) _______________________ Signature _______________________________ Company _______________________________ Title Date 5DWH6FKHGXOH :6%(1*&20      %LOOLQJ5DWH+RXU  35,1&,3$/    $662&,$7(_65352-(&70$1$*(5_65352-(&7(1*,1((5    352-(&70$1$*(5    352-(&7(1*,1((5    *5$'8$7((1*,1((5    65/$1'6&$3($5&+,7(&7_653/$11(5_65*,663(&,$/,67    /$1'6&$3($5&+,7(&7_3/$11(5_*,663(&,$/,67    (1*,1((5,1*63(&,$/,67_65(19,5210(17$/6&,(17,67    (1*,1((5,1*7(&+1,&,$1_(19,5210(17$/6&,(17,67    &216758&7,212%6(59(5    6859(< 2QH3HUVRQ&UHZ 7ZR3HUVRQ&UHZ 7KUHH3HUVRQ&UHZ  2)),&(7(&+1,&,$1    &RVWVDVVRFLDWHGZLWKZRUGSURFHVVLQJFHOOSKRQHVUHSURGXFWLRQRIFRPPRQFRUUHVSRQGHQFHDQGPDLOLQJDUHLQFOXGHGLQWKH DERYHKRXUO\UDWHV9HKLFOHPLOHDJHLVLQFOXGHGLQRXUELOOLQJUDWHV>H[FOXGLQJJHRWHFKQLFDODQGFRQVWUXFWLRQPDWHULDOVWHVWLQJ &07  VHUYLFHUDWHV@0LOHDJHFDQEHFKDUJHGVHSDUDWHO\LIVSHFLILFDOO\RXWOLQHGE\FRQWUDFW_5HLPEXUVDEOHH[SHQVHVLQFOXGHFRVWVDVVR FLDWHGZLWKSODQVSHFLILFDWLRQDQGUHSRUWUHSURGXFWLRQSHUPLWIHHVGHOLYHU\FRVWVHWF_0XOWLSOHUDWHVLOOXVWUDWHWKHYDU\LQJOHYHOVRI H[SHULHQFHZLWKLQHDFKFDWHJRU\_5DWH6FKHGXOHLVDGMXVWHGDQQXDOO\ ([KLELW$±*HQHUDO&RQWUDFW3URYLVLRQV 3DJH :6% $662&,$7(6,1& (;+,%,7$ *(1(5$/&2175$&73529,6,216 $57,&/(±3(5)250$1&(2)7+(:25. &RQVXOWDQWVKDOOSHUIRUPWKHVHUYLFHVXQGHUWKLV $JUHHPHQWLQDFFRUGDQFHZLWKWKHFDUHDQGVNLOO RUGLQDULO\H[HUFLVHGE\PHPEHUVRI&RQVXOWDQW ¶V SURIHVVLRQ SUDFWLFLQJ XQGHU VLPLODU FLUFXPVWDQFHVDWWKHVDPHWLPHDQGLQWKHVDPH ORFDOLW\ &RQVXOWDQW PDNHV QR ZDUUDQWLHV H[SUHVV RU LPSOLHG XQGHU WKLV $JUHHPHQW RU RWKHUZLVHLQFRQQHFWLRQZLWKLWVVHUYLFHV $57,&/(±$'',7,21$/6(59,&(6 ,IWKH&OLHQWUHTXHVWVWKDWWKH&RQVXOWDQWSHUIRUP DQ\VHUYLFHVZKLFKDUHEH\RQGWKHVFRSHDVVHW IRUWK LQ WKH $JUHHPHQW RU LI FKDQJHG RU XQIRUHVHHQFRQGLWLRQVUHTXLUHWKH&RQVXOWDQWWR SHUIRUP VHUYLFHV RXWVLGH RI WKH RULJLQDO VFRSH WKHQ&RQVXOWDQWVKDOOSURPSWO\QRWLI\WKH&OLHQW RI FDXVH DQG QDWXUH RI WKH DGGLWLRQDO VHUYLFHV UHTXLUHG8SRQQRWLILFDWLRQ&RQVXOWDQWVKDOOEH HQWLWOHG WR DQ HTXLWDEOH DGMXVWPHQW LQ ERWK FRPSHQVDWLRQDQGWLPHWRSHUIRUP $57,&/(±6&+('8/( 8QOHVV VSHFLILF SHULRGV RI WLPH RU GDWHV IRU SURYLGLQJ VHUYLFHV DUH VSHFLILHG LQ D VHSDUDWH ([KLELW &RQVXOWDQW¶V REOLJDWLRQ WR UHQGHU VHUYLFHV KHUHXQGHU ZLOO EH IRU D SHULRG ZKLFK PD\UHDVRQDEO\EHUHTXLUHGIRUWKHFRPSOHWLRQ RI VDLG VHUYLFHV  7KH &OLHQW DJUHHV WKDW &RQVXOWDQW LV QRW UHVSRQVLEOH IRU GDPDJHV DULVLQJGLUHFWO\RULQGLUHFWO\IURPDQ\GHOD\VIRU FDXVHV EH\RQG &RQVXOWDQW¶V FRQWURO  )RU SXUSRVHV RI WKLV $JUHHPHQW VXFK FDXVHV LQFOXGH EXW DUH QRW OLPLWHG WR VWULNHV RU RWKHU ODERU GLVSXWHV VHYHUH ZHDWKHU GLVUXSWLRQV RU RWKHU QDWXUDO GLVDVWHUV RU DFWV RI *RG ILUHV ULRWV ZDU RU RWKHU HPHUJHQFLHV DQ\ DFWLRQ RU IDLOXUH WR DFW LQ D WLPHO\ PDQQHU E\ DQ\ JRYHUQPHQWDJHQF\DFWLRQVRUIDLOXUHWRDFWE\ WKH &OLHQW RU WKH &OLHQW¶V FRQWUDFWRU RU FRQVXOWDQWV RU GLVFRYHU\ RI DQ\ KD]DUGRXV VXEVWDQFH RU GLIIHULQJ VLWH FRQGLWLRQV ,I WKH GHOD\VRXWVLGHRI&RQVXOWDQW¶VFRQWUROLQFUHDVH WKH FRVW RU WKH WLPH UHTXLUHG E\ &RQVXOWDQW WR SHUIRUP LWV VHUYLFHV LQ DFFRUGDQFH ZLWK SURIHVVLRQDOVNLOODQGFDUHWKHQ&RQVXOWDQWVKDOO EH HQWLWOHG WR D UHDVRQDEOH DGMXVWPHQW LQ VFKHGXOHDQGFRPSHQVDWLRQ $57,&/(±&216758&7,21 2%6(59$7,21 ,IUHTXHVWHGE\&OLHQW&RQVXOWDQWVKDOOYLVLWWKH SURMHFW GXULQJ FRQVWUXFWLRQ WR EHFRPH IDPLOLDU ZLWKWKHSURJUHVVDQGTXDOLW\RIWKHFRQWUDFWRUV¶ ZRUNDQGWRGHWHUPLQHLIWKHZRUNLVSURFHHGLQJ LQ JHQHUDO LQ DFFRUGDQFH ZLWK SODQV VSHFLILFDWLRQV RU RWKHU FRQWUDFW GRFXPHQWV SUHSDUHG E\ &RQVXOWDQW IRU WKH &OLHQW  7KH &OLHQWKDVQRWUHWDLQHGWKH&RQVXOWDQWWRPDNH GHWDLOHGLQVSHFWLRQVRUWRSURYLGHH[KDXVWLYHRU FRQWLQXRXV SURMHFW UHYLHZ DQG REVHUYDWLRQ VHUYLFHV &RQVXOWDQWQHLWKHUJXDUDQWHHVWKHSHUIRUPDQFH RI DQ\ &RQWUDFWRU UHWDLQHG E\ &OLHQW QRU DVVXPHV UHVSRQVLELOLW\ IRU DQ\ &RQWUDFWRU¶V IDLOXUH WR IXUQLVK DQG SHUIRUP WKH ZRUN LQ DFFRUGDQFH ZLWK WKH FRQVWUXFWLRQ GRFXPHQWV &OLHQW DFNQRZOHGJHV &RQVXOWDQW ZLOO QRW GLUHFW VXSHUYLVHRUFRQWUROWKH ZRUNRIFRQWUDFWRUVRU WKHLUVXEFRQWUDFWRUVQRUVKDOO &RQVXOWDQWKDYH DXWKRULW\ RYHU RU UHVSRQVLELOLW\ IRU WKH FRQWUDFWRUV¶PHDQVPHWKRGVRUSURFHGXUHVRI FRQVWUXFWLRQ &RQVXOWDQW¶V VHUYLFHV GR QRW LQFOXGH UHYLHZ RU HYDOXDWLRQ RI WKH &OLHQW¶V FRQWUDFWRU¶VRUVXEFRQWUDFWRU¶VVDIHW\PHDVXUHV RUMREVLWHVDIHW\-RE6LWH6DIHW\VKDOOEHWKH VROH UHVSRQVLELOLW\ RI WKH FRQWUDFWRU ZKR LV SHUIRUPLQJWKHZRUN )RU &OLHQWREVHUYHG SURMHFWV WKH &RQVXOWDQW VKDOO EH HQWLWOHG WR UHO\ XSRQ DQG DFFHSW UHSUHVHQWDWLRQVRIWKH&OLHQW¶VREVHUYHU,IWKH &OLHQW GHVLUHV PRUH H[WHQVLYH SURMHFW REVHUYDWLRQ RU IXOOWLPH SURMHFW UHSUHVHQWDWLRQ WKH &OLHQW VKDOO UHTXHVW VXFK VHUYLFHV EH SURYLGHG E\ WKH &RQVXOWDQW DV DQ $GGLWLRQDO 6HUYLFH&RQVXOWDQWDQG&OLHQWVKDOOWKHQHQWHU LQWR D 6XSSOHPHQWDO $JUHHPHQW GHWDLOLQJ WKH WHUPV DQG FRQGLWLRQV RI WKH UHTXHVWHG SURMHFW REVHUYDWLRQ $57,&/( ± 23,1,216 2) 352%$%/( &267 2SLQLRQVLIDQ\RISUREDEOHFRVWFRQVWUXFWLRQ FRVW ILQDQFLDO HYDOXDWLRQV IHDVLELOLW\ VWXGLHV HFRQRPLF DQDO\VHV RI DOWHUQDWH VROXWLRQV DQG XWLOLWDULDQ FRQVLGHUDWLRQV RI RSHUDWLRQV DQG PDLQWHQDQFH FRVWV FROOHFWLYHO\ UHIHUUHG WR DV ³&RVW(VWLPDWHV´SURYLGHGIRUDUHPDGHRUWREH PDGH RQ WKH EDVLV RI WKH &RQVXOWDQW V H[SHULHQFHDQGTXDOLILFDWLRQVDQGUHSUHVHQWWKH &RQVXOWDQW V EHVW MXGJPHQW DV DQ H[SHULHQFHG DQG TXDOLILHG SURIHVVLRQDO GHVLJQ ILUP  7KH SDUWLHV DFNQRZOHGJH KRZHYHU WKDW WKH &RQVXOWDQWGRHVQRWKDYHFRQWURORYHUWKHFRVW ([KLELW$±*HQHUDO&RQWUDFW3URYLVLRQV 3DJH RI ODERU PDWHULDO HTXLSPHQW RU VHUYLFHV IXUQLVKHGE\RWKHUVRURYHUPDUNHWFRQGLWLRQVRU FRQWUDFWRU VPHWKRGVRIGHWHUPLQLQJWKHLUSULFHV DQG DQ\ HYDOXDWLRQ RI DQ\ IDFLOLW\ WR EH FRQVWUXFWHG RU DFTXLUHG RU ZRUN WR EH SHUIRUPHG PXVW RI QHFHVVLW\ EH YLHZHG DV VLPSO\SUHOLPLQDU\$FFRUGLQJO\WKH&RQVXOWDQW DQG &OLHQW DJUHH WKDW WKH SURSRVDOV ELGV RU DFWXDOFRVWVPD\YDU\IURPRSLQLRQVHYDOXDWLRQV RUVWXGLHVVXEPLWWHGE\WKH&RQVXOWDQWDQGWKDW &RQVXOWDQW DVVXPHV QR UHVSRQVLELOLW\ IRU WKH DFFXUDF\ RI RSLQLRQV RI &RVW (VWLPDWHV DQG &OLHQWH[SUHVVO\ZDLYHVDQ\FODLPVUHODWHGWRWKH DFFXUDF\RIRSLQLRQVRI&RVW(VWLPDWHV,I&OLHQW ZLVKHVJUHDWHUDVVXUDQFHDVWR&RVW(VWLPDWHV &OLHQW VKDOO HPSOR\ DQ LQGHSHQGHQW FRVW HVWLPDWRUDVSDUWRILWV3URMHFWUHVSRQVLELOLWLHV $57,&/(±5(86($1'',6326,7,212) ,167580(1762)6(59,&( $OO GRFXPHQWV LQFOXGLQJ UHSRUWV GUDZLQJV FDOFXODWLRQV VSHFLILFDWLRQV &$'' PDWHULDOV FRPSXWHUVVRIWZDUH RUKDUGZDUHRU RWKHU ZRUN SURGXFWSUHSDUHGE\&RQVXOWDQWSXUVXDQWWRWKLV $JUHHPHQW DUH &RQVXOWDQW¶V ,QVWUXPHQWV RI 6HUYLFH DQG &RQVXOWDQW UHWDLQV DOO RZQHUVKLS LQWHUHVWV LQ ,QVWUXPHQWV RI 6HUYLFH LQFOXGLQJ FRS\ULJKWV7KH,QVWUXPHQWVRI6HUYLFHDUHQRW LQWHQGHGRUUHSUHVHQWHGWREHVXLWDEOHIRUUHXVH E\ WKH &OLHQW RU RWKHUV RQ H[WHQVLRQV RI WKH 3URMHFW RU RQ DQ\ RWKHU SURMHFW  &RSLHV RI GRFXPHQWVWKDWPD\EHUHOLHGXSRQE\&OLHQWDUH OLPLWHGWRWKHSULQWHGFRSLHV DOVRNQRZQDVKDUG FRSLHV WKDWDUHVLJQHGRUVHDOHGE\&RQVXOWDQW )LOHVLQHOHFWURQLFIRUPDWIXUQLVKHGWR&OLHQWDUH RQO\IRUFRQYHQLHQFHRI&OLHQW$Q\FRQFOXVLRQRU LQIRUPDWLRQ REWDLQHG RU GHULYHG IURP VXFK HOHFWURQLF ILOHV ZLOO EH DW WKH XVHU¶V VROH ULVN &RQVXOWDQWPDNHVQRUHSUHVHQWDWLRQVDVWRORQJ WHUP FRPSDWLELOLW\ XVDELOLW\ RU UHDGDELOLW\ RI HOHFWURQLFILOHV ,I UHTXHVWHG DW WKH WLPH RI FRPSOHWLRQ RU WHUPLQDWLRQ RI WKH ZRUN WKH &RQVXOWDQW PD\ PDNHDYDLODEOHWRWKH&OLHQWWKH,QVWUXPHQWVRI 6HUYLFH XSRQ L SD\PHQW RIDPRXQWVGXH DQG RZLQJ IRU ZRUN SHUIRUPHG DQG H[SHQVHV LQFXUUHGWRWKHGDWHDQGWLPHRIWHUPLQDWLRQDQG LL  IXOILOOPHQW RI WKH &OLHQW¶V REOLJDWLRQV XQGHU WKLV$JUHHPHQW$Q\XVHRUUHXVHRIVXFK ,QVWUXPHQWV RI 6HUYLFH E\ WKH &OLHQW RU RWKHUV ZLWKRXW ZULWWHQ FRQVHQW YHULILFDWLRQ RU DGDSWDWLRQ E\ WKH &RQVXOWDQW H[FHSW IRU WKH VSHFLILFSXUSRVHLQWHQGHGZLOOEHDWWKH&OLHQW¶V ULVN DQG IXOO OHJDO UHVSRQVLELOLW\ DQG &OLHQW H[SUHVVO\UHOHDVHVDOOFODLPVDJDLQVW&RQVXOWDQW DULVLQJIURPUHXVHRIWKH,QVWUXPHQWVRI6HUYLFH ZLWKRXW&RQVXOWDQW¶VZULWWHQFRQVHQWYHULILFDWLRQ RUDGDSWDWLRQ 7KH&OLHQWZLOOWRWKHIXOOHVWH[WHQWSHUPLWWHGE\ ODZLQGHPQLI\DQGKROGWKH&RQVXOWDQWKDUPOHVV IURP DQ\ FODLP OLDELOLW\ RU FRVW LQFOXGLQJ UHDVRQDEOHDWWRUQH\V IHHVDQGGHIHQVHFRVWV  DULVLQJ RU DOOHJHGO\ DULVLQJ RXW RI DQ\ XQDXWKRUL]HG UHXVH RU PRGLILFDWLRQ RI WKHVH ,QVWUXPHQWV RI 6HUYLFH E\ WKH &OLHQW RU DQ\ SHUVRQ RU HQWLW\ WKDW DFTXLUHV RU REWDLQV WKH UHSRUWVSODQVDQGVSHFLILFDWLRQVIURPRUWKURXJK WKH&OLHQWZLWKRXWWKHZULWWHQDXWKRUL]DWLRQRIWKH &RQVXOWDQW  8QGHU QR FLUFXPVWDQFHV VKDOO WUDQVIHURI,QVWUXPHQWVRI6HUYLFHEHGHHPHGD VDOH E\ &RQVXOWDQW DQG &RQVXOWDQW PDNHV QR ZDUUDQWLHV HLWKHU H[SUHVVHG RU LPSOLHG RI PHUFKDQWDELOLW\ DQG ILWQHVV IRU DQ\ SDUWLFXODU SXUSRVH  &RQVXOWDQW VKDOO EH HQWLWOHG WR FRPSHQVDWLRQ IRU DQ\ FRQVHQW YHULILFDWLRQ RU DGDSWLRQ RI WKH ,QVWUXPHQWV RI 6HUYLFH IRU H[WHQVLRQVRIWKH3URMHFWRUDQ\RWKHUSURMHFW $57,&/(±3$<0(176 3D\PHQWWR&RQVXOWDQWVKDOOEHRQDOXPSVXP RU KRXUO\ EDVLV DV VHW RXW LQ WKH $JUHHPHQW &RQVXOWDQW LV HQWLWOHG WR SD\PHQW RI DPRXQWV GXHSOXVUHLPEXUVDEOHH[SHQVHV&OLHQWZLOOSD\ WKHEDODQFHVWDWHGRQWKHLQYRLFHXQOHVV&OLHQW QRWLILHV &RQVXOWDQW LQ ZULWLQJ RI DQ\ GLVSXWHG LWHPV ZLWKLQ ILIWHHQ   GD\V IURP WKH GDWH RI LQYRLFH,QWKHHYHQWRIDQ\GLVSXWH&OLHQWZLOO SD\ DOO XQGLVSXWHG DPRXQWV LQ WKH RUGLQDU\ FRXUVHDQGWKH3DUWLHVZLOOHQGHDYRUWRUHVROYH DOO GLVSXWHG LWHPV  $OO DFFRXQWV XQSDLG DIWHU WKLUW\  GD\VIURPWKHGDWHRIRULJLQDOLQYRLFH VKDOOEHVXEMHFWWRDVHUYLFHFKDUJHRI SHUPRQWKRUWKHPD[LPXPDPRXQWDXWKRUL]HG E\ ODZ ZKLFKHYHU LV OHVV &RQVXOWDQW UHVHUYHV WKHULJKWWRUHWDLQLQVWUXPHQWVRIVHUYLFHXQWLODOO LQYRLFHVDUHSDLGLQIXOO&RQVXOWDQWZLOOQRWEH OLDEOHIRUDQ\FODLPVRIORVVGHOD\RUGDPDJHE\ &OLHQW IRU UHDVRQ RI ZLWKKROGLQJ VHUYLFHV RU LQVWUXPHQWVRIVHUYLFHXQWLODOOLQYRLFHVDUHSDLG LQIXOO&RQVXOWDQWVKDOOEHHQWLWOHGWRUHFRYHUDOO UHDVRQDEOH FRVWV DQG GLVEXUVHPHQWV LQFOXGLQJ UHDVRQDEOHDWWRUQH\IHHVLQFXUUHGLQFRQQHFWLRQ ZLWK FROOHFWLQJ DPRXQWV RZHG E\ &OLHQW  ,Q DGGLWLRQ&RQVXOWDQWPD\DIWHUJLYLQJVHYHQ   GD\V¶ZULWWHQQRWLFHWR&OLHQWVXVSHQGVHUYLFHV XQGHU WKLV $JUHHPHQW XQWLO LW UHFHLYHV IXOO SD\PHQWIRUDOODPRXQWVWKHQGXHIRUVHUYLFHV H[SHQVHV DQG FKDUJHV 3D\PHQW PHWKRGV H[SHQVHVDQGUDWHVPD\EHPRUHIXOO\GHVFULEHG LQ([KLELW&DQG([KLELW( ([KLELW$±*HQHUDO&RQWUDFW3URYLVLRQV 3DJH $57,&/( ± 68%0,77$/6 $1' 3$< $33/,&$7,216 ,I WKH 6FRSH RI :RUN LQFOXGHV WKH &RQVXOWDQW UHYLHZLQJ DQG FHUWLI\LQJ WKH DPRXQWV GXH WKH &RQWUDFWRU WKH &RQVXOWDQW¶V FHUWLILFDWLRQ IRU SD\PHQWVKDOOFRQVWLWXWHDUHSUHVHQWDWLRQWRWKH &OLHQW WKDW WR WKH EHVW RI WKH &RQVXOWDQW¶V NQRZOHGJHLQIRUPDWLRQDQGEHOLHIWKH:RUNKDV SURJUHVVHG WR WKH SRLQW LQGLFDWHG DQG WKDW WKH TXDOLW\RIWKH:RUNLVLQJHQHUDODFFRUGDQFHZLWK WKH 'RFXPHQWV LVVXHG E\ WKH &RQVXOWDQW 7KH LVVXDQFHRID&HUWLILFDWHIRU3D\PHQWVKDOOQRW EHDUHSUHVHQWDWLRQWKDWWKH&RQVXOWDQWKDV   PDGH H[KDXVWLYH RU FRQWLQXRXV RQVLWH LQVSHFWLRQVWRFKHFNWKHTXDOLW\RUTXDQWLW\RIWKH :RUN   UHYLHZHG FRQVWUXFWLRQ PHDQV PHWKRGVWHFKQLTXHVVHTXHQFHVRUSURFHGXUHV  UHYLHZHGFRSLHVRIUHTXLVLWLRQVUHFHLYHGIURP 6XEFRQWUDFWRUVDQGPDWHULDOVXSSOLHUVDQGRWKHU GDWDUHTXHVWHGE\WKH&OLHQWWRVXEVWDQWLDWHWKH &RQWUDFWRU¶VULJKWWRSD\PHQWRU  DVFHUWDLQHG KRZ RU IRU ZKDW SXUSRVH WKH &RQWUDFWRU KDV XVHGPRQH\SUHYLRXVO\SDLGRQDFFRXQWRIWKH &RQWUDFW 6XP  &RQWUDFWRU VKDOO UHPDLQ H[FOXVLYHO\UHVSRQVLEOHIRULWV:RUN ,I WKH 6FRSH RI :RUN LQFOXGHV &RQVXOWDQW¶V UHYLHZ DQG DSSURYDO RI VXEPLWWDOV IURP WKH &RQWUDFWRUVXFKUHYLHZVKDOOEHIRUWKHOLPLWHG SXUSRVH RI FKHFNLQJ IRU FRQIRUPDQFH ZLWK WKH LQIRUPDWLRQJLYHQDQGWKHGHVLJQFRQFHSW7KH UHYLHZRIVXEPLWWDOVLVQRWLQWHQGHGWRGHWHUPLQH WKHDFFXUDF\RIDOOFRPSRQHQWVWKHDFFXUDF\RI WKH TXDQWLWLHV RU GLPHQVLRQV RU WKH VDIHW\ SURFHGXUHV PHDQV RU PHWKRGV WR EH XVHG LQ FRQVWUXFWLRQ DQG WKRVH UHVSRQVLELOLWLHV UHPDLQ H[FOXVLYHO\ZLWKWKH&OLHQW¶VFRQWUDFWRU $57,&/(±+$=$5'2860$7(5,$/6 1RWZLWKVWDQGLQJ WKH 6FRSH RI 6HUYLFHV WR EH SURYLGHG SXUVXDQW WR WKLV $JUHHPHQW LW LV XQGHUVWRRGDQGDJUHHGWKDW&RQVXOWDQWLVQRWD XVHU KDQGOHU JHQHUDWRU RSHUDWRU WUHDWHU DUUDQJHU VWRUHU WUDQVSRUWHU RU GLVSRVHU RI KD]DUGRXV RU WR[LF VXEVWDQFHV SROOXWDQWV RU FRQWDPLQDQWVDVDQ\RIWKHIRUHJRLQJLWHPVDUH GHILQHGE\)HGHUDO6WDWHDQGRUORFDOODZUXOHV RU UHJXODWLRQV QRZ H[LVWLQJ RU KHUHDIWHU DPHQGHGDQGZKLFKPD\EHIRXQGRULGHQWLILHG RQ DQ\ 3URMHFW ZKLFK LV XQGHUWDNHQ E\ &RQVXOWDQW 7KH&OLHQWDJUHHVWRLQGHPQLI\&RQVXOWDQWDQG LWV RIILFHUV VXEFRQVXOWDQW V  HPSOR\HHV DQG DJHQWV IURP DQG DJDLQVW DQ\ DQG DOO FODLPV ORVVHV GDPDJHV OLDELOLW\ DQG FRVWV LQFOXGLQJ EXWQRWOLPLWHGWRFRVWVRIGHIHQVHDULVLQJRXWRI RU LQ DQ\ ZD\ FRQQHFWHG ZLWK WKH SUHVHQFH GLVFKDUJH UHOHDVH RU HVFDSH RI KD]DUGRXV RU WR[LFVXEVWDQFHVSROOXWDQWVRUFRQWDPLQDQWVRI DQ\NLQGH[FHSWWKDWWKLVFODXVHVKDOOQRWDSSO\ WRVXFKOLDELOLW\DVPD\DULVHRXWRI&RQVXOWDQW¶V VROHQHJOLJHQFHLQWKHSHUIRUPDQFHRIVHUYLFHV XQGHUWKLV$JUHHPHQWDULVLQJIURPRUUHODWLQJWR KD]DUGRXV RU WR[LF VXEVWDQFHV SROOXWDQWV RU FRQWDPLQDQWVVSHFLILFDOO\LGHQWLILHGE\WKH&OLHQW DQGLQFOXGHGZLWKLQ&RQVXOWDQW¶VVHUYLFHVWREH SURYLGHGXQGHUWKLV$JUHHPHQW $57,&/(±,1685$1&( &RQVXOWDQW KDV SURFXUHG JHQHUDO DQG SURIHVVLRQDO OLDELOLW\ LQVXUDQFH  2Q UHTXHVW &RQVXOWDQWZLOOIXUQLVKFOLHQWZLWKDFHUWLILFDWHRI LQVXUDQFHGHWDLOLQJWKHSUHFLVHQDWXUHDQGW\SH RILQVXUDQFHDORQJZLWKDSSOLFDEOHSROLF\OLPLWV $GGLWLRQDO ,QVXUDQFH UHTXLUHPHQWV DUH OLVWHG LQ ([KLELW' $57,&/( ±7(50,1$7,2125 6863(16,21 ,I &RQVXOWDQW¶V VHUYLFHV DUH GHOD\HG RU VXVSHQGHG LQ ZKROH RU LQ SDUW E\ &OLHQW RU LI &RQVXOWDQW¶VVHUYLFHVDUHGHOD\HGE\DFWLRQVRU LQDFWLRQVRIRWKHUVIRUPRUHWKDQVL[W\  GD\V WKURXJKQRIDXOWRI&RQVXOWDQW&RQVXOWDQWVKDOO EH HQWLWOHG WR HLWKHU WHUPLQDWH LWV DJUHHPHQW XSRQ VHYHQ   GD\V ZULWWHQ QRWLFH RU DW LWV RSWLRQDFFHSWDQHTXLWDEOHDGMXVWPHQWRIUDWHV DQG DPRXQWV RI FRPSHQVDWLRQ SURYLGHG IRU HOVHZKHUH LQ WKLV $JUHHPHQW WR UHIOHFW UHDVRQDEOH FRVWV LQFXUUHG E\ &RQVXOWDQW LQ FRQQHFWLRQZLWKDPRQJRWKHUWKLQJVVXFKGHOD\ RUVXVSHQVLRQDQGUHDFWLYDWLRQDQGWKHIDFWWKDW WKHWLPHIRUSHUIRUPDQFHXQGHUWKLV$JUHHPHQW KDVEHHQUHYLVHG 7KLV $JUHHPHQW PD\ EH WHUPLQDWHG E\ HLWKHU SDUW\XSRQVHYHQ  GD\VZULWWHQQRWLFHVKRXOG WKH RWKHU SDUW\ IDLO VXEVWDQWLDOO\ WR SHUIRUP LQ DFFRUGDQFHZLWKLWVWHUPVWKURXJKQRIDXOWRIWKH SDUW\ LQLWLDWLQJ WKH WHUPLQDWLRQ ,Q WKH HYHQW RI WHUPLQDWLRQ&RQVXOWDQWVKDOOEHFRPSHQVDWHGIRU VHUYLFHV SHUIRUPHG SULRU WR WHUPLQDWLRQ GDWH LQFOXGLQJFKDUJHVIRUH[SHQVHVDQGHTXLSPHQW FRVWVWKHQGXHDQGDOOWHUPLQDWLRQH[SHQVHV 7KLV $JUHHPHQW PD\ EH WHUPLQDWHG E\ HLWKHU SDUW\XSRQWKLUW\  GD\V¶ZULWWHQQRWLFHZLWKRXW FDXVH&RQVXOWDQWVKDOOXSRQWHUPLQDWLRQRQO\EH HQWLWOHGWRSD\PHQWIRUWKHZRUNSHUIRUPHGXSWR WKH 'DWH RI WHUPLQDWLRQ  ,Q WKH HYHQW RI WHUPLQDWLRQ FRSLHV RI SODQV UHSRUWV VSHFLILFDWLRQV HOHFWURQLF GUDZLQJGDWD ILOHV &$'' ILHOGGDWDQRWHVDQGRWKHUGRFXPHQWV ZKHWKHU ZULWWHQ SULQWHG RU UHFRUGHG RQ DQ\ PHGLXP ZKDWVRHYHU ILQLVKHG RU XQILQLVKHG ([KLELW$±*HQHUDO&RQWUDFW3URYLVLRQV 3DJH SUHSDUHG E\ WKH &RQVXOWDQW SXUVXDQW WR WKLV $JUHHPHQWDQGSHUWDLQLQJWRWKHZRUNRUWRWKH 3URMHFW KHUHLQDIWHU ,QVWUXPHQWV RI 6HUYLFH  VKDOO EH PDGH DYDLODEOH WR WKH &OLHQW XSRQ SD\PHQW RI DOO DPRXQWV GXH DV RI WKH GDWH RI WHUPLQDWLRQ  $OO SURYLVLRQV RI WKLV $JUHHPHQW DOORFDWLQJ UHVSRQVLELOLW\ RU OLDELOLW\ EHWZHHQ WKH &OLHQW DQG &RQVXOWDQW VKDOO VXUYLYH WKH FRPSOHWLRQRIWKHVHUYLFHVKHUHXQGHUDQGRUWKH WHUPLQDWLRQRIWKLV$JUHHPHQW $57,&/(±,1'(01,),&$7,21 7KH&RQVXOWDQWDJUHHVWRLQGHPQLI\DQGKROGWKH &OLHQW KDUPOHVV IURP DQ\ GDPDJH OLDELOLW\ RU FRVW WR WKH H[WHQW FDXVHG E\ WKH &RQVXOWDQW ¶V QHJOLJHQFHRUZLOOIXOPLVFRQGXFW 7KH &OLHQW DJUHHV WR LQGHPQLI\ DQG KROG WKH &RQVXOWDQWKDUPOHVVIURPDQ\GDPDJHOLDELOLW\ RU FRVW WR WKH H[WHQW FDXVHG E\ WKH &OLHQW¶V QHJOLJHQFHRUZLOOIXOPLVFRQGXFW $57,&/(±:$,9(52)&216(48(17,$/ '$0$*(6 7KH&RQVXOWDQWDQG&OLHQWZDLYHFODLPVDJDLQVW HDFK RWKHU IRU FRQVHTXHQWLDO GDPDJHV DULVLQJ RXWRIRUUHODWLQJWRWKLVFRQWUDFW7KLVPXWXDO ZDLYHULQFOXGHVGDPDJHVLQFXUUHGE\WKH&OLHQW IRU UHQWDO H[SHQVHV IRU ORVV RI XVH ORVV RI LQFRPH ORVW SURILW SURMHFW GHOD\V ILQDQFLQJ EXVLQHVV DQG UHSXWDWLRQ DQG IRU ORVV RI PDQDJHPHQWRUHPSOR\HHSURGXFWLYLW\RURIWKH VHUYLFHV RI VXFK SHUVRQV DQG   'DPDJHV LQFXUUHG E\ WKH &RQVXOWDQW IRU SULQFLSDO RIILFH H[SHQVHV LQFOXGLQJ WKH FRPSHQVDWLRQ IRU SHUVRQQHO VWDWLRQHG WKHUH IRU ORVVHV RI ILQDQFLQJEXVLQHVVDQGUHSXWDWLRQDQGIRUORVV RISURILWH[FHSWDQWLFLSDWHGSURILWDULVLQJGLUHFWO\ IURP WKH :RUN  7KH &RQVXOWDQW DQG &OLHQW IXUWKHU DJUHH WR REWDLQ D VLPLODU ZDLYHU IURP HDFK RI WKHLU FRQWUDFWRUV VXEFRQWUDFWRUV RU VXSSOLHUV $57,&/( ±:$,9(52)&/$,06)25 3(5621$//,$%,/,7< ,WLVLQWHQGHGE\WKHSDUWLHVWRWKLV$JUHHPHQW WKDW &RQVXOWDQW¶V VHUYLFHV VKDOO QRW VXEMHFW &RQVXOWDQW¶VHPSOR\HHVRIILFHUVRUGLUHFWRUVWR DQ\ SHUVRQDO OHJDO H[SRVXUH IRU WKH ULVNV DVVRFLDWHGZLWKWKLV$JUHHPHQW7KHUHIRUHDQG QRWZLWKVWDQGLQJ DQ\WKLQJ WR WKH FRQWUDU\ FRQWDLQHGKHUHLQWKH&OLHQWDJUHHVWKDWDVWKH &OLHQW¶VVROHDQGH[FOXVLYHUHPHG\DQ \ FODLP GHPDQGRUVXLWVKDOOEHGLUHFWHGDQGRUDVVHUWHG RQO\DJDLQVW&RQVXOWDQWDQGQRWDJDLQVWDQ\RI &RQVXOWDQW¶V LQGLYLGXDO HPSOR\HHV RIILFHUV RU GLUHFWRUV $57,&/(±$66,*10(17 1HLWKHU3DUW\WRWKLV$JUHHPHQWVKDOODVVLJQLWV LQWHUHVW LQ WKLV DJUHHPHQW DQ\ SURFHHGV GXH XQGHUWKH$JUHHPHQWQRU DQ\FODLPVWKDWPD\ DULVHIURPVHUYLFHVRUSD\PHQWVGXHXQGHUWKH $JUHHPHQW ZLWKRXW WKH ZULWWHQ FRQVHQW RI WKH RWKHU3DUW\$Q\DVVLJQPHQWLQYLRODWLRQRIWKLV SURYLVLRQ VKDOO EH QXOO DQG YRLG  1RWKLQJ FRQWDLQHG LQ WKLV $JUHHPHQW VKDOO FUHDWH D FRQWUDFWXDOUHODWLRQVKLSZLWKRUDFDXVHRIDFWLRQ LQ IDYRU RI D WKLUG SDUW\ DJDLQVW HLWKHU WKH &RQVXOWDQWRU&OLHQW7KLV$JUHHPHQWLVIRUWKH H[FOXVLYH EHQHILW RI &RQVXOWDQW DQG &OLHQW DQG WKHUHDUHQRRWKHULQWHQGHGEHQHILFLDULHVRIWKLV $JUHHPHQW $57,&/(±&21)/,&75(62/87,21 ,Q DQ HIIRUW WR UHVROYH DQ\ FRQIOLFWV WKDW DULVH GXULQJWKHGHVLJQRUFRQVWUXFWLRQRIWKHSURMHFW RU IROORZLQJ WKH FRPSOHWLRQ RI WKH SURMHFW WKH &OLHQW DQG &RQVXOWDQW DJUHH WKDW DOO GLVSXWHV EHWZHHQ WKHP DULVLQJ RXW RI RU UHODWLQJ WR WKLV $JUHHPHQW VKDOO EH VXEPLWWHG WR QRQELQGLQJ PHGLDWLRQDVDSUHFRQGLWLRQWRDQ\IRUPDOOHJDO SURFHHGLQJV $57,&/(±&21),'(17,$/,7< 7KH&RQVXOWDQWDJUHHVWRNHHSFRQILGHQWLDODQG QRW WR GLVFORVH WR DQ\ SHUVRQ RU HQWLW\ RWKHU WKDQ WKH &RQVXOWDQW¶V HPSOR\HHV VXEFRQVXOWDQWV DQG WKH JHQHUDO FRQWUDFWRU DQG VXEFRQWUDFWRUV LI DSSURSULDWH DQ\ GDWD DQG LQIRUPDWLRQ IXUQLVKHG WR WKH &RQVXOWDQW DQG PDUNHG &21),'(17,$/ E\ WKH &OLHQW  7KHVH SURYLVLRQV VKDOO QRW DSSO\ WR LQIRUPDWLRQ LQ ZKDWHYHU IRUP WKDW FRPHV LQWR WKH SXEOLF GRPDLQQRUVKDOOLWUHVWULFWWKH&RQVXOWDQWIURP JLYLQJQRWLFHVUHTXLUHGE\ODZRUFRPSO\LQJZLWK DQ RUGHU WR SURYLGH LQIRUPDWLRQ RU GDWD ZKHQ VXFKRUGHULVLVVXHGE\DFRXUWDGPLQLVWUDWLYH DJHQF\RURWKHUDXWKRULW\ZLWKSURSHUMXULVGLFWLRQ RULILWLVUHDVRQDEO\QHFHVVDU\IRUWKH &RQVXOWDQW WR FRPSOHWH VHUYLFHV XQGHU WKH $JUHHPHQW RU GHIHQG LWVHOI IURP DQ\ VXLW RU FODLP  ([KLELW$±*HQHUDO&RQWUDFW3URYLVLRQV 3DJH $57,&/( ± $9$,/$%/( ,1685$1&( 352&(('6$1'/,0,7$7,212)/,$%,/,7< &RQVXOWDQW PDLQWDLQV SURIHVVLRQDO OLDELOLW\ LQVXUDQFH ZLWK D OLDELOLW\ OLPLW RI QRW OHVV WKDQ  SHU FODLP 7KH &RQVXOWDQW¶V WRWDO OLDELOLW\ WR &OLHQW VKDOO QRW H[FHHG WKH WRWDO DYDLODEOH LQVXUDQFH SROLF\ OLPLWV SHU FODLP DYDLODEOH WR &RQVXOWDQW XQGHU LWV SURIHVVLRQDO OLDELOLW\LQVXUDQFHSROLF\ &OLHQWKHUHE\DJUHHV WKDW WR WKH IXOOHVW H[WHQW SHUPLWWHG E\ ODZ WKH &RQVXOWDQW¶VWRWDOOLDELOLW\WR&OLHQWIRUDQ\DQGDOO LQMXULHV FODLPV ORVVHV H[SHQVHV RU GDPDJHV ZKDWVRHYHUDULVLQJRXWRIRULQDQ\ZD\UHODWHG WR RU DULVLQJ IURP WKLV $JUHHPHQW IURP DQ\ FDXVH RU FDXVHV LQFOXGLQJ EXW QRW OLPLWHG WR &RQVXOWDQW¶VQHJOLJHQFHHUURUVRPLVVLRQVVWULFW OLDELOLW\EUHDFKRIFRQWUDFWRUEUHDFKRIZDUUDQW\ &OLHQW¶V&ODLPV VKDOOQRWH[FHHGWKHWRWDOSROLF\ OLPLWV DYDLODEOH WR &RQVXOWDQW XQGHU LWV SURIHVVLRQDO OLDELOLW\ LQVXUDQFH SROLF\ IRU VHWWOHPHQW RU VDWLVIDFWLRQ RI &OLHQW¶V &ODLPV XQGHU WKH WHUPV DQG FRQGLWLRQV RI WKH &RQVXOWDQW¶V SURIHVVLRQDO OLDELOLW\ LQVXUDQFH SROLF\DSSOLFDEOHKHUHWR 1RWZLWKVWDQGLQJ WKH ODQJXDJH DERYH &OLHQW DJUHHVWKDWZLWKUHJDUGWRDQ\FODLPDULVLQJIURP RUUHODWLQJWR &RQVXOWDQW¶V SURYLVLRQ RI JHRWHFKQLFDO HQJLQHHULQJ VHUYLFHV FRQVWUXFWLRQ PDWHULDOV WHVWLQJ VSHFLDO LQVSHFWLRQV DQGRU HQYLURQPHQWDO HQJLQHHULQJ VHUYLFHV LQFOXGLQJ EXW QRW OLPLWHG WR HQYLURQPHQWDO VLWH DVVHVVPHQWV WKDW &RQVXOWDQW¶V OLDELOLW\ IRU DQ\ FODLPV DVVHUWHG E\ RU WKURXJK &OLHQW VKDOO EH OLPLWHGWR &OLHQW DQG &RQVXOWDQW HDFK IXUWKHU DJUHH WKDW QHLWKHU ZLOO EH UHVSRQVLEOH IRU DQ\ LQFLGHQWDO LQGLUHFW RU FRQVHTXHQWLDO GDPDJHV LQFOXGLQJ ORVVRIXVHRUORVVRISURILWV VXVWDLQHGE\WKH RWKHU LWV VXFFHVVRUV RU DVVLJQV  7KLV PXWXDO ZDLYHU VKDOO DSSO\ HYHQ LI WKH GDPDJHV ZHUH IRUHVHHDEOH DQG UHJDUGOHVV RI WKH WKHRU\ RI UHFRYHU\SOHDGRUDVVHUWHG $57,&/(±&21752//,1*/$: 7KLV$JUHHPHQWLVWREHJRYHUQHGE\WKHODZVRI WKH 6WDWH RI 0LQQHVRWD  $Q\ FRQWURYHUV\ RU FODLPDULVLQJRXWRIRUUHODWLQJWRWKLV$JUHHPHQW RUWKHEUHDFKWKHUHRILQFOXGLQJEXWQRWOLPLWHGWR FODLPVIRUQHJOLJHQFHRUEUHDFKRIZDUUDQW\WKDW LVQRWVHWWOHGE\QRQELQGLQJPHGLDWLRQVKDOOEH VHWWOHGE\WKHODZRIWKHVWDWHRI0LQQHVRWD $57,&/( ± /2&$7,21 2) 81'(5*5281',03529(0(176 :KHUH UHTXHVWHG E\ &OLHQW &RQVXOWDQW ZLOO SHUIRUP FXVWRPDU\ UHVHDUFK WR DVVLVW &OLHQW LQ ORFDWLQJ DQG LGHQWLI\LQJ VXEWHUUDQHDQ VWUXFWXUHV RUXWLOLWLHV+RZHYHU&RQVXOWDQWPD\UHDVRQDEO\ UHO\ RQ LQIRUPDWLRQ IURP WKH &OLHQW DQG LQIRUPDWLRQ SURYLGHG E\ ORFDO XWLOLWLHV UHODWHG WR VWUXFWXUHV RU XWLOLWLHV DQG ZLOO QRW EH OLDEOH IRU GDPDJHV LQFXUUHG ZKHUH &RQVXOWDQW KDV FRPSOLHGZLWKWKHVWDQGDUGRIFDUHDQGDFWHGLQ UHOLDQFHRQWKDWLQIRUPDWLRQ7KH&OLHQWDJUHHVWR ZDLYHDOOFODLPVDQGFDXVHVRIDFWLRQDJDLQVWWKH &RQVXOWDQWIRUFODLPVE\&OLHQWRULWVFRQWUDFWRUV UHODWLQJWRWKHLGHQWLILFDWLRQUHPRYDOUHORFDWLRQ RU UHVWRUDWLRQ RI XWLOLWLHV RU GDPDJHV WR XQGHUJURXQG LPSURYHPHQWV UHVXOWLQJ IURP VXEVXUIDFHSHQHWUDWLRQORFDWLRQVHVWDEOLVKHGE\ WKH&RQVXOWDQW G:\Group Data\Municipal\Clients - Cities - Counties\Arden Hills\Proposals\2019 Cummings, Hazelnut and Royal Hills Tennis Court Projects 178 E 9TH STREET | SUITE 200 | SAINT PAUL, MN | 55101 | 651.286.8450 | WSBENG.COM May 6, 2019 Ms. Susan Polka City of Arden Hills 1245 Highway 96 W Arden Hills, MN 55112 Re: Tennis Court Improvements at Cummings, Hazelnut and Royal Hills Park Proposal Dear Ms. Polka: This letter proposal outlines a scope of services and fee for tennis court improvements at Royal Hills Park, Hazelnut Park and Cummings Park for the City of Arden Hills (City). Anticipated improvements include: removal and replacement of the tennis and basketball court at Royal Hills Park, removal and replacement of the tennis court at Hazelnut Park, and resurfacing the tennis and basketball court at Cummings park. It is our understanding that the professional services for this project will consist of topo survey, design, construction documents and specifications, bidding, construction contract administration, construction staking, and material testing. SCOPE OF SERVICES A. Construction Documents and Specifications 1. Preparation of final bid documents for the improvements as approved by the City for inclusion in this project. These documents shall include site plans for removals, layout, grading, restoration, and other typical details as well as specifications for the construction of the improvements as it relates to each project location. 2. Site review and recommendation for improvements at each location. 3. The design of pavement sections shall be based upon city direction and the results of the geotechnical recommendation by WSB (performed under a separate contract). 4. Two meetings (initial kickoff meeting and 90% review meeting) 5. Deliverables: a. One set of plans, specifications, and cost estimate at 75% completion b. One set of plans, specifications, and cost estimate at 100% completion B. Bidding 1. WSB will provide services to assist in bidding of one single package for improvements at Cummings Park, Hazelnut Park and Royal Hills Park as listed below: a. Advertisement for bids b. Online plan set availability to Contractors c. Field questions from prospective bidders d. Issue addenda as necessary e. Attend the bid opening f. Prepare tabulation of bids Ms. Sue Polka May 6, 2019 Page 2 G:\Group Data\Municipal\Clients - Cities - Counties\Arden Hills\Proposals\2019 Cummings, Hazelnut and Royal Hills Tennis Court Projects g. Prepare letter of recommendation for contract award C. Construction Contract Administration 1. Contract Administration a. Conduct one pre-construction conference b. Facilitate up to six site meetings as necessary. Meeting minutes will be prepared and distributed to all the attendees. c. Provide part time construction observation to verify that the design intent, construction plans, and specifications are being met. d. Review pay applications prepared by contractor and make recommendations regarding payment. e. Review submittals and shop drawings. f. Prepare necessary change orders and coordinate with City and contractor. g. Facilitate substantial completion meeting and develop punch list. h. Final project completion and walkthrough. 2. Construction Inspection Following Critical Stages (not full-time) a. Subgrade b. Concrete pour c. Bituminous pavement D. Survey and Construction Staking 1. Basemap Topo Survey a. Provide a basemap topo survey of the area of improvement. The survey will be prepared in AutoCAD format. 2. Construction Staking a. Provide a survey crew to perform (construction staking for grading and final elevations (four trips). E. Material Testing 1. Aggregate and Soils Testing a. Earthwork Observations (two trips) b. Excavation observation (two trips) c. Compaction testing of fill and backfill (six trips) d. Nuclear Density (ten tests) e. Sieve Analysis (four tests) f. Standard Proctor (four test) 2. Asphalt Pavements a. Bituminous test rolling observation (four trips) b. Asphalt Content (four tests) c. Extracted gradation (four tests) Ms. Sue Polka May 6, 2019 Page 3 G:\Group Data\Municipal\Clients - Cities - Counties\Arden Hills\Proposals\2019 Cummings, Hazelnut and Royal Hills Tennis Court Projects Exclusions: We don’t anticipate nor have we included design services for a SWPPP and Watershed Permit. FEES FOR PROFESSIONAL SERVICES We will complete the work defined above to be billed on an hourly basis with a not-to-exceed total of $39,420. We will review our progress monthly and will not exceed this amount without your prior approval. A fee breakdown is listed below. Construction Documents and Specifications $15,820 Bidding $2,620 Construction Contract Administration $9,240 Survey and Construction Staking $5,000 Material Testing $6,740 Total $39,420 If you would like us to proceed with the above work, please sign the statement provided at the bottom of this letter and return the executed copy to WSB. If you should have any questions regarding this proposal, please contact me at 763-231-4865. On behalf of our entire organization, I would like to thank you again for inviting us to submit this proposal. We value every opportunity to work with you on public space improvements within your community! Sincerely, WSB & Associates, Inc. Steven Foss Jason L. Amberg, PLA Landscape Architect Landscape Architecture Group Manager, Principal ACCEPTED BY: City of Arden Hills By: ______________________________ Title: ______________________________ Date: ______________________________ Page 1 of 1 CONSENT ITEM – 7K MEMORANDUM DATE: May 13, 2019 TO: Honorable Mayor and City Councilmembers Dave Perrault, City Administrator FROM: Julie Hanson, City Clerk SUBJECT: Cancellation of the May 28, 2019 Regular City Council Meeting Budgeted Amount: Actual Amount: Funding Source: $ $ $ Council Should Consider Approval of cancellation of the Ma y 28, 2019, regular City Council meeting. Background City Council has traditionally cancelled a meeting if there are no items requiring timely action by the Council. Staff has confirmed there are no items requiring action at this time and recommends consideration of cancellation of the above-referenced meeting. DATE: May 13, 2019 TO: Honorable Mayor and City Councilmembers FROM: Dave Perrault, City Administrator SUBJECT: Update to the TCAAP Final AUAR and Final Mitigation Plan Budgeted Amount: Estimated Amount: Funding Source: $65,000 $15,930 General Fund Council Should Consider Council should consider approving Kimley Horn to begin the update process for the TCAAP final AUAR and final mitigation plan. Background At the City Council work session on March 18, 2019 the City’s planning consultant, Jane Kansier of Bolton & Menk, updated the City Council on the needed upcoming AUAR update. The previous memo is attached for background (see Attachment A). The City did receive two proposals to complete this work, one from Bolton and Menk ($24,864) and one from Kimley Horn ($15,930). Staff is proposing moving forward with Kimley Horn’s proposal (see Attachment B). Attachment Attachment A: TCAAP AUAR Update Memo – March 18, 2019 Work Session Attachment B: TCAAP AUAR Update Proposal – Kimley Horn CONSENT ITEM – 7L MEMORANDUM Page 1 of 1 AGENDA ITEM – 1A MEMORANDUM DATE: March 18, 2019 TO: Honorable Mayor and City Councilmembers Dave Perrault, City Administrator FROM: Jane Kansier, AICP SUBJECT: TCAAP AUAR Update Budgeted Amount: Actual Amount: Funding Source: $ $ $ Council Should Consider Providing direction regarding the update to the TCAAP Final AUAR and Final Mitigation Plan Background/Discussion An Alternative Urban Areawide Review (AUAR) is a form of environmental documentation through Minnesota State Rules that evaluates development scenarios (or several scenarios) for an entire geographical area rather than a specific project. On July 28, 2014, the City Council approved Resolution No. 2014-037 adopting the Final AUAR for the TCAAP project. Under Minnesota Rules, and AUAR must be updated every five years, regardless of the activity on the site, until all the development in the area has been approved. In this case the update is due in July, 2019. An AUAR update generally takes less time than a new AUAR because the update process does not require a complete revision of the AUAR document. The update only needs to reflect the changes that have occurred in the area since approval of the final AUAR. The updated documents are distributed to a variety of state, regional and local agencies, and published in the EQB Monitor. If no objections are filed, the City can adopt the final AUAR update. Attached is an explanation of the update process prepared by the State Environmental Quality Board. If the AUAR is not updated, there is no environmental review coverage on the project. In that case, further environmental review will be required if a specific project that exceeds any mandatory EAW or EIS categories is applied. Attachment Attachment A: AUAR Update Process kimley-horn.com 767 Eustis Street, Suite 100, Saint Paul, MN 55114 651 645 4197 MEMORANDUM To: Dave Perrault From: Beth Engum and Beth Kunkel, Kimley-Horn Date: March 22, 2019 Subject: TCAAP AUAR Update Project Understanding The TCAAP Final AUAR and Final Mitigation Plan was completed in 2014 and, according to Minnesota Rules, part 4410.3610, subpart 7, AUARs must be revised every five years until all the development within the area has been given final approval. The City of Arden Hills has requested a scope, fee, and schedule for completing an AUAR update. Scope of Services TASK 1: PROJECT MANAGEMENT AND AGENCY INVOLVEMENT  Prepare for and attend up to 2 team meetings with City staff. Includes attendance of up to 2 Kimley-Horn staff and preparation of agendas and meeting notes.  Prepare for and attend 1 City Council meeting. Includes attendance of 1 Kimley-Horn staff and preparation of the presentation.  Prepare monthly invoices  General client coordination (telephone calls and emails) TASK 2: AUAR UPDATE The AUAR Update will reference the approved Final AUAR document and mitigation plan. It does not require new analysis for each item addressed in the Final AUAR; rather, the AUAR Update documents the development and mitigation that has been completed to date, and any changes in the development that have occurred or are planned to occur, which may affect future phases of implementation or mitigation measures. The format of the AUAR Update will include an introduction, report of what has been done on-site, description of changes in scenarios, results of impact analysis (including a list of areas with no change), updated mitigation plan with notations for what has been accomplished and identifying any new mitigation measures, and an AUAR process description/conclusion. Task 2.1: Determine and document what has been completed  Coordinate with City to understand and quantify what has been completed since 2014  Coordinate with City to understand which mitigation measures identified in the Mitigation Plan have been implemented Page 2 kimley-horn.com 767 Eustis Street, Suite 100, Saint Paul, MN 55114 651 645 4197  Prepare list of completed development for the AUAR Update  Assumes that the City will provide the as-built details needed to document current land use Task 2.2: Define and document any changes to the project description/scenarios  Coordinate with the City to understand any planned development changes which are different from the scenarios studied in the 2014 AUAR. We have assumed that the scenarios will remain the same.  Prepare description of project changes for the AUAR Update (i.e., Spine Road alignment) Task 2.3: Review/update impact assessment  Analyze land use modifications and compare to thresholds established in the 2014 AUAR  Assumes analysis for each issue area will not be required. Notable changes to be included will be Thumb Road, sanitary sewer, watermain, adjacent CR H interchange, creek meander, and site cleanup. This scope does not include any updates to the traffic model/analysis since no development has occurred on site. Task 2.4: Review/update Mitigation Plan  Describe measures that have been implemented to date  Based an updated impact assessment, coordinate with the City to identify additional mitigation measures to address new impacts, as necessary  Update Mitigation Plan Task 2.5: AUAR Update process  Prepare remaining sections of AUAR Update and assemble with the updated Mitigation Plan document  Edit documents based on one round of comments from the City  Prepare notices and distribute AUAR Update following the process as dictated in Minnesota Rules  If no objections are received, provide documentation to the City for approval by resolution  Activities in response to any formal agency objections are not included in this scope Schedule The schedule below assumes notice to proceed on April 22, 2019. It also assumes no objections will be filed by state agencies or the Metropolitan Council. Date Activity April 22, 2019 Notice to proceed Week of April 29 Initial meeting with city May 6-17 Conduct updated analysis and draft AUAR Update and Mitigation Plan May 20-28 City review of updated analysis and mitigation measures May 29 – June 7 Finalize AUAR Update and Mitigation Plan Page 3 kimley-horn.com 767 Eustis Street, Suite 100, Saint Paul, MN 55114 651 645 4197 Date Activity June 10-14 Final review by City June 17 Submit to EQB Monitor Week of June 17 Distribute documents June 24 EQB Monitor publication June 24 – July 9 Period in which state agencies and the Metropolitan Council can file an objection to the document July 29 If no objections, City approves AUAR Update and Mitigation Plan at its first regularly scheduled city council meeting (must be 15 or more days after the distribution of the document) Fee Based on the scope and schedule identified above, Kimley-Horn can complete the identified tasks for a fee of $15,930. _____________________________________________________________________________________________ City of Arden Hills City Council Meeting for May 13, 2019 C:\Users\mike.mrosla\AppData\Local\Microsoft\Windows\INetCache\Content.MSO\~WRL0001.tmp Page 1 of 9 Requested Action Mounds View Public Schools has submitted an application for a Master and Final Planned Unit Development (PUD). The Applicant is requesting to construct 27,300 square feet of additional classroom space and a 49,000 square feet gymnasium addition. The property, located at 1900 Lake Valentine Road, is zoned R-1, Single Family Residential and is guided as Public and Institutional on the Land Use Plan. In addition, the Applicant is requesting to amend the 2040 Comprehensive Plan. The Applicant is requesting to modify the future Land Use designation of 1901 Lake Valentine Road, the former First Student Bus Garage, from Low Density Residential to Public and Institutional in the 2040 land use plan. This property will be used for high school student and staff parking. Background The last major addition to the high school occurred in 2000 when the track and field stadium was reconstructed and additions were made to the main entrance, auditorium, orchestra/choir area, storage, computer lab, staff dining area, woodshop, and classrooms. Public Hearing – 9A MEMORANDUM DATE: May 13, 2019 TO: Honorable Mayor and City Councilmembers Dave Perrault, City Administrator FROM: Mike Mrosla, City Planner Jane Kansier, AICP, Planning Consultant SUBECT: Planning Case #18-014 Applicant: Mounds View Public Schools Property Location: 1900 and 1901 Lake Valentine Road Request: Comprehensive Plan Amendment and Master and Final Planned Unit Development _____________________________________________________________________________________________ City of Arden Hills City Council Meeting for May 13, 2019 C:\Users\mike.mrosla\AppData\Local\Microsoft\Windows\INetCache\Content.MSO\~WRL0001.tmp Page 2 of 9 The Applicant is proposing an addition totaling 76,300 square feet, including 49,000 square feet for gymnasiums and 27,300 square feet for a total of seven classrooms. Interior remodels of the existing building include 65,000 square feet. The subject property is located at 1900 Lake Valentine Road. The Applicant recently acquired the former First Student school bus garage located directly north of the high school at 1901 Lake Valentine Road. The Applicant is proposing to repave and restripe the parking lot for more efficient car parking. The existing building on the site will be used for cold storage. If they receive City approval, construction of the new additions will begin in May, 2019, with completion expected in fall of 2020. Renovations or changes to the north parking lot will occur at a later time, still to be determined. The applicant has provided plan sets (Attachment C), and a Traffic Report (Attachment D). Plan Evaluation 1. Comprehensive Plan Amendment: An amendment to the Comprehensive Plan requires a recommendation from the Planning Commission following a public hearing, adoption of a resolution by the City Council, and review and approval by the Metropolitan Council. The City has submitted its 2040 Comprehensive Plan update to the Metropolitan Council. The Metropolitan Council will not consider any amendments to the Comprehensive Plan until the 2040 Plan is approved. The City can proceed with the amendment, but must wait to submit it to the Metropolitan Council for final approval, likely later this summer. This delay does not affect the PUD process. 2. Planned Unit Development (PUD) Process: The proposed project would be developed as a PUD in the R-1 District. The PUD process is a tool that provides flexibility for development that an underlying zoning district would not otherwise allow. For example, a PUD may make exceptions to setbacks, lot coverage, or parking _____________________________________________________________________________________________ City of Arden Hills City Council Meeting for May 13, 2019 C:\Users\mike.mrosla\AppData\Local\Microsoft\Windows\INetCache\Content.MSO\~WRL0001.tmp Page 3 of 9 requirements. It is intended to overcome the limitations of zoning regulations and improve the overall design of a project. While the City may negotiate aspects of the development, any conditions imposed on the PUD must have a rational basis related to the expected impact of the development. A full evaluation of the proposal was presented to the Planning Commission on May 8, 2019. The staff report to the Planning Commission on this case is provided in Attachment E and includes an analysis of the development plans and where flexibility is needed. Stormwater Management This proposal involves significant grading on the site to accommodate the stormwater ponding, building additions, the access road around the building, new parking lot configuration, and new athletic field configuration. The original proposal called for a series of underground stormwater structures; however, the cost of these structures proved to be prohibitive. The revised drainage plans directs stormwater runoff to a large stormwater pond located north of Lake Valentine Road, west of Janet Court, and east of the existing bus storage building. The grading and drainage plan is under review by the City Engineer and the Rice Creek Watershed District. This item is scheduled for review by the Watershed District on May 22, 2019. Traffic Impacts The official use of the north lot for school parking requires safety improvements on Lake Valentine Road. Lake Valentine Road is currently a two-lane road with a center turn lane between Janet Court and the west driveway into the school. This street is designated as a Municipal State Aid System (MSAS) route. The City is eligible to receive funding for maintenance and construction based on the number of miles of streets classified as MSAS roads. In order to maintain this classification, the City must meet specific design standards, including lane width and speed, for these roads. The City has worked extensively with the Applicant to develop a plan to safely accommodate pedestrians and vehicles at this location, both in the short-term (during construction) and the long- term. Early discussions about safety at this location included consideration of a traffic signal and a pedestrian overpass. The location does not meet the warrants for a traffic signal. A pedestrian overpass or underpass would be very costly and would likely not meet ADA requirements. The proposed traffic safety plan was recently reviewed by WSB. They believe the proposed plan would lead to safety and operational issues. They are proposing a pedestrian activated signal, similar to that shown below. _____________________________________________________________________________________________ City of Arden Hills City Council Meeting for May 13, 2019 C:\Users\mike.mrosla\AppData\Local\Microsoft\Windows\INetCache\Content.MSO\~WRL0001.tmp Page 4 of 9 This looks similar to a traffic signal, but is activated by pedestrians. Staff is proposing to work with the Applicant to design a system which will provide both pedestrian and vehicular safety. This system would be installed prior to the start of the 2020 school year. In the meantime, the interim safety measures would remain in place. Additional Review City Engineer The City Engineer has reviewed the submitted plans and provided comments. These comments are included in the conditions of approval. A Grading and Erosion Control Permit will be required for this project. All conditions must be addressed prior to issuance of this permit. Building Official The City Building Official has reviewed the submitted plans and does not have any additional comments at this time. Lake Johanna Fire Department The Lake Johanna Fire Marshal has reviewed the plans; their requirements are included as a condition of approval. Rice Creek Watershed District The applicant has submitted a permit application with the RCWD. A copy of the approved RCWD _____________________________________________________________________________________________ City of Arden Hills City Council Meeting for May 13, 2019 C:\Users\mike.mrosla\AppData\Local\Microsoft\Windows\INetCache\Content.MSO\~WRL0001.tmp Page 5 of 9 permit will be required prior to the issuance of any development permits. Findings of Fact The Planning Commission reviewed Planning Case 18-014 at their regular meeting on May 8, 2019. The Planning Commission offers the following findings of fact for consideration: 1. The property located at 1900 Lake Valentine Road is designed for Public and Institutional uses on the 2040 Land Use Plan map. 2. The property located at 1901 Lake Valentine Road is designated for Low Density Residential uses on the 2040 Land Use Plan map. 3. The properties located at 1900 and 1901 Lake Valentine Road are located in the R-1 Single Family Residential District. 4. The R-1 district is consistent with the existing and proposed Public and Institutional designation. 5. The Applicant has proposed a Master Planned Unit Development in order to include noncontiguous parcels as a single use. Other components of the proposal are classroom and gymnasium additions, reconfiguration of the bus parking lot and the staff and student parking lots, and reconfiguration of athletic fields. 6. The Applicant has submitted a Master and Final Planned Unit Development. 7. The Master PUD is generally consistent with the requirements of the City Code. 8. Where the plan is not in conformance with the City Code, flexibility has been requested by the Applicant and/or conditions have been placed on an approval that would mitigate the nonconformity. 9. Flexibility through the PUD process has been requested in the following areas: planting island coverage, tree replacement, building height, and wall signage. 10. The proposed development plan exceeds the minimum requirements of the City Code in the following areas: lot size, building coverage, landscape coverage, setbacks, street trees, perennials and shrubs, tree selection, lighting, screening, location and number of parking stalls, aesthetics and freestanding signs. 11. The Master PUD is in conformance with the draft Arden Hills 2040 Comprehensive Plan, as proposed to be amended. The properties at 1900 and 1901 Lake Valentine Road are zoned R-1, Single Family Residential. Compatible uses such as educational campuses are also intended for this zoning district. 12. With the applied conditions, the application is not anticipated to create a negative impact on the immediate area or the community as a whole. Recommended Action 1. Comprehensive Plan Amendment _____________________________________________________________________________________________ City of Arden Hills City Council Meeting for May 13, 2019 C:\Users\mike.mrosla\AppData\Local\Microsoft\Windows\INetCache\Content.MSO\~WRL0001.tmp Page 6 of 9 The Planning Commission voted to recommend approval (5-0) of Planning Case 18-014 for an amendment to the 2040 Comprehensive Plan Land Use Map from the Low Density Residential designation to the Public and Institutional designation subject to the following condition: 1. Approval of the Comprehensive Plan Amendment is subject to approval by the Metropolitan Council. 2. Planned Unit Development The Planning Commission voted to recommend approval (5-0) of Planning Case 18-014 for a Master and Final PUD at 1900 and 1901 Lake Valentine Road be subject to the following conditions: 1. The project shall be completed in accordance with the plans submitted as amended by the conditions of approval. Any significant changes to the plans, as determined by the City Planner, shall require review and approval by the Planning Commission and City Council. 2. Prior to the issuance of a Grading and Erosion Control permit, the Applicant shall enter into a PUD Development Agreement with the City. The Development Agreement shall outline conditions of approval, required securities and fees, and sequence of events. 3. A letter of credit equal to or 125% of the cost of the required landscaping must be submitted to the City prior to issuance of a Grading and Erosion Control permit. 4. Prior to the issuance of a Grading and Erosion Control permit, staff shall review and approve the final landscaping plan. 5. Prior to the issuance of a Grading and Erosion Control permit, the Applicant shall determine if they will be adding 562 caliper inches of additional trees on the site, off-site or provide cash in lieu of replacement. 6. A Site Plan Review application shall be required for the reconstruction of the parking lot on PID 21302334005. 7. Any use of the existing building on the on PID 21302334005 other than cold storage will require an amendment to the approved PUD. The existing structure shall comply with City Code Chapter 14 and any other use of the building shall meet all applicable codes. 8. Overnight vehicle storage is prohibited. All overnight vehicle storage shall be stored in indoors. 9. No exterior storage shall be permitted onsite. 10. All light poles shall be a maximum of 25 feet in height, including base, and shall be shoebox style, downward directed, with high-pressure sodium or LED lamps and flush lens. Other than wash or architectural lighting, attached security lighting shall be shoebox style, downward directed with flush lens. In addition, any entry lighting under canopies shall be recessed and use a flush lens. Shields shall also be added as directed by the City. 11. All rooftop or ground mounted mechanical equipment shall be hidden from view with the same materials used on the building in accordance with City Code requirements. 12. Prior to the issuance of a Grading and Erosion Control permit, trees or tree areas that are to be preserved shall be visibly marked and City-approved tree protection fencing or other methods shall be installed and maintained at the critical root zones of the trees to be _____________________________________________________________________________________________ City of Arden Hills City Council Meeting for May 13, 2019 C:\Users\mike.mrosla\AppData\Local\Microsoft\Windows\INetCache\Content.MSO\~WRL0001.tmp Page 7 of 9 protected. The location of the fencing shall be in conformance with the approved tree preservation plan and approved by staff in writing. 13. The Applicant shall be responsible for obtaining any other permits necessary from other agencies, MPCA, Rice Creek Watershed District, etc. prior to the start of any site activities. 14. All disturbed boulevards shall be restored with sod. 15. The Applicant shall be responsible for protecting the proposed on-site storm sewer infrastructure and components and any existing storm sewer from exposure to any and all stormwater runoff, sediments and debris during all construction activities. Temporary stormwater facilities shall be installed to protect the quality aspect of the proposed and existing stormwater facilities prior to and during construction activities. Maintenance of any and all temporary stormwater facilities shall be the responsibility of the Applicant. 16. The Applicant shall be responsible for obtaining a land disturbance Grading and Erosion Control permit from the City’s Engineering Division prior to the commencement of any land disturbance activities. 17. Heavy duty silt fence and adequate erosion control around the entire construction site shall be required and maintained by the Developer during construction to ensure that sediment and storm water does not leave the project site. 18. Prior to the beginning of the 2019-2020 school year, the Applicant shall stripe a minimum of 334 parking stalls in parking lot located on PID 213023340005. Parking stalls dimensions shall be 9 feet by 18 feet. 19. Prior to the issuance of a Grading and Erosion Control permit, the School District shall provide the City in writing how they will staff the pedestrian crossing during student arrival and release. City staff and the Ramsey County Sheriff shall review and approve the pedestrian crossing plan prior to August 1, 2019. The School District shall implement any and all recommendations made by the City and/or the Sheriff prior to the start of the 2019-2020 school year. 20. Prior to the issuance of a Grading and Erosion Control permit the Engineering Department shall approve the Final grading, utility, stormwater and right of way improvement plans. 21. The Applicant, Ramsey County Sheriff and City staff shall review traffic and pedestrian operations annually. The Applicant shall implement improvements recommended by the City Engineer. 22. Prior to the issuance of a Grading and Erosion Control Permit, all items identified in the March 5, 2019 Engineering Review Comments memo shall be addressed. All comments shall be adopted herein by reference. 23. The proposed mascot wall sign may be externally illumined and shall be approved by Planning staff in writing. Internal illumination is prohibited. The proposed mascot sign shall not exceed 53 square feet. Final location of the proposed mascot wall sign shall be approved in writing by Planning staff. 24. Findings and recommendations of the March 19, 2019 Traffic memo from Wenck shall be implemented. 25. A Planned Unit Development Agreement shall be fully executed prior to the prior to the issuance of a Grading and Erosion Control Permit. _____________________________________________________________________________________________ City of Arden Hills City Council Meeting for May 13, 2019 C:\Users\mike.mrosla\AppData\Local\Microsoft\Windows\INetCache\Content.MSO\~WRL0001.tmp Page 8 of 9 26. The Applicant shall be financially responsible for 100 percent of all Lake Valentine Road street improvements. These improvements include but shall not be limited to: turn lanes and other access improvements, trail and sidewalk improvements, pedestrian signal, signage and striping modifications, and drainage and utility improvements. The City’s engineering consultant will design construction plans and specifications. These charges will be identified in the Planned Unit Development Agreement. 27. The Applicant shall preform a analysis of how many trees the parking lot and surrounding land on PID 21302334005 can accommodate and reserve the said number of trees from 562 caliper inches required to be replaced. 28. After site grading has been completed, the Applicant shall work with the adjacent property owners to ensure any screening concerns are addressed. Any trees planted shall count towards the 562 caliper inches required to be replaced. Motion Language Options Staff has provided the following motion language options for the City Council to consider. The recommended action by the Planning Commission is for approval with the 28 conditions in the May 13, 2019, Report to the City Council. 1. Approve with Conditions: Motion to approve Planning Case 18-014 for a Comprehensive Plan Amendment and a Master and Final PUD at 1900 Lake Valentine Road, based on the findings of fact and submitted plans, as amended by the conditions in the May 13, 2019, Report to the City Council, and authorize the Mayor and City Administrator to execute the Planned Unit Development Agreement subject to the listed conditions. Four affirmative votes are required to approve the PUD Master Plan. 2. Approve without Conditions: Motion to approve Planning Case 18-014 for a Comprehensive Plan Amendment and a Master and Final PUD at 1900 and 1901 Lake Valentine Road, based on the findings of fact and submitted plans in the May 13, 2019, Report to the Council. Four affirmative votes are required to approve the PUD Master Plan, and authorize the Mayor and City Administrator to execute the Planned Unit Development Agreement subject to the listed conditions. 3. Deny: Motion to deny Planning Case 18-014 for a Comprehensive Plan Amendment and a Master and Final PUD at 1900 and 1901 Lake Valentine Road based on the following findings of fact: findings to deny should specifically reference the reasons for denial and why those reasons cannot be mitigated. 4. Table: Motion to table Planning Case 18-014 for a Comprehensive Plan Amendment and a Master and Final PUD at 1900 and 1901 Lake Valentine Road for the following reasons: a specific reason and/or information request should be included with a motion to table. _____________________________________________________________________________________________ City of Arden Hills City Council Meeting for May 13, 2019 C:\Users\mike.mrosla\AppData\Local\Microsoft\Windows\INetCache\Content.MSO\~WRL0001.tmp Page 9 of 9 Notice and Public Comments Notice was published in the Arden Hills-Shoreview Bulletin on May 1, 2019. Notice was prepared by the City and mailed to property owners within 500 feet of the subject property. Two neighborhood meetings were held for the project with the first being held on February 12, 2019 with 7 property owners in attendance. Questions were raised regarding traffic on Lake Valentine Road, screening, park lot improvements and construction timing. The second neighborhood meeting was held on April 30, 2019 with 6 neighbors in attendance. Questions were raised regarding construction timing, stormwater, screening, pedestrian crossings and traffic on Lake Valentine Road. Since the last neighborhood meeting staff has met with the property owners of 1817 Gramsie Road in regards to this planning case. A public hearing for Mounds View High School was held on April 3, 2019 at the Planning Commission meeting. At that time three (3) residents came forward to make comment. Questions and comments were raised regarding pedestrian movements and safety, parking, and tree impacts. Deadline for Agency Actions The City of Arden Hills received the completed application for this request on April 24, 2019. Pursuant to Minnesota State Statute, the City must act on this request by June 22, 2019 (60 days), unless the City provides the petitioner with written reasons for an additional 60 day review period. The City may, with the consent of the applicant, extend the review period beyond the initial 120 days. Attachments A. Land Use Application B. Location Map C. Plan Sets D. Wenck Traffic Memo, dated March 19, 2019 E. Wenck Traffic Report, dated March 27, 2019 F. Planning Commission Report, May 8, 2019 Disclaimer: This map is intended for reference purposes only and is not a legally recorded map or survey. The City of Arden Hills shall not be liable for any damages or claims that arise due to accuracy, availability, use or misuse of the information herein pursuant to MN Statute 466.03 Subd 21. Interstate 694 Lake Val e n t i n e R o a d Venus A v e n u e Gramsie Road Glenview AvenueFairview Avenue NorthCrystal Avenue Janet Court NB I35W To EB I694 Dellview AvenueValentine Crest R o a d WB I694 T o N B I 3 5 W Rolling Hills RoadInterstate 694 Fairview Avenue NorthSubject Parcel Park and Open Space Location Map §¨¦35W §¨¦694 £¤10Lexington Ave. N± R2 R7 R1 R1 R1 R1 R1 R1 R1 R1 R2 R2 R2X1 R2 X1REMOVE MAILBOX R2 R2 R2 R2 REMOVE BOLLARDS R2 R2 R3 R3 R3 X1 R3 R3 P3 P3 P3 R3 R3 R3 R3 R5 R5 R5 R5 R3 R3 R5 R5 R5 R7 R7 R7 R8 R2 R2 R9 R10 R11 X1 P2 R12 R12 R12 R12 R12 R12 R14 R14 R14 R14 P1 P1 P10 P1 P2 P2 P2 P2 R2 P2 P2 P2 P2P2 P2 P2 P2 P2 R2 R2 PROTECT VEHICLE GATE P2 P2 P2 P2 P3 P3 P3 P3 P3 X1 R3 P3 R5 P5 R5 R5 P5 P5 P7 P7 P8 P8 P7 P7 P8 P7 P11 P9 P9 P9 P9 P12 P12 P12P8 P12 P12 P12 P12 R5 P14 P14 P14 P14 X1 X2 X2 X2 X2 X2X2 P3 R2 P2 P2P5 X1 P5 R3 R14 X1 P9 P2 R1 P3 P4 R12 P12 P12 P3 PROTECT WETLAND R2 X1 P2 R12 P12P12 P12R12 R12 P2 X2 X2 X2 R8 COORDINATE RELOCATION OF POWER POLE WITH LOCAL POWER COMPANY COORDINATE RELOCATION OF POWER POLE WITH LOCAL POWER COMPANY R10 R12 R12 R12 R12 R12R12 R12 REMOVE SANITARY SEWER REMOVE SANITARY SEWER STRUCTURE REMOVE SANITARY SEWER STRUCTURE X1 R12 BLACK OUT EXISTING PAINT STRIPING BLACK OUT EXISTING PAINT STRIPING R3 R14 R14 P3 R12 NOTES:LEGEND CONCRETE PAVEMENT REMOVALS CONCRETE CURB AND GUTTER REMOVALS BITUMINOUS PAVEMENT REMOVALS GRAVEL / ROCK SURFACE REMOVALS FENCING REMOVALS RETAINING WALL REMOVALS UTILITY REMOVALS TREE REMOVALS MASS TREE / SHRUB REMOVALS SAWCUT REMOVALS KEY NOTE PROPERTY LINE 1. REFER TO SHEET C1.34, GRADING AND DRAINAGE PLAN FIELDS, FOR GENERAL NOTES. 2. MINIMIZE DISTURBANCE TO SITE AND PROTECT EXISTING VEGETATION AND SITE FEATURES (CURBS, WALKS, PAVEMENTS, OVERHEAD AND UNDERGROUND UTILITIES, SIGNAGE, FENCING, ROADWAYS, ETC.) WHICH ARE TO REMAIN. 3. REPAIR OR REPLACE EXISTING PROPERTY AND SITE FEATURES, INCLUDING GRASS AND VEGETATION, WHICH IS TO REMAIN THAT IS DAMAGED BY THE WORK, TO OWNER'S SATISFACTION AND AT NO ADDITIONAL COST TO THE OWNER. 4. VISIT THE SITE PRIOR TO BIDDING; BE FAMILIAR WITH ACTUAL CONDITIONS IN THE FIELD. EXTRA COMPENSATION WILL NOT BE ALLOWED FOR CONDITIONS WHICH COULD HAVE BEEN DETERMINED OR ANTICIPATED BY EXAMINATION OF THE SITE, THE CONTRACT DRAWINGS AND THE INFORMATION AVAILABLE PERTAINING TO EXISTING SOILS, UTILITIES AND OTHER SITE CHARACTERISTICS. 5. THE CONTRACTOR SHALL HIRE THE SERVICES OF A UTILITY LOCATOR COMPANY TO LOCATE ALL PRIVATELY OWNED UTILITIES THAT MAY BE DISTURBED BY CONSTRUCTION OPERATIONS. 6. SAWCUT ALL JOINTS FOR BITUMINOUS REMOVALS. KEY NOTE LEGEND REMOVE CONCRETE PAVEMENT TO NEAREST JOINT REMOVE CONCRETE CURB AND GUTTER / VALLEY GUTTER REMOVE BITUMINOUS PAVEMENT REMOVE FENCING (INCLUDING FOOTINGS AND GATES) REMOVE TRAFFIC CONTROL SIGN AND POST REMOVE RETAINING WALL REMOVE STORM SEWER REMOVE STORM SEWER STRUCTURE REMOVE WATERMAIN REMOVE HYDRANT REMOVE GATE VALVE REMOVE TREE REMOVE LANDSCAPING (MULCH, SHRUBS, ETC.) SAWCUT PROTECT CONCRETE PAVEMENT PROTECT CONCRETE CURB AND GUTTER / VALLEY GUTTER PROTECT BITUMINOUS PAVEMENT PROTECT FENCING (INCLUDING FOOTINGS AND GATES) PROTECT TRAFFIC CONTROL SIGN AND POST PROTECT RETAINING WALL PROTECT STORM SEWER PROTECT STORM SEWER STRUCTURE PROTECT WATERMAIN PROTECT HYDRANT PROTECT GATE VALVE PROTECT TREE PROTECT LANDSCAPING (MULCH, SHRUBS, ETC.) PROTECT SANITARY SEWER REFER TO UTILITY PLAN FOR TREATMENT REFER TO ELECTRICAL PLANS FOR TREATMENT REFER TO MECHANICAL PLANS FOR TREATMENT REFER TO ARCHITECTURAL PLANS FOR TREATMENT R1 R1 R2 R3 R4 R5 R6 R7 R8 R9 R10 R11 R12 R13 R14 P1 P2 P3 P4 P5 P6 P7 P8 P9 P10 P11 P12 P13 P14 X1 X2 X3 X4 LANDSCAPE ARCHITECTURE SITE PLANNING CIVIL ENGINEERING ANDERSON - JOHNSON ASSOCIATES, INC. 7575 GOLDEN VALLEY ROAD SUITE 200 MINNEAPOLIS. MN 55427 FAX (763) 544-0531 PH (763) 544-7129 DateRegistration Number Check Drawn Date: Comm I hereby certify that this plan, specification or report was prepared by me or under my direct supervision and that I am a duly Licensed under the laws of the State of Revisions Description Date Num Scale: North 501 South Eighth Street Minneapolis, MN 55404 krausanderson.com | 612 332 7281 MOUNDS VIEW HIGH SCHOOL 2019 IMPROVEMENTS 1900 Lake Valentine Road ARDEN HILLS, MINNESOTA 55112 4570 VICTORIA STREET N SHOREVIEW, MINNESOTA 55126 ISD #621: MOUNDS VIEW PUBLIC SCHOOLS PROFESSIONAL ENGINEER MINNESOTA C1.11 1" = 40' DAR MET 02/06/2019 172270 40180 02/06/2019 DAVID A. REY NORTHPLANREMOVALS R2 R1 R1 R1 R1 R1 R7 R1 R1 R1R1 R1 R1 R1 R1 R1 R1 R1 R1 R2 R2X1 R2 X1REMOVE MAILBOX R2 R2 R2 R2 R2 P2 R2 R2 R2 R2 R2 R2 R2 REMOVE BOLLARDS R2 R2 R2 R2 R3 R3 R3 R3 R3 R3 R3 R3 R3 X1 R3 R3 P3 R3 R3 R3 R3 R3 R3 R3 R3 R3 R3 R4 R4 R4 R4 R5 R5 R5 R5 R3 R3 R5 R5 R5 R5 R5 R5 R5 R4 R5 R6 R6 R6 R7 R7 R7 R7 R7 R7 R7 R7 R7 R7 R7 P1 R8 R8 R8 R8 R8 R8 R8 R8 R2 R2 R9 R9 R9 R9 R10 R11 X1 X1 X1 X1 P2 R12 R12 R12 R12R12 R12 R12 R12 R12 R12 R12 R12 R12 R12 R12 R14 R14 R14 R14 R14 R14 R14 R14 P1 P1 P1 P1 P1 P1 R14 P1 P1 P1 P1 P10 P1 P1 P1 P1 P1P2 R2 P2 P2 P2 P2P2 P2 P2 P2 P2 R2 R2 PROTECT VEHICLE GATE P2 P2 P2 P2 P2 P2 P2 P2 R14 P2 P3 P3 P3 P3 P3 P3 P3 R3 P3 P3 P3 P3 P6 R4 R6R4 P4 P4 P4 P4 P4 P4 P4 P5 R5 R5 P5 P5 P5 P6 X1 X1 P7 P7 P7 P7 P8 P8 P7 P7 P8 P7 P8 P11 P9 P9 P9 P9 P9 P9 P11P9 P9 P9 P9 P12 P12 P12 P12P8 P12 P12 P14 P14 P14 P14 X1 P2 X2 X2 X2 X2 X2 X2 X2 X2 X2 X2 X2 X2 X2 CONTACT AND COORDINATE WITH LOCAL UTILITY TO RELOCATE EXISTING GAS LINE REMOVE VEHICLE GATE (INCLUDING P3 R2 P2 P2P5 X1 P5 R14 X1 P9 P2 R1 P3 P4 R2 X1 P2 R12 P12P12 P12R12 R12 P2 X2 X2 X2 R8 PROTECT STEPS X4 R6 R12 X2 X2 X2 X2 P6 P11P10 P6 P6P4 R1 R2 R10 REMOVE SANITARY SEWER STRUCTURER3R14 P3 BLACK OUT EXISTING PAINT STRIPING NOTES:LEGEND CONCRETE PAVEMENT REMOVALS CONCRETE CURB AND GUTTER REMOVALS BITUMINOUS PAVEMENT REMOVALS GRAVEL / ROCK SURFACE REMOVALS FENCING REMOVALS RETAINING WALL REMOVALS UTILITY REMOVALS TREE REMOVALS MASS TREE / SHRUB REMOVALS SAWCUT REMOVALS KEY NOTE PROPERTY LINE 1. REFER TO SHEET C1.34, GRADING AND DRAINAGE PLAN FIELDS, FOR GENERAL NOTES. 2. MINIMIZE DISTURBANCE TO SITE AND PROTECT EXISTING VEGETATION AND SITE FEATURES (CURBS, WALKS, PAVEMENTS, OVERHEAD AND UNDERGROUND UTILITIES, SIGNAGE, FENCING, ROADWAYS, ETC.) WHICH ARE TO REMAIN. 3. REPAIR OR REPLACE EXISTING PROPERTY AND SITE FEATURES, INCLUDING GRASS AND VEGETATION, WHICH IS TO REMAIN THAT IS DAMAGED BY THE WORK, TO OWNER'S SATISFACTION AND AT NO ADDITIONAL COST TO THE OWNER. 4. VISIT THE SITE PRIOR TO BIDDING; BE FAMILIAR WITH ACTUAL CONDITIONS IN THE FIELD. EXTRA COMPENSATION WILL NOT BE ALLOWED FOR CONDITIONS WHICH COULD HAVE BEEN DETERMINED OR ANTICIPATED BY EXAMINATION OF THE SITE, THE CONTRACT DRAWINGS AND THE INFORMATION AVAILABLE PERTAINING TO EXISTING SOILS, UTILITIES AND OTHER SITE CHARACTERISTICS. 5. THE CONTRACTOR SHALL HIRE THE SERVICES OF A UTILITY LOCATOR COMPANY TO LOCATE ALL PRIVATELY OWNED UTILITIES THAT MAY BE DISTURBED BY CONSTRUCTION OPERATIONS. 6. SAWCUT ALL JOINTS FOR BITUMINOUS REMOVALS. KEY NOTE LEGEND REMOVE CONCRETE PAVEMENT TO NEAREST JOINT REMOVE CONCRETE CURB AND GUTTER / VALLEY GUTTER REMOVE BITUMINOUS PAVEMENT REMOVE FENCING (INCLUDING FOOTINGS AND GATES) REMOVE TRAFFIC CONTROL SIGN AND POST REMOVE RETAINING WALL REMOVE STORM SEWER REMOVE STORM SEWER STRUCTURE REMOVE WATERMAIN REMOVE HYDRANT REMOVE GATE VALVE REMOVE TREE REMOVE LANDSCAPING (MULCH, SHRUBS, ETC.) SAWCUT PROTECT CONCRETE PAVEMENT PROTECT CONCRETE CURB AND GUTTER / VALLEY GUTTER PROTECT BITUMINOUS PAVEMENT PROTECT FENCING (INCLUDING FOOTINGS AND GATES) PROTECT TRAFFIC CONTROL SIGN AND POST PROTECT RETAINING WALL PROTECT STORM SEWER PROTECT STORM SEWER STRUCTURE PROTECT WATERMAIN PROTECT HYDRANT PROTECT GATE VALVE PROTECT TREE PROTECT LANDSCAPING (MULCH, SHRUBS, ETC.) PROTECT SANITARY SEWER REFER TO UTILITY PLAN FOR TREATMENT REFER TO ELECTRICAL PLANS FOR TREATMENT REFER TO MECHANICAL PLANS FOR TREATMENT REFER TO ARCHITECTURAL PLANS FOR TREATMENT R1 R1 R2 R3 R4 R5 R6 R7 R8 R9 R10 R11 R12 R13 R14 P1 P2 P3 P4 P5 P6 P7 P8 P9 P10 P11 P12 P13 P14 X1 X2 X3 X4 LANDSCAPE ARCHITECTURE SITE PLANNING CIVIL ENGINEERING ANDERSON - JOHNSON ASSOCIATES, INC. 7575 GOLDEN VALLEY ROAD SUITE 200 MINNEAPOLIS. MN 55427 FAX (763) 544-0531 PH (763) 544-7129 DateRegistration Number Check Drawn Date: Comm I hereby certify that this plan, specification or report was prepared by me or under my direct supervision and that I am a duly Licensed under the laws of the State of Revisions Description Date Num Scale: North 501 South Eighth Street Minneapolis, MN 55404 krausanderson.com | 612 332 7281 MOUNDS VIEW HIGH SCHOOL 2019 IMPROVEMENTS 1900 Lake Valentine Road ARDEN HILLS, MINNESOTA 55112 4570 VICTORIA STREET N SHOREVIEW, MINNESOTA 55126 ISD #621: MOUNDS VIEW PUBLIC SCHOOLS PROFESSIONAL ENGINEER MINNESOTA C1.12 1" = 30' DAR MET 02/06/2019 172270 40180 02/06/2019 DAVID A. REY CENTERPLANREMOVALS Addendum #2 02/22/2019 1 R1 R1 R1 R1 R1 R1 REMOVE STAIRS (INCLUDING FOOTINGS, RAILINGS, ETC.) R1 R1 R1R1 R1 R1 R2 R2 R2 R2 R2 R2 R2 R2 R2 R2 P2 R2 R2 R2 R2 R2 R2 R2 R3 R3 R3 R3 R3 R3 R12 R3 R3 R3 R3 R3 R3 R3 R3 R3 R3 R3 R3 R3 R3 R3 R4 R4 R4 R5 R5 R5 R4 R5 RELOCATE SHED - COORDINATE LOCATION WITH OWNER R6 R6 R6 R7 R7 R7 R7 R7 R7 R7 R7 R7 R7 R7 R7 R7 R7 R8 R7 P1 R8 R8 R8 R8 R8 R8 R8 R8 R8 R8 R8 R8 R8 R9 R9 R9R10 R9 R12 X1 X1 X1R12 R12 R12 R12 R12 R12 R12 R12 R12 R12 R12 R12 R12 R12 R12 R12 R14 R14 R14 R14 R14 R14 R14 P1 P1 P1 P1 P1 P1 P1 P1 P1 P1 P1 P1 P2 P2 P2 P2 R14 P2 P2 P2 P2 P3 P P3 P3 P3 P3 P3 R6R4 P6P4 R6R4 R6R4 R6R4 P6 R4 R6R4 P4 REMOVE ROCK REMOVE GRAVEL P4 P5 P6 P6 X1 X1 P7 P7 P7 P8 X1 P7 P9 P9 P11P9 P9 P9 P9 P12 P12 P12 P12 P12 P12 P12 P12 P12 P12 P12 P12 P12 P12 PROTECT ROCK PROTECT ROCK P2 X2 X2 X2 X2 X2 X2 X2 X2 X2 X2 X2 X3 CONTACT AND COORDINATE WITH LOCAL UTILITY TO RELOCATE EXISTING GAS LINE CONTACT AND COORDINATE WITH LOCAL UTILITY TO RELOCATE EXISTING GAS LINE REMOVE VEHICLE GATE (INCLUDING POSTS AND FOOTINGS) PROTECT STEPS X4 R6 R12 P4 PROTECT UNDERGROUND UTILITY P6 P11P10 P6 P6P4 R1 R2 NOTES: LEGEND CONCRETE PAVEMENT REMOVALS CONCRETE CURB AND GUTTER REMOVALS BITUMINOUS PAVEMENT REMOVALS GRAVEL / ROCK SURFACE REMOVALS FENCING REMOVALS RETAINING WALL REMOVALS UTILITY REMOVALS TREE REMOVALS MASS TREE / SHRUB REMOVALS SAWCUT REMOVALS KEY NOTE PROPERTY LINE 1. REFER TO SHEET C1.34, GRADING AND DRAINAGE PLAN FIELDS, FOR GENERAL NOTES. 2. MINIMIZE DISTURBANCE TO SITE AND PROTECT EXISTING VEGETATION AND SITE FEATURES (CURBS, WALKS, PAVEMENTS, OVERHEAD AND UNDERGROUND UTILITIES, SIGNAGE, FENCING, ROADWAYS, ETC.) WHICH ARE TO REMAIN. 3. REPAIR OR REPLACE EXISTING PROPERTY AND SITE FEATURES, INCLUDING GRASS AND VEGETATION, WHICH IS TO REMAIN THAT IS DAMAGED BY THE WORK, TO OWNER'S SATISFACTION AND AT NO ADDITIONAL COST TO THE OWNER. 4. VISIT THE SITE PRIOR TO BIDDING; BE FAMILIAR WITH ACTUAL CONDITIONS IN THE FIELD. EXTRA COMPENSATION WILL NOT BE ALLOWED FOR CONDITIONS WHICH COULD HAVE BEEN DETERMINED OR ANTICIPATED BY EXAMINATION OF THE SITE, THE CONTRACT DRAWINGS AND THE INFORMATION AVAILABLE PERTAINING TO EXISTING SOILS, UTILITIES AND OTHER SITE CHARACTERISTICS. 5. THE CONTRACTOR SHALL HIRE THE SERVICES OF A UTILITY LOCATOR COMPANY TO LOCATE ALL PRIVATELY OWNED UTILITIES THAT MAY BE DISTURBED BY CONSTRUCTION OPERATIONS. 6. SAWCUT ALL JOINTS FOR BITUMINOUS REMOVALS. R1 KEY NOTE LEGEND REMOVE CONCRETE PAVEMENT TO NEAREST JOINT REMOVE CONCRETE CURB AND GUTTER / VALLEY GUTTER REMOVE BITUMINOUS PAVEMENT REMOVE FENCING (INCLUDING FOOTINGS AND GATES) REMOVE TRAFFIC CONTROL SIGN AND POST REMOVE RETAINING WALL REMOVE STORM SEWER REMOVE STORM SEWER STRUCTURE REMOVE WATERMAIN REMOVE HYDRANT REMOVE GATE VALVE REMOVE TREE REMOVE LANDSCAPING (MULCH, SHRUBS, ETC.) SAWCUT PROTECT CONCRETE PAVEMENT PROTECT CONCRETE CURB AND GUTTER / VALLEY GUTTER PROTECT BITUMINOUS PAVEMENT PROTECT FENCING (INCLUDING FOOTINGS AND GATES) PROTECT TRAFFIC CONTROL SIGN AND POST PROTECT RETAINING WALL PROTECT STORM SEWER PROTECT STORM SEWER STRUCTURE PROTECT WATERMAIN PROTECT HYDRANT PROTECT GATE VALVE PROTECT TREE PROTECT LANDSCAPING (MULCH, SHRUBS, ETC.) PROTECT SANITARY SEWER REFER TO UTILITY PLAN FOR TREATMENT REFER TO ELECTRICAL PLANS FOR TREATMENT REFER TO MECHANICAL PLANS FOR TREATMENT REFER TO ARCHITECTURAL PLANS FOR TREATMENT R1 R2 R3 R4 R5 R6 R7 R8 R9 R10 R11 R12 R13 R14 P1 P2 P3 P4 P5 P6 P7 P8 P9 P10 P11 P12 P13 P14 X1 X2 X3 X4 LANDSCAPE ARCHITECTURE SITE PLANNING CIVIL ENGINEERING ANDERSON - JOHNSON ASSOCIATES, INC. 7575 GOLDEN VALLEY ROAD SUITE 200 MINNEAPOLIS. MN 55427 FAX (763) 544-0531 PH (763) 544-7129 DateRegistration Number Check Drawn Date: Comm I hereby certify that this plan, specification or report was prepared by me or under my direct supervision and that I am a duly Licensed under the laws of the State of Revisions Description Date Num Scale: North 501 South Eighth Street Minneapolis, MN 55404 krausanderson.com | 612 332 7281 MOUNDS VIEW HIGH SCHOOL 2019 IMPROVEMENTS 1900 Lake Valentine Road ARDEN HILLS, MINNESOTA 55112 4570 VICTORIA STREET N SHOREVIEW, MINNESOTA 55126 ISD #621: MOUNDS VIEW PUBLIC SCHOOLS PROFESSIONAL ENGINEER MINNESOTA C1.13 1" = 30' DAR MET 02/06/2019 172270 40180 02/06/2019 DAVID A. REY SOUTHPLANREMOVALS Addendum #2 02/22/2019 1Addendum #3 02/26/2019 2 R12 R12 R12 R12 R12 R12 R12 R12 R12 R12 R12 R12 R12 R12 R12 R12 R12 R12 R12 R12 R12 R12 P12 P4 PROTECT SCOREBOARD AND RELATED COMPONENTS P7 P8 P12 P12 P12 P12 P12 P12 P12 P12 P12 P12 P12 P12 P12 P12 P4 R4 R12 R12 NOTES:LEGEND CONCRETE PAVEMENT REMOVALS CONCRETE CURB AND GUTTER REMOVALS BITUMINOUS PAVEMENT REMOVALS GRAVEL / ROCK SURFACE REMOVALS FENCING REMOVALS RETAINING WALL REMOVALS UTILITY REMOVALS TREE REMOVALS MASS TREE / SHRUB REMOVALS SAWCUT REMOVALS KEY NOTE PROPERTY LINE 1. REFER TO SHEET C1.34, GRADING AND DRAINAGE PLAN FIELDS, FOR GENERAL NOTES. 2. MINIMIZE DISTURBANCE TO SITE AND PROTECT EXISTING VEGETATION AND SITE FEATURES (CURBS, WALKS, PAVEMENTS, OVERHEAD AND UNDERGROUND UTILITIES, SIGNAGE, FENCING, ROADWAYS, ETC.) WHICH ARE TO REMAIN. 3. REPAIR OR REPLACE EXISTING PROPERTY AND SITE FEATURES, INCLUDING GRASS AND VEGETATION, WHICH IS TO REMAIN THAT IS DAMAGED BY THE WORK, TO OWNER'S SATISFACTION AND AT NO ADDITIONAL COST TO THE OWNER. 4. VISIT THE SITE PRIOR TO BIDDING; BE FAMILIAR WITH ACTUAL CONDITIONS IN THE FIELD. EXTRA COMPENSATION WILL NOT BE ALLOWED FOR CONDITIONS WHICH COULD HAVE BEEN DETERMINED OR ANTICIPATED BY EXAMINATION OF THE SITE, THE CONTRACT DRAWINGS AND THE INFORMATION AVAILABLE PERTAINING TO EXISTING SOILS, UTILITIES AND OTHER SITE CHARACTERISTICS. 5. THE CONTRACTOR SHALL HIRE THE SERVICES OF A UTILITY LOCATOR COMPANY TO LOCATE ALL PRIVATELY OWNED UTILITIES THAT MAY BE DISTURBED BY CONSTRUCTION OPERATIONS. KEY NOTE LEGEND REMOVE CONCRETE PAVEMENT TO NEAREST JOINT REMOVE CONCRETE CURB AND GUTTER / VALLEY GUTTER REMOVE BITUMINOUS PAVEMENT REMOVE FENCING (INCLUDING FOOTINGS AND GATES) REMOVE TRAFFIC CONTROL SIGN AND POST REMOVE RETAINING WALL REMOVE STORM SEWER REMOVE STORM SEWER STRUCTURE REMOVE WATERMAIN REMOVE HYDRANT REMOVE GATE VALVE REMOVE TREE REMOVE LANDSCAPING (MULCH, SHRUBS, ETC.) SAWCUT PROTECT CONCRETE PAVEMENT PROTECT CONCRETE CURB AND GUTTER / VALLEY GUTTER PROTECT BITUMINOUS PAVEMENT PROTECT FENCING (INCLUDING FOOTINGS AND GATES) PROTECT TRAFFIC CONTROL SIGN AND POST PROTECT RETAINING WALL PROTECT STORM SEWER PROTECT STORM SEWER STRUCTURE PROTECT WATERMAIN PROTECT HYDRANT PROTECT GATE VALVE PROTECT TREE PROTECT LANDSCAPING (MULCH, SHRUBS, ETC.) PROTECT SANITARY SEWER REFER TO UTILITY PLAN FOR TREATMENT REFER TO ELECTRICAL PLANS FOR TREATMENT REFER TO MECHANICAL PLANS FOR TREATMENT REFER TO ARCHITECTURAL PLANS FOR TREATMENT R1 R1 R2 R3 R4 R5 R6 R7 R8 R9 R10 R11 R12 R13 R14 P1 P2 P3 P4 P5 P6 P7 P8 P9 P10 P11 P12 P13 P14 X1 X2 X3 X4 LANDSCAPE ARCHITECTURE SITE PLANNING CIVIL ENGINEERING ANDERSON - JOHNSON ASSOCIATES, INC. 7575 GOLDEN VALLEY ROAD SUITE 200 MINNEAPOLIS. MN 55427 FAX (763) 544-0531 PH (763) 544-7129 DateRegistration Number Check Drawn Date: Comm I hereby certify that this plan, specification or report was prepared by me or under my direct supervision and that I am a duly Licensed under the laws of the State of Revisions Description Date Num Scale: North 501 South Eighth Street Minneapolis, MN 55404 krausanderson.com | 612 332 7281 MOUNDS VIEW HIGH SCHOOL 2019 IMPROVEMENTS 1900 Lake Valentine Road ARDEN HILLS, MINNESOTA 55112 4570 VICTORIA STREET N SHOREVIEW, MINNESOTA 55126 ISD #621: MOUNDS VIEW PUBLIC SCHOOLS PROFESSIONAL ENGINEER MINNESOTA C1.14 1" = 30' DAR MET 02/06/2019 172270 40180 02/06/2019 DAVID A. REY FIELDPLANREMOVALS Addendum #2 02/22/2019 1Addendum #3 02/26/2019 2 1 C1.16 1 C1.16 1 C1.16 1 C1.16 1 C1.16 1 C1.16 1 C1.16 1 C1.16 1 C1.16 1 C1.16 1 C1.16 1 C1.16 1 C1.16 1 C1.16 1 C1.16 1 C1.16 1 C1.16 1 C1.16 1 C1.16 1 C1.16 1 C1.16 1 C1.16 LANDSCAPE ARCHITECTURE SITE PLANNING CIVIL ENGINEERING ANDERSON - JOHNSON ASSOCIATES, INC. 7575 GOLDEN VALLEY ROAD SUITE 200 MINNEAPOLIS. MN 55427 FAX (763) 544-0531 PH (763) 544-7129 DateRegistration Number Check Drawn Date: Comm I hereby certify that this plan, specification or report was prepared by me or under my direct supervision and that I am a duly Licensed under the laws of the State of Revisions Description Date Num Scale: North 501 South Eighth Street Minneapolis, MN 55404 krausanderson.com | 612 332 7281 MOUNDS VIEW HIGH SCHOOL 2019 IMPROVEMENTS 1900 Lake Valentine Road ARDEN HILLS, MINNESOTA 55112 4570 VICTORIA STREET N SHOREVIEW, MINNESOTA 55126 ISD #621: MOUNDS VIEW PUBLIC SCHOOLS PROFESSIONAL ENGINEER MINNESOTA C1.15 1" = 50' DAR MET 02/06/2019 172270 40180 02/06/2019 DAVID A. REY NORTHPLANPROTECTIONTREE 1 C1.16 1 C1.16 1 C1.16 1 C1.16 1 C1.16 1 C1.16 1 C1.16 1 C1.16 1 C1.16 1 C1.16 1 C1.16 1 C1.16 LANDSCAPE ARCHITECTURE SITE PLANNING CIVIL ENGINEERING ANDERSON - JOHNSON ASSOCIATES, INC. 7575 GOLDEN VALLEY ROAD SUITE 200 MINNEAPOLIS. MN 55427 FAX (763) 544-0531 PH (763) 544-7129 DateRegistration Number Check Drawn Date: Comm I hereby certify that this plan, specification or report was prepared by me or under my direct supervision and that I am a duly Licensed under the laws of the State of Revisions Description Date Num Scale: North 501 South Eighth Street Minneapolis, MN 55404 krausanderson.com | 612 332 7281 MOUNDS VIEW HIGH SCHOOL 2019 IMPROVEMENTS 1900 Lake Valentine Road ARDEN HILLS, MINNESOTA 55112 4570 VICTORIA STREET N SHOREVIEW, MINNESOTA 55126 ISD #621: MOUNDS VIEW PUBLIC SCHOOLS PROFESSIONAL ENGINEER MINNESOTA C1.16 1" = 50' DAR MET 02/06/2019 172270 40180 02/06/2019 DAVID A. REY SOUTHPLANPROTECTIONTREE TREE PROTECTION DRIPLINE VARIES. SET FENCE 6' OUTSIDE DRIPLINE UNLESS SITE OBSTRUCTIONS INTERFERE. POSTS SHALL BE 7' U-CHANNEL 1.12 LBS/FOOT STRENGTH PAINTED OR GALVANIZED FENCE: MEET OR EXCEED Mn/DOT 2572.2B (2000) TREE PROTECTION FENCING: 48" WOOD SNOW FENCING OR CONSTRUCTION GRADE CHAIN LINK. FASTEN TO POSTS WITH GALVANIZED WIRE TIES. NOTES: 1.ALL TREE PROTECTION FENCING AND EROSION CONTROL FENCING SHALL BE INSTALLED ACCORDING TO THE PLANS PRIOR TO ANY DEMOLITION. AFTER DEMOLITION OR AS NECESSARY, TREE PROTECTION FENCING MAY BE RELOCATED WITH APPROVAL FROM THE LANDSCAPE ARCHITECT. ALL TREE PROTECTION FENCING AND EROSION CONTROL DEVICES SHALL BE MAINTAINED FOR THE DURATION OF THE CONSTRUCTION PERIOD. 2. CONTRACTOR SHALL NOT STORE ANY MATERIALS OR PARK ANY VEHICLES IN TREE PROTECTION ZONES. THE FENCE SHALL PREVENT TRAFFIC MOVEMENT AND THE PLACEMENT OF TEMPORARY FACILITIES, EQUIPMENT, STOCKPILES AND SUPPLIES FROM HARMING VEGETATION WITHIN THE LIMITS OF PROTECTION. 3. THE CONTRACTOR SHALL CLEANLY CUT ALL ROOTS EXPOSED BY GRADING AS DIRECTED BY THE LANDSCAPE ARCHITECT. 4. THE CONTRACTOR SHALL USE DESIGNATED CONSTRUCTION ENTRANCES AND STAGING AREAS. 6' FROM DRIPLINE 6' MAX. POST SPACING DRIPLINE VARIES 1 C1.16 BUS PARKING (29 BUS STALLS) PROPOSED BUILDING ADDITION 'B' PROPOSED BUILDINGADDITION 'F' PROPOSED BUILDING ADDITION 'G' EAST PARKING (174 STALLS) WEST PARKING (8 BUS STALLS) SOUTH PARKING (14 BUS STALLS) ACCESSIBLE PARKING (14 STALLS) 174 17 12 NOPARKINGNOPARKINGNOPARKINGNOPARKINGNOPARKINGNOPARKINGNOPARKINGNOPARKING24.00' 36.00' 36.00' 24.00' 36.00' 24.00' 36.00' 24.00' 36.00' 24.00' 36.00' 24.00' 36.00' NORTH PARKING (483 STALLS) LANDSCAPE ARCHITECTURE SITE PLANNING CIVIL ENGINEERING ANDERSON - JOHNSON ASSOCIATES, INC. 7575 GOLDEN VALLEY ROAD SUITE 200 MINNEAPOLIS. MN 55427 FAX (763) 544-0531 PH (763) 544-7129 DateRegistration Number Check Drawn Date: Comm I hereby certify that this plan, specification or report was prepared by me or under my direct supervision and that I am a duly Licensed under the laws of the State of Revisions Description Date Num Scale: North 501 South Eighth Street Minneapolis, MN 55404 krausanderson.com | 612 332 7281 MOUNDS VIEW HIGH SCHOOL 2019 IMPROVEMENTS 1900 Lake Valentine Road ARDEN HILLS, MINNESOTA 55112 4570 VICTORIA STREET N SHOREVIEW, MINNESOTA 55126 ISD #621: MOUNDS VIEW PUBLIC SCHOOLS PROFESSIONAL ENGINEER MINNESOTA C1.20 1" = 60' DAR MET 02/06/2019 172270 40180 02/06/2019 DAVID A. REY DIAGRAMSCOPE LIMITS OF SITE CONSTRUCTION WEST PARKING (8 BUS STALLS) ACCESSIBLE PARKING (14 STALLS) 12 45°0'0"40.00'13.00'5.00'30.00' 4 UNITS TOTAL SIMILAR TO SIMILAR TO SIMILAR TO STANDARD ONE-WAY DIRECTIONAL COMBINED DIRECTIONAL TIERED PERPENDICULAR COMBINED DIRECTIONAL STANDARD ONE-WAY DIRECTIONAL STANDARD ONE-WAY DIRECTIONAL STANDARD ONE-WAY DIRECTIONAL GNOPARKINGNOPARKINGNOPARKINGNOPARKINGNOPARKINGNOPARKINGNPAR24.00' 36.00' 36.00' 24.00' 36.00' 24.00' 36.00' 24.00' 36.00' 24.00' 36.00' 24.00' 36.00' NORTH PARKING (483 STALLS) REFER TO SHEET C1.25 FOR LAKE VALENTINE ROAD RELATED PAINT STRIPING 9'X18' STALLS (TYPICAL) PAINTED ACCESSIBLE SYMBOL (TYPICAL) 4" PAINT STRIPE @ 3' O.C. WITH WORDS "NO PARKING" (TYPICAL)1 C2.13 1 C2.13 1 C2.13 1 C2.13 3 C2.13 TRANSITION CURB STYLES OVER 10' 3 C2.13 3 C2.13 C2.13 20 C2.13 19 2 C2.13 6 C2.13 6 C2.13 6 C2.13 6 C2.13 6 C2.13 6 C2.13 6 C2.13 6 C2.13 6 C2.13 6 C2.13 8 C2.13 8 C2.13 8 C2.13 9 C2.13 1 C2.14 2 C2.14 10 C2.13 10 C2.13 10 C2.13 11 C2.13 11 C2.13 12 C2.13 12 C2.13 12 C2.13 3 C2.13 3 C2.13 3 C2.13 3 C2.13 14 C2.13 C2.13 20 C2.13 19 C2.13 20 C2.13 19 C2.13 20 C2.13 19 C2.13 20 C2.13 19 C2.13 20 C2.13 19 2 C2.14 6 C2.13 C2.12 3 C2.12 21 C2.12 22 C2.13 1 C2.13 4 C2.12 4" PAINT STRIPE @ 3' O C WITH WORDS "NO REFER TO STRUCTURAL 5 C2.13 5 C2.13 5 C2.13 14 C2.13 DB16 C2.13 DB 17 C2.13 CB 12 C2.15 CB12 C2.15 CB12 C2.15 CB12 C2.15 DB 17 C2.13 DB 17 C2.13 EC2.13 16 FC2.13 16 FC2.13 16 17 C2.13A 17 C2.13A AC2.13 17 AC2.13 16 8 C2.13 11 C2.13 9 C2.13 9 C2.13 17 C2.13A 2 C2.14 2 C2.14 2 C2.14 2 C2.14 EC2.13 16 5' WIDE SIDEWALK 5' WIDE SIDEWALK 5' WIDE SIDEWALK 8' WIDE SIDEWALK 5' WIDE SIDEWALK 5' WIDE SIDEWALK2 C2.13 2 C2.13 7 C2.13 7 C2.13 BACK TO BACK PERPENDICULAR 1 C2.14 3 C2.16 3 C2.16 BACK TO BACK PERPENDICULAR 1 C2.14 STANDARD ONE-WAY DIRECTIONAL 2 C2.14 GC2.13 16 17 C2.13G NOTES: 1.REFER TO SHEET C1.34, GRADING AND DRAINAGE PLAN FIELDS, FOR GENERAL NOTES. 2. CHECK ALL PLAN AND DETAIL DIMENSIONS AND VERIFY SAME BEFORE FIELD LAYOUT. 3. SIGNAGE SHALL GENERALLY BE INSTALLED 18" BEHIND THE BACK OF CURB. 4. ALL DISTURBED AREAS OUTSIDE THE BUILDING PAD WHICH ARE NOT DESIGNATED TO BE PAVED SHALL RECEIVE AT LEAST 6" OF TOPSOIL AND SHALL BE SODDED OR SEEDED. 5. WHERE NEW SOD MEETS EXISTING TURF, EXISTING TURF EDGE SHALL BE CUT TO ALLOW FOR A CONSISTENT, UNIFORM STRAIGHT EDGE. JAGGED OR UNEVEN EDGES WILL NOT BE ACCEPTABLE. REMOVE TOPSOIL AT JOINT BETWEEN EXISTING AND NEW AS REQUIRED TO ALLOW NEW SOD SURFACE TO BE FLUSH WITH EXISTING. 6. FAILURE OF TURF DEVELOPMENT: IN THE EVENT THE CONTRACTOR FAILS TO PROVIDE AN ACCEPTABLE TURF, THE CONTRACTOR SHALL RE-SOD OR RE-SEED ALL APPLICABLE AREAS, AT NO ADDITIONAL COST TO THE OWNER, TO THE SATISFACTION OF THE ENGINEER. 7. ALL DIMENSIONS ARE TO FACE OF CURB, CENTERLINE OF FENCE, OR PROPERTY LINE UNLESS OTHERWISE NOTED. EXISTING PARKING COUNTS (680 TOTAL STALLS): NORTH PARKING = 158 CAR STALLS BUS / EAST PARKING = 446 CAR STALLS SOUTH PARKING = 68 STALLS WEST PARKING = 8 STALLS PROPOSED PARKING COUNTS (691 TOTAL CAR STALLS): NORTH PARKING = 483 STALLS BUS / EAST PARKING = 29 BUS STALLS, 174 CAR STALLS SOUTH PARKING = 14 STALLS WEST PARKING = 8 STALLS ACCESSIBLE PARKING = 16 STALLS ACCESSIBLE PARKING STALL REQUIREMENTS = 18 STALLS ACCESSIBLE PARKING STALLS PROVIDED = 20 STALLS SITE STATISTICS: LEGEND REFERENCE KEY TO SITE DETAILS DETAIL I.D NUMBER (TOP) DETAIL SHEET NUMBER (BOTTOM) PROPOSED CONCRETE WALK PROPOSED CONCRETE SLAB PROPOSED MEDIUM DUTY BITUMINOUS PAVEMENT PROPOSED HEAVY DUTY BITUMINOUS PAVEMENT PROPOSED LAKE VALENTINE ROAD BITUMINOUS PAVEMENT PROPOSED RETAINING WALL PROPOSED REINFORCED SOIL SLOPE (RSS) PROPOSED CHAIN LINK / DECORATIVE METAL FENCING WITH MAINTENANCE STRIP PROPOSED TRAFFIC CONTROL SIGN PAINTED ACCESSIBLE SYMBOL PROPOSED MANHOLE (MH) PROPOSED CATCH BASIN (CB) PROPOSED FLARED END SECTION (FES) PROPOSED HYDRANT (HYD) PROPOSED GATE VALVE (GV) PROPOSED BUILDING STOOP - REFER TO ARCHITECTURAL PLANS PROPERTY LINE 1 C2.11 6 C2.13 7 C2.13 10 C2.13 11 C2.13 12 C2.13 24 C2.11 1 C2.12 2 C2.12 3 C2.12 18 C2.13 19 C2.13 20 C2.13 13 C2.13 14 C2.13 15 C2.13 16 C2.13 17 C2.13 15 C2.11 19 C2.11 20 C2.11 22 C2.11 23 C2.11 17 C2.11 16 C2.11 LANDSCAPE ARCHITECTURE SITE PLANNING CIVIL ENGINEERING ANDERSON - JOHNSON ASSOCIATES, INC. 7575 GOLDEN VALLEY ROAD SUITE 200 MINNEAPOLIS. MN 55427 FAX (763) 544-0531 PH (763) 544-7129 DateRegistration Number Check Drawn Date: Comm I hereby certify that this plan, specification or report was prepared by me or under my direct supervision and that I am a duly Licensed under the laws of the State of Revisions Description Date Num Scale: North 501 South Eighth Street Minneapolis, MN 55404 krausanderson.com | 612 332 7281 MOUNDS VIEW HIGH SCHOOL 2019 IMPROVEMENTS 1900 Lake Valentine Road ARDEN HILLS, MINNESOTA 55112 4570 VICTORIA STREET N SHOREVIEW, MINNESOTA 55126 ISD #621: MOUNDS VIEW PUBLIC SCHOOLS PROFESSIONAL ENGINEER MINNESOTA C1.21 1" = 40' DAR MET 02/06/2019 172270 40180 02/06/2019 DAVID A. REY NORTHPLANFINISHING BUILDINGS: 246,897 SQ. FT. PARKING AND DRIVES: 390,962 SQ. FT. WALKWAYS: 80,981 SQ. FT. IMPERVIOUS SURFACE BREAKDOWN: MnMUTCD R1-1 (30"x30")A MnMUTCD S1-1 (30"x30")B MnMUTCD W16-7P (24"x12")C MnMUTCD W16-9P (24"x12")D MnMUTCD R4-7 (36"x30")E MnMUTCD R3-7 (30"x30")F SIGNAGE KEY NOTES MnMUTCD S5-1 (24"x48")25 SPEED LIMIT SCHOOL WHEN FLASHING G BUS PARKING (29 BUS STALLS) PROPOSED BUILDING ADDITION 'B' PROPOSED BUILDING ADDITION 'G' EAST PARKING (174 STALLS) WEST PARKING (8 BUS STALLS) SOUTH PARKING (14 BUS STALLS) ACCESSIBLE PARKING (14 STALLS) 17 12 5.00'45°0'0"45°0'0"40.00'13.00'40.00'13.00'5.00'30.00'73.88'REFER TO ARCHITECTURAL PLANS FOR DIMENSIONS AND LAYOUT REFER TO ARCHITECTURAL PLANS FOR DIMENSIONS AND LAYOUT MATCH EXISTING FENCE HEIGHT AND LAYOUT - NO MAINTENANCE STRIP 4 UNITS TOTAL MATCH EXISTING FENCE HEIGHT AND LAYOUT - NO MAINTENANCE STRIP MATCH EXISTING FENCE HEIGHT AND LAYOUT INCLUDING GATE SIZES AND LOCATIONS MATCH EXISTING FENCE HEIGHT AND LAYOUT INCLUDING GATE SIZES AND LOCATIONS - NO MAINTENANCE STRIP 3.89' 24.00' MATCH EXISTING FENCE HEIGHT AND LAYOUT - NO MAINTENANCE STRIP MATCH EXISTING FENCE HEIGHT AND LAYOUT - NO MAINTENANCE STRIP SIMILAR TO SIMILAR TO SIMILAR TO SIMILAR TO AY DIRECTIONAL COMBINED DIRECTIONAL COMBINED DIRECTIONAL DIRECTIONAL STANDARD ONE-WAY DIRECTIONAL STANDARD ONE-WAY DIRECTIONAL NOPARKINGNOPARKINGNOPARKINGNOPARKINGNOPARKINGNOPARKINGNOPARKINGNOPARKING12' WALK 9'X18' STALLS (TYPICAL) PAINTED ACCESSIBLE SYMBOL (TYPICAL) 4" PAINT STRIPE @ 3' O.C. WITH WORDS "NO PARKING" (TYPICAL)1 C2.13 1 C2.13 1 C2.13 1 C2.13 1 C2.13 1 C2.13 1 C2.13 ANSFORMER - REFER TO ECTRICAL PLANS K - REFER TO PLANS 1 C2.13 2 C2.13 3 C2.13 TRANSITION CURB STYLES OVER 10' 3 C2.13 3 C2.13 2 C2.13 4 C2.13 4 C2.13 5 C2.13 5 C2.13 5 C2.13 6 C2.13 6 C2.13 6 C2.13 6 C2.13 6 C2.13 6 C2.13 6 C2.13 6 C2.13 6 C2.13 C2.13 6 C2.13 6 C2.13 6 C2.13 7 C2.13 7 C2.13 7 C2.13 8 C2.13 8 C2.13 9 C2.13 2 C2.14 10 C2.13 11 C2.13 11 C2.13 11 C2.13 11 C2.13 11 C2.13 11 C2.13 11 C2.13 11 C2.13 11 C2.13 11 C2.13 11 C2.13 14 C2.13 C2.13 20 C2.13 19 C2.13 20 C2.13 19 C2.13 20 C2.13 192 C2.14 6 C2.13 C2.12 3 C2.12 21 C2.12 5 C2.13 1 C2.13 24 C2.11 18 C2.13 TIE INTO EXISTING RETAINING WALL. DISMANTLE EXISTING RETAINING WALL SYSTEM AS REQUIRED. TIE INTO EXISTING RETAINING WALL. DISMANTLE EXISTING RETAINING WALL SYSTEM AS REQUIRED. TIE INTO EXISTING RETAINING WALL AND EXISTING FENCE. DISMANTLE EXISTING RETAINING WALL SYSTEM AS REQUIRED. MATCH EXISTING FENCE HEIGHT AND CONCRETE MAINTENANCE STRIP / MOUNTING TO WALL. 18 C2.13 18 C2.13 6 C2.13 1 C2.13 4 C2.12 PLACE POST AS CLOSE AS POSSIBLE TO BUILDING PLACE POST MIN. 12" INSIDE BITUMINOUS LIMITS 18 C2.13 18 C2.13 3' WIDE SINGLE SWING GATE WITH LATCHING DEVICE 12' WIDE DOUBLE SWING GATE WITH LATCHING DEVICE 12' WIDE DOUBLE SWING GATE WITH LATCHING DEVICE 18 C2.13 10 C2.13 4" PAINT STRIPE @ 3' O.C. WITH WORDS "NO PARKING" (TYPICAL) REFER TO STRUCTURAL PLANS FOR WALL SECTION 1 C2.13 5 C2.13 5 C2.13 5 C2.13 5 C2.13 14 C2.13 1 C2.13 C2.13 18 C2.11 24 6 C2.13 CB 12 C2.15 CB12 C2.15 CB12 C2.15 DB 17 C2.13 DB 17 C2.13 EC2.13 16 17 C2.13A AC2.13 16 8 C2.13 11 C2.13 9 C2.13 9 C2.13 17 C2.13A 2 C2.14 C2.14 2 C2.14 2 C2.14 5' WIDE SIDEWALK 8' WIDE SIDEWALK 5' WIDE SIDEWALK 5' WIDE SIDEWALK 14 C2.13 2 C2.13 C2.13 7 C2.13 7 C2.13 BACK TO BACK PERPENDICULAR 1 C2.14 3 C2.16 BACK TO BACK PERPENDICULAR 1 C2.14 NOTES:LEGEND REFERENCE KEY TO SITE DETAILS DETAIL I.D NUMBER (TOP) DETAIL SHEET NUMBER (BOTTOM) PROPOSED CONCRETE WALK PROPOSED CONCRETE SLAB PROPOSED MEDIUM DUTY BITUMINOUS PAVEMENT PROPOSED HEAVY DUTY BITUMINOUS PAVEMENT PROPOSED LAKE VALENTINE ROAD BITUMINOUS PAVEMENT PROPOSED RETAINING WALL PROPOSED REINFORCED SOIL SLOPE (RSS) PROPOSED CHAIN LINK / DECORATIVE METAL FENCING WITH MAINTENANCE STRIP PROPOSED TRAFFIC CONTROL SIGN PAINTED ACCESSIBLE SYMBOL PROPOSED MANHOLE (MH) PROPOSED CATCH BASIN (CB) PROPOSED FLARED END SECTION (FES) PROPOSED HYDRANT (HYD) PROPOSED GATE VALVE (GV) PROPOSED BUILDING STOOP - REFER TO ARCHITECTURAL PLANS PROPERTY LINE 1 C2.11 6 C2.13 7 C2.13 10 C2.13 11 C2.13 12 C2.13 24 C2.11 1 C2.12 2 C2.12 3 C2.12 18 C2.13 19 C2.13 20 C2.13 13 C2.13 14 C2.13 15 C2.13 16 C2.13 17 C2.13 15 C2.11 19 C2.11 20 C2.11 22 C2.11 23 C2.11 17 C2.11 16 C2.11 LANDSCAPE ARCHITECTURE SITE PLANNING CIVIL ENGINEERING ANDERSON - JOHNSON ASSOCIATES, INC. 7575 GOLDEN VALLEY ROAD SUITE 200 MINNEAPOLIS. MN 55427 FAX (763) 544-0531 PH (763) 544-7129 DateRegistration Number Check Drawn Date: Comm I hereby certify that this plan, specification or report was prepared by me or under my direct supervision and that I am a duly Licensed under the laws of the State of Revisions Description Date Num Scale: North 501 South Eighth Street Minneapolis, MN 55404 krausanderson.com | 612 332 7281 MOUNDS VIEW HIGH SCHOOL 2019 IMPROVEMENTS 1900 Lake Valentine Road ARDEN HILLS, MINNESOTA 55112 4570 VICTORIA STREET N SHOREVIEW, MINNESOTA 55126 ISD #621: MOUNDS VIEW PUBLIC SCHOOLS PROFESSIONAL ENGINEER MINNESOTA C1.22 1" = 30' DAR MET 02/06/2019 172270 40180 02/06/2019 DAVID A. REY CENTERPLANFINISHING Addendum #2 02/22/2019 1 1. REFER TO SHEET C1.34, GRADING AND DRAINAGE PLAN FIELDS, FOR GENERAL NOTES. 2. CHECK ALL PLAN AND DETAIL DIMENSIONS AND VERIFY SAME BEFORE FIELD LAYOUT. 3. SIGNAGE SHALL GENERALLY BE INSTALLED 18" BEHIND THE BACK OF CURB. 4. ALL DISTURBED AREAS OUTSIDE THE BUILDING PAD WHICH ARE NOT DESIGNATED TO BE PAVED SHALL RECEIVE AT LEAST 6" OF TOPSOIL AND SHALL BE SODDED OR SEEDED. 5. WHERE NEW SOD MEETS EXISTING TURF, EXISTING TURF EDGE SHALL BE CUT TO ALLOW FOR A CONSISTENT, UNIFORM STRAIGHT EDGE. JAGGED OR UNEVEN EDGES WILL NOT BE ACCEPTABLE. REMOVE TOPSOIL AT JOINT BETWEEN EXISTING AND NEW AS REQUIRED TO ALLOW NEW SOD SURFACE TO BE FLUSH WITH EXISTING. 6. FAILURE OF TURF DEVELOPMENT: IN THE EVENT THE CONTRACTOR FAILS TO PROVIDE AN ACCEPTABLE TURF, THE CONTRACTOR SHALL RE-SOD OR RE-SEED ALL APPLICABLE AREAS, AT NO ADDITIONAL COST TO THE OWNER, TO THE SATISFACTION OF THE ENGINEER. 7. ALL DIMENSIONS ARE TO FACE OF CURB, CENTERLINE OF FENCE, OR PROPERTY LINE UNLESS OTHERWISE NOTED. 1 PROPOSED BUILDING ADDITION 'B' PROPOSED BUILDINGADDITION 'F' PROPOSED BUILDING ADDITION 'G' SOUTH PARKING (14 BUS STALLS)45°0'0REFER TO ARCHITECTURAL PLANS FOR DIMENSIONS AND LAYOUT REFER TO ARCHITECTURAL PLANS FOR DIMENSIONS AND LAYOUT REFER TO ARCHITECTURAL PLANS FOR DIMENSIONS AND LAYOUT MATCH EXISTING FENCE HEIGHT AND LAYOUT - NO MAINTENANCE STRIP MATCH EXISTING FENCE HEIGHT AND LAYOUT INCLUDING GATE SIZES AND LOCATIONS MATCH EXISTING FENCE HEIGHT AND LAYOUT - NO MAINTENANCE STRIP MATCH EXISTING FENCE HEIGHT AND LAYOUT - NO MAINTENANCE STRIP TO 12' WALK 1 C2.13 1 C2.13 1 C2.13 1 C2.13 1 C2.13 1 C2.13 TRANSFORMER - REFER TO ELECTRICAL PLANS FUEL OIL TANK - REFER TO MECHANICAL PLANS 1 C2.13 1 C2.13 1 C2.13 C2.13 18 C2.11 24 4 C2.13 5 C2.13 5 C2.13 5 C2.13 6 C2.13 6 C2.13 6 C2.13 7 C2.13 7 C2.13 11 C2.1311 C2.13 11 C2.13 11 C2.13 11 C2.13 11 C2.13 11 C2.13 11 C2.13 11 C2.13 11 C2.13 11 C2.13 11 C2.13 C2.13 18 C2.11 24 C2.13 18 C2.11 24 C2.13 20 C2.13 18 C2.12 3 C2.12 21 C2.12 C2.13 20 C2.13 18 1 C2.12 C2.12 3 C2.12 21 C2.12 C2.13 20 C2.13 18 C2.12 3 C2.12 2 1 C2.12 C2.13 20 C2.13 18 C2.12 3 C2.12 2 21 C2.13 5 C2.13 5 C2.13 1 C2.13 24 C2.11 18 C2.13 TIE INTO EXISTING RETAINING WALL. DISMANTLE EXISTING RETAINING WALL SYSTEM AS REQUIRED. TIE INTO EXISTING RETAINING WALL. DISMANTLE EXISTING RETAINING WALL SYSTEM AS REQUIRED. TIE INTO EXISTING RETAINING WALL AND EXISTING FENCE. DISMANTLE EXISTING RETAINING WALL SYSTEM AS REQUIRED. MATCH EXISTING FENCE HEIGHT AND CONCRETE MAINTENANCE STRIP / MOUNTING TO WALL. 18 C2.13 18 C2.13 6 C2.13 6 C2.13 6 C2.13 6 C2.13 PLACE POST AS CLOSE AS POSSIBLE TO BUILDING PLACE POST MIN. 12" INSIDE BITUMINOUS LIMITS 18 C2.13 3' WIDE SINGLE SWING GA WITH LATCHING DEVICE 5 C2.13 5 C2.13 TIE INTO EXISTING RETAINING WALL AND EXISTING FENCE. DISMANTLE EXISTING RETAINING WALL SYSTEM AS REQUIRED. MATCH EXISTING FENCE HEIGHT AND CONCRETE MAINTENANCE STRIP / MOUNTING TO WALL. 1 C2.13 C2.13 1 C2.13 C2.13 18 C2.11 24 6 C2.13 9 C2.13 14 C2.13 NOTES: LEGEND REFERENCE KEY TO SITE DETAILS DETAIL I.D NUMBER (TOP) DETAIL SHEET NUMBER (BOTTOM) PROPOSED CONCRETE WALK PROPOSED CONCRETE SLAB PROPOSED MEDIUM DUTY BITUMINOUS PAVEMENT PROPOSED HEAVY DUTY BITUMINOUS PAVEMENT PROPOSED LAKE VALENTINE ROAD BITUMINOUS PAVEMENT PROPOSED RETAINING WALL PROPOSED REINFORCED SOIL SLOPE (RSS) PROPOSED CHAIN LINK / DECORATIVE METAL FENCING WITH MAINTENANCE STRIP PROPOSED TRAFFIC CONTROL SIGN PAINTED ACCESSIBLE SYMBOL PROPOSED MANHOLE (MH) PROPOSED CATCH BASIN (CB) PROPOSED FLARED END SECTION (FES) PROPOSED HYDRANT (HYD) PROPOSED GATE VALVE (GV) PROPOSED BUILDING STOOP - REFER TO ARCHITECTURAL PLANS PROPERTY LINE 1 C2.11 6 C2.13 7 C2.13 10 C2.13 11 C2.13 12 C2.13 24 C2.11 1 C2.12 2 C2.12 3 C2.12 18 C2.13 19 C2.13 20 C2.13 13 C2.13 14 C2.13 15 C2.13 16 C2.13 17 C2.13 15 C2.11 19 C2.11 20 C2.11 22 C2.11 23 C2.11 17 C2.11 16 C2.11 LANDSCAPE ARCHITECTURE SITE PLANNING CIVIL ENGINEERING ANDERSON - JOHNSON ASSOCIATES, INC. 7575 GOLDEN VALLEY ROAD SUITE 200 MINNEAPOLIS. MN 55427 FAX (763) 544-0531 PH (763) 544-7129 DateRegistration Number Check Drawn Date: Comm I hereby certify that this plan, specification or report was prepared by me or under my direct supervision and that I am a duly Licensed under the laws of the State of Revisions Description Date Num Scale: North 501 South Eighth Street Minneapolis, MN 55404 krausanderson.com | 612 332 7281 MOUNDS VIEW HIGH SCHOOL 2019 IMPROVEMENTS 1900 Lake Valentine Road ARDEN HILLS, MINNESOTA 55112 4570 VICTORIA STREET N SHOREVIEW, MINNESOTA 55126 ISD #621: MOUNDS VIEW PUBLIC SCHOOLS PROFESSIONAL ENGINEER MINNESOTA C1.23 1" = 30' DAR MET 02/06/2019 172270 40180 02/06/2019 DAVID A. REY SOUTHPLANFINISHING Addendum #2 02/22/2019 1 1. REFER TO SHEET C1.34, GRADING AND DRAINAGE PLAN FIELDS, FOR GENERAL NOTES. 2. CHECK ALL PLAN AND DETAIL DIMENSIONS AND VERIFY SAME BEFORE FIELD LAYOUT. 3. SIGNAGE SHALL GENERALLY BE INSTALLED 18" BEHIND THE BACK OF CURB. 4. ALL DISTURBED AREAS OUTSIDE THE BUILDING PAD WHICH ARE NOT DESIGNATED TO BE PAVED SHALL RECEIVE AT LEAST 6" OF TOPSOIL AND SHALL BE SODDED OR SEEDED. 5. WHERE NEW SOD MEETS EXISTING TURF, EXISTING TURF EDGE SHALL BE CUT TO ALLOW FOR A CONSISTENT, UNIFORM STRAIGHT EDGE. JAGGED OR UNEVEN EDGES WILL NOT BE ACCEPTABLE. REMOVE TOPSOIL AT JOINT BETWEEN EXISTING AND NEW AS REQUIRED TO ALLOW NEW SOD SURFACE TO BE FLUSH WITH EXISTING. 6. FAILURE OF TURF DEVELOPMENT: IN THE EVENT THE CONTRACTOR FAILS TO PROVIDE AN ACCEPTABLE TURF, THE CONTRACTOR SHALL RE-SOD OR RE-SEED ALL APPLICABLE AREAS, AT NO ADDITIONAL COST TO THE OWNER, TO THE SATISFACTION OF THE ENGINEER. 7. ALL DIMENSIONS ARE TO FACE OF CURB, CENTERLINE OF FENCE, OR PROPERTY LINE UNLESS OTHERWISE NOTED. Addendum #3 02/26/2019 2 PROPOSED FOOTBALL / LACROSSE FIELD (180' X 360') 461.70' MEASURED ALONG PROPERTY LINE54.68'90 ° 0 ' 0 "113°19'53"180.00'360.00 ' 4 C2.15 4 C2.15 4 C2.15 4 C2.15 NOTES:LEGEND REFERENCE KEY TO SITE DETAILS DETAIL I.D NUMBER (TOP) DETAIL SHEET NUMBER (BOTTOM) PROPOSED CONCRETE WALK PROPOSED CONCRETE SLAB PROPOSED MEDIUM DUTY BITUMINOUS PAVEMENT PROPOSED HEAVY DUTY BITUMINOUS PAVEMENT PROPOSED LAKE VALENTINE ROAD BITUMINOUS PAVEMENT PROPOSED RETAINING WALL PROPOSED REINFORCED SOIL SLOPE (RSS) PROPOSED CHAIN LINK / DECORATIVE METAL FENCING WITH MAINTENANCE STRIP PROPOSED TRAFFIC CONTROL SIGN PAINTED ACCESSIBLE SYMBOL PROPOSED MANHOLE (MH) PROPOSED CATCH BASIN (CB) PROPOSED FLARED END SECTION (FES) PROPOSED HYDRANT (HYD) PROPOSED GATE VALVE (GV) PROPOSED BUILDING STOOP - REFER TO ARCHITECTURAL PLANS PROPERTY LINE 1 C2.11 6 C2.13 7 C2.13 10 C2.13 11 C2.13 12 C2.13 24 C2.11 1 C2.12 2 C2.12 3 C2.12 18 C2.13 19 C2.13 20 C2.13 13 C2.13 14 C2.13 15 C2.13 16 C2.13 17 C2.13 15 C2.11 19 C2.11 20 C2.11 22 C2.11 23 C2.11 17 C2.11 16 C2.11 LANDSCAPE ARCHITECTURE SITE PLANNING CIVIL ENGINEERING ANDERSON - JOHNSON ASSOCIATES, INC. 7575 GOLDEN VALLEY ROAD SUITE 200 MINNEAPOLIS. MN 55427 FAX (763) 544-0531 PH (763) 544-7129 DateRegistration Number Check Drawn Date: Comm I hereby certify that this plan, specification or report was prepared by me or under my direct supervision and that I am a duly Licensed under the laws of the State of Revisions Description Date Num Scale: North 501 South Eighth Street Minneapolis, MN 55404 krausanderson.com | 612 332 7281 MOUNDS VIEW HIGH SCHOOL 2019 IMPROVEMENTS 1900 Lake Valentine Road ARDEN HILLS, MINNESOTA 55112 4570 VICTORIA STREET N SHOREVIEW, MINNESOTA 55126 ISD #621: MOUNDS VIEW PUBLIC SCHOOLS PROFESSIONAL ENGINEER MINNESOTA C1.24 1" = 30' DAR MET 02/06/2019 172270 40180 02/06/2019 DAVID A. REY FIELDPLANFINISHING 1.REFER TO SHEET C1.34, GRADING AND DRAINAGE PLAN FIELDS, FOR GENERAL NOTES. 2. CHECK ALL PLAN AND DETAIL DIMENSIONS AND VERIFY SAME BEFORE FIELD LAYOUT. 3. SIGNAGE SHALL GENERALLY BE INSTALLED 18" BEHIND THE BACK OF CURB. 4. ALL DISTURBED AREAS OUTSIDE THE BUILDING PAD WHICH ARE NOT DESIGNATED TO BE PAVED SHALL RECEIVE AT LEAST 6" OF TOPSOIL AND SHALL BE SODDED OR SEEDED. 5. WHERE NEW SOD MEETS EXISTING TURF, EXISTING TURF EDGE SHALL BE CUT TO ALLOW FOR A CONSISTENT, UNIFORM STRAIGHT EDGE. JAGGED OR UNEVEN EDGES WILL NOT BE ACCEPTABLE. REMOVE TOPSOIL AT JOINT BETWEEN EXISTING AND NEW AS REQUIRED TO ALLOW NEW SOD SURFACE TO BE FLUSH WITH EXISTING. 6. FAILURE OF TURF DEVELOPMENT: IN THE EVENT THE CONTRACTOR FAILS TO PROVIDE AN ACCEPTABLE TURF, THE CONTRACTOR SHALL RE-SOD OR RE-SEED ALL APPLICABLE AREAS, AT NO ADDITIONAL COST TO THE OWNER, TO THE SATISFACTION OF THE ENGINEER. Addendum #3 02/26/2019 2 BUS PARKING (29 BUS STALLS) EAST PARKING (174 STALLS) WEST PARKING (8 BUS STALLS) 17 12 NOPARKINGNOPARKINGNOPARKINGNOPARKINGNOPARKINGNOPARKINGNOPARKINGNOPARKINGNORTH PARKING (483 STALLS) PAINTED DIRECTIONAL ARROW 24" SOLID WHITE PAINTED STOP BAR 24" SOLID WHITE PAINTED STOP BAR 4" WIDE SINGLE WHITE PAINT STRIPE 24" SOLID YELLOW LINE @ 30' O.C. WITH DOUBLE 4" YELLOW LINE BORDER. GRIND OR BLAST EXISTING PAINT STRIPING. LIMITS SHALL MATCH THE EXISTING CENTER LANE MARKINGS PER MnDOT CROSSWALK DETAIL - CROSSWALK BLOCKS SHALL BE 2.5' x 6' @ 5.5' O.C. (3' SPACE) PER MnDOT CROSSWALK DETAIL - CROSSWALK BLOCKS SHALL BE 2.5' x 6' @ 5.5' O.C. (3' SPACE) PER MnDOT CROSSWALK DETAIL - CROSSWALK BLOCKS SHALL BE 2.5' x 6' @ 5.5' O.C. (3' SPACE) 24" SOLID WHITE PAINTED STOP BAR PER MnDOT CROSSWALK DETAIL - CROSSWALK BLOCKS SHALL BE 2.5' x 6' @ 5.5' O.C. (3' SPACE) PAINTED DIRECTIONAL ARROW PER MnDOT CROSSWALK DETAIL - CROSSWALK BLOCKS SHALL BE 2.5' x 6' @ 5.5' O.C. (3' SPACE) PAINTED 'STOP' BAR PER MnDOT CROSSWALK DETAIL - CROSSWALK BLOCKS SHALL BE 2.5' x 6' @ 5.5' O.C. (3' SPACE) R35.00' R35 . 0 0 'R55.00 'R35.00' R 3 5 . 0 0 'R100.00'15:1 L A N E T A P E R R35.00'11' LANE WIDTH11' LANE WIDTHR35.00'24.00' 30.00' 30.00' 34.85' (EXISTING) R20.00'R35.00'12'12'13'R310.00'R310.00'13'13'12'12'4" WIDE PAINT STRIPE @ 3' O.C.R35.00'4" WIDE DOUBLE YELLOW PAINT STRIPE R25.00'EQEQ24.00'R35.00 ' R35.00' 20' FIRE L A N E R120.00' 120' TURN LANES 125' TAPER 110' TUR N L A N E 105' TAPER 23 C2.13 TYPICAL SECTION ALIGN WITH EXISTING LANE STRIPING 4" WIDE SINGLE YELLOW SOLID PAINT STRIPE WITH 4" YELLOW 6' LONG DASH AT 45' O.C. (MATCH EXISTING LANE STRIPING) 4" WIDE SINGLE YELLOW SOLID PAINT STRIPE WITH 4" YELLOW 6' LONG DASH AT 45' O.C. (MATCH EXISTING LANE STRIPING) LANDSCAPE ARCHITECTURE SITE PLANNING CIVIL ENGINEERING ANDERSON - JOHNSON ASSOCIATES, INC. 7575 GOLDEN VALLEY ROAD SUITE 200 MINNEAPOLIS. MN 55427 FAX (763) 544-0531 PH (763) 544-7129 DateRegistration Number Check Drawn Date: Comm I hereby certify that this plan, specification or report was prepared by me or under my direct supervision and that I am a duly Licensed under the laws of the State of Revisions Description Date Num Scale: North 501 South Eighth Street Minneapolis, MN 55404 krausanderson.com | 612 332 7281 MOUNDS VIEW HIGH SCHOOL 2019 IMPROVEMENTS 1900 Lake Valentine Road ARDEN HILLS, MINNESOTA 55112 4570 VICTORIA STREET N SHOREVIEW, MINNESOTA 55126 ISD #621: MOUNDS VIEW PUBLIC SCHOOLS PROFESSIONAL ENGINEER MINNESOTA C1.25 1" = 30' DAR MET 02/06/2019 172270 40180 02/06/2019 DAVID A. REY ROADVALENTINELAKE MnMUTCD R1-1 (30"x30")A MnMUTCD S1-1 (30"x30")B MnMUTCD W16-7P (24"x12")C MnMUTCD W16-9P (24"x12")D MnMUTCD R4-7 (36"x30")E MnMUTCD R3-7 (30"x30")F SIGNAGE KEY NOTES CROSSWALK SIGN WITH FLASHING SIGNAL NOTES: 1.ALL DIMENSIONS ARE TO FACE OF CURB UNLESS OTHERWISE NOTED. MnMUTCD S5-1 (24"x48")25 SPEED LIMIT SCHOOL WHEN FLASHING G 25 SPEED LIMIT SCHOOL WHEN FLASHING 25 SPEED LIMIT SCHOOL WHEN FLASHING 23 15 17 12NOPARKING NOPARKINGNOPARKINGNOPARKINGNOPARKINGNOPARKINGNOPARKINGNOPARKINGNORTH PARKING (501 STALLS) BUS PARKING (29 BUS STALLS) 58 56 58 52 32 34 34 26 23 26 26 EAST PARKING (174 STALLS) WEST PARKING (8 BUS STALLS)NOPARKINGNOPARKINGNOPARKINGNOPARKINGNOPARKINGNOPARKINGLANDSCAPE ARCHITECTURE SITE PLANNING CIVIL ENGINEERING ANDERSON - JOHNSON ASSOCIATES, INC. 7575 GOLDEN VALLEY ROAD SUITE 200 MINNEAPOLIS. MN 55427 FAX (763) 544-0531 PH (763) 544-7129 DateRegistration Number Check Drawn Date: Comm I hereby certify that this plan, specification or report was prepared by me or under my direct supervision and that I am a duly Licensed under the laws of the State of Revisions Description Date Num Scale: North 501 South Eighth Street Minneapolis, MN 55404 krausanderson.com | 612 332 7281 MOUNDS VIEW HIGH SCHOOL 2019 IMPROVEMENTS 1900 Lake Valentine Road ARDEN HILLS, MINNESOTA 55112 4570 VICTORIA STREET N SHOREVIEW, MINNESOTA 55126 ISD #621: MOUNDS VIEW PUBLIC SCHOOLS PROFESSIONAL ENGINEER MINNESOTA C1.26 1" = 30' DAR MET 02/06/2019 172270 40180 02/06/2019 DAVID A. REY MOTIONSFIRE TRUCK F 0" 6" F F F F 6" 6" 6" 6" 6" 6" 6" 6" 6" 0"0"0" 0"0" 0" 0" 0" 0" 0" 0" F 0"6"0" 0" 0" 0" 0" 0" 0" 6" 6"6" 6" 6" F F F F F F 6" 0" 0" 6" 6" 0" 0" 6" 0" 0" 6" 6" LANDSCAPE ARCHITECTURE SITE PLANNING CIVIL ENGINEERING ANDERSON - JOHNSON ASSOCIATES, INC. 7575 GOLDEN VALLEY ROAD SUITE 200 MINNEAPOLIS. MN 55427 FAX (763) 544-0531 PH (763) 544-7129 DateRegistration Number Check Drawn Date: Comm I hereby certify that this plan, specification or report was prepared by me or under my direct supervision and that I am a duly Licensed under the laws of the State of Revisions Description Date Num Scale: North 501 South Eighth Street Minneapolis, MN 55404 krausanderson.com | 612 332 7281 MOUNDS VIEW HIGH SCHOOL 2019 IMPROVEMENTS 1900 Lake Valentine Road ARDEN HILLS, MINNESOTA 55112 4570 VICTORIA STREET N SHOREVIEW, MINNESOTA 55126 ISD #621: MOUNDS VIEW PUBLIC SCHOOLS PROFESSIONAL ENGINEER MINNESOTA C1.27 1" = 20' DAR MET 02/06/2019 172270 40180 02/06/2019 DAVID A. REY DETAILSINTERSECTION 1 C1.27 WEST INTERSECTION 2 C1.27 CENTRAL INTERSECTION 3 C1.27 EAST INTERSECTION LEGEND CONTROL POINTS AT GUTTER FLOW LINE TRUNCATED DOMES (SEE STANDARD PLATE 7038) CURB HEIGHT LANDING AREA - 4' X 4' MIN. DIMENSIONS AND MAX 2.0% SLOPE IN ALL DIRECTIONS INDICATES PEDESTRIAN RAMP - SLOPE SHALL BE BETWEEN 5.0% MINIMUM AND 8.3% MAXIMUM IN THE DIRECTION SHOWN AND CROSS SLOPE SHALL NOT EXCEED 2.0% INDICATES PEDESTRIAN RAMP - SLOPE SHALL BE GREATER THAN 2.0% AND LESS THAN 5.0% IN THE DIRECTION SHOWN AND CROSS SLOPE SHALL NOT EXCEED 2.0% DRAINAGE FLOW ARROW TRAFFIC FLOW ARROW S F XXX X" 913 9 1 1 911 911 9129 1 2 913 9 1 3 914 9 1 4 9149159 1 69099 1 0911 912913 9 1 4 91 5 915 91 6 906 907 911 912 9 1 2 913 14.8 14.7 14.3 14.2 14.1 13.8 13.7 13.5 13.4 13.2 13.1 12.9 11.8 11.2 ME 11.7 ME12.3 ME 05.4 ME 07.4 ME 07.3 ME 07.6 ME 08.7 ME 09.1 ME 12.9 ME 15.5 15.1 15.3 15.4 13.5 13.3 15.3 15.2 15.6 15.4 14.1 14.715.7 15.8 13.7 13.8 18.1 ME 17.7 15.0 ME 15.9 ME 16.6 ME 17.0 ME 12.7 ME 12.6 ME 12.3 ME 11.9 ME 11.9 ME 14.0 14.0 13.212.813.0 12.2 ME 12.2 ME 12.3 ME 12.8 ME 12.8 ME 12.4 ME 12.4 12.4 12.4 12.4 12.4 12.4 12.6 ME 12.6 ME 13.3 ME13.7 ME 13.3 ME 14.0 13.8 13.6 13.8 14.0 13.8 14.1 13.9 14.2 14.0 ME 14.8 14.1 13.9 ME 10.0 ME 11.8 ME 13.3 ME 14.3 ME 15.1 ME 15.3 ME 15.9 ME 15.8 ME 15.6 ME 15.3 ME 14.7 ME 15.9 ME 15.6 ME 16.1 ME 15.7 ME 16.7 ME 15.9 ME 15.7 ME 15.5 ME 14.8 ME 14.3 ME 13.4 ME 12.7 ME 06.2 ME 10.6 ME 10.5 ME 11.7 12.3 12.5 13.2 13.8 14.1 14.7 14.9 14.8 15.4 15.6 15.1 15.7 15.9 14.9 14.8 20.5 ME 20.5 ME 11.7 ME 12.7 ME 12.5 ME 12.6 ME 12.7 15.4 15.7 15.4 15.1 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 12.0 ME12.2 ME 12.1 ME12.5 ME 12.2 12.3 12.1 12.2 12.3 12.2 12.8 12.7 12.7 12.6 12.4 12.3 12.4 12.3 11.6 11.2 11.1 09.0 ME 09.4 ME 09.8 ME 09.1 ME 14.8 14.5 14.3 ME 14.6 ME 14.7 ME 13.1 ME 13.2 ME 13.3 13.2 12.6 ME 12.6 ME 15.1 ME 16.0 15.4 15.6 ME 11.9 EOF 13.4 ME 12.9 ME 17.2 15.7 15.5 15.2 15.4 16.8 16.7 913 914 915 903903 903903903904904904 904904 905906907 90707.8 07.8 07.8 06.6 EOF 07.8 07.8 07.8 07.8 07.8 WEST PARKING (8 BUS STALLS) ACCESSIBLE PARKING (14 STALLS) MATCH EXISTING GRADES FOR RESTORATION WORK OUTSIDE OF GRADING LIMITS (TYPICAL) MATCH EXISTING GRADES FOR RESTORATION WORK OUTSIDE OF GRADING LIMITS (TYPICAL) STORM WATER POND SOUTH LOBE BOTTOM = 898.00 NWL = 903.50 HWL = 906.63 EOF = 907.00 STORM WATER POND NORTH LOBE BOTTOM = 894.50 NWL = 903.50 HWL = 906.63 EOF = 907.00 NORTH PARKING (483 STALLS) LEGEND 915 15.6 1.)Top of top nut of fire hydrant, approx. 115 feet north of door #2, north of school Elevation = 920.79 feet 2.)Top of top nut of fire hydrant, west of southerly building corner Elevation = 927.71 feet 3.)Top of top nut of fire hydrant, north of Lake Valentine Rd., west of west entrance to bus garage Elevation = 918.17 feet BENCHMARKS (FIELD VERIFY BEFORE USING)NOTES: 1.REFER TO SHEET C1.34, GRADING AND DRAINAGE PLAN FIELDS, FOR GENERAL NOTES. 15 C2.11 19 C2.11 20 C2.11 22 C2.11 23 C2.11 17 C2.11 16 C2.11 1 C2.11 5 C2.11 LANDSCAPE ARCHITECTURE SITE PLANNING CIVIL ENGINEERING ANDERSON - JOHNSON ASSOCIATES, INC. 7575 GOLDEN VALLEY ROAD SUITE 200 MINNEAPOLIS. MN 55427 FAX (763) 544-0531 PH (763) 544-7129 DateRegistration Number Check Drawn Date: Comm I hereby certify that this plan, specification or report was prepared by me or under my direct supervision and that I am a duly Licensed under the laws of the State of Revisions Description Date Num Scale: North 501 South Eighth Street Minneapolis, MN 55404 krausanderson.com | 612 332 7281 MOUNDS VIEW HIGH SCHOOL 2019 IMPROVEMENTS 1900 Lake Valentine Road ARDEN HILLS, MINNESOTA 55112 4570 VICTORIA STREET N SHOREVIEW, MINNESOTA 55126 ISD #621: MOUNDS VIEW PUBLIC SCHOOLS PROFESSIONAL ENGINEER MINNESOTA C1.31 1" = 40' DAR MET 02/06/2019 172270 40180 02/06/2019 DAVID A. REY NORTHPLANDRAINAGEGRADING AND REFERENCE KEY TO SITE DETAILS DETAIL I.D NUMBER (TOP) DETAIL SHEET NUMBER (BOTTOM) EXISTING CONTOUR EXISTING SPOT ELEVATION PROPOSED CONTOUR PROPOSED SPOT ELEVATION ME = MATCH EXISTING EOF = EMERGENCY OVERFLOW PROPOSED GRADING LIMITS PROPOSED SAND SUBBASE AT FROST FOOTED STOOPS APPROXIMATE SOIL BORING LOCATION PROPOSED MANHOLE (MH) PROPOSED CATCH BASIN (CB) PROPOSED FLARED END SECTION (FES) PROPOSED HYDRANT (HYD) PROPOSED GATE VALVE (GV) PROPOSED BUILDING STOOP - REFER TO ARCHITECTURAL PLANS PROPERTY LINE 913 9 1 1 911 911 9129 1 2 913 9 1 3 925 6 7 914 9 1 4 914 915915915 9 1 6 9 1 6 917 91 7 91 7 917918918 919920 915 91 6 906 907 911 912 9 1 2 913 27.4 ME 26.9 26.9 27.427.427.427.427.4 27.3 ME 27.1 17.5 ME 18.7 ME 19.1 ME 18.7 ME 18.4 ME 18.4 ME20.9 ME 18.9 ME 18.3 17.8 18.018.018.0 18.0 13.8 13.7 13.5 13.4 13.2 13.1 12.9 11.8 11.2 ME 11.7 ME12.3 ME 07.4 ME 07.3 ME 07.6 ME 12.9 ME 17.5 17.1 15.5 14.7 ME 17.2 17.1 16.9 16.6 16.8 16.7 15.1 15.3 15.4 13.5 13.3 15.3 15.2 15.6 17.9 17.9 17.7 20.8 20.6 21.4 17.5 16.5 17.8 17.6 17.3 18.0 17.2 16.7 16.0 17.2 16.7 16.8 16.6 15.4 14.1 14.715.7 15.8 17.0 17.7 13.7 13.8 22.4 22.5 22.7 22.6 26.8 23.0 ME 22.7 ME 19.0 ME 18.9 ME 18.1 ME 18.5 ME 17.7 18.0 18.1 15.0 ME 15.9 ME 16.6 ME 17.0 ME 12.7 ME 12.6 ME 12.3 ME 11.9 ME 11.9 ME 14.0 14.0 13.212.813.0 12.2 ME 12.2 ME 12.3 ME 12.8 ME 12.8 ME 12.4 ME 12.4 12.4 12.4 12.4 12.4 12.4 12.6 ME 12.6 ME 13.3 ME 13.7 ME 13.8 ME 13.7 ME 13.3 ME 14.0 13.8 13.6 13.8 14.0 13.8 14.1 13.9 14.2 14.0 ME 14.8 14.1 13.9 ME 17.0 ME 14.7 ME 15.9 ME 15.6 ME 16.1 ME 15.7 ME 15.7 15.9 14.9 14.8 20.5 ME 17.9 11.7 ME 12.7 ME 13.6 ME 14.3 ME 14.2 ME 13.8 ME 13.3 ME 12.5 ME 12.6 ME 13.3 13.8 14.2 13.8 13.9 ME 13.6 12.7 17.517.5 16.9 16.9 17.217.5 21.421.2 17.4 17.9 18.5 15.4 15.7 15.4 15.1 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 14.5 ME 14.5 ME 14.5 ME 14.8 ME 14.9 ME 14.5 ME14.5 ME 14.6 ME 17.2 ME 17.5 ME 16.6 ME 15.1 ME 17.4 ME 17.5 ME 18.2 ME 18.2 ME 19.4 ME 16.4 16.6 ME 16.2 ME 15.8 ME 15.6 ME 15.2 ME 15.3 ME 15.9 16.0 16.3 16.5 16.9 17.3 17.7 17.5 18.2 17.1 16.8 16.7 18.2 ME 6 E 26.5 ME 25.7 ME 25.4 ME 24.7 ME 25.2 ME 30.6 ME25 4 12.0 ME12.2 ME 12.1 ME12.5 ME 12.2 12.3 12.1 12.2 12.3 12.2 12.8 12.7 12.7 12.6 12.4 12.3 12.4 12.3 11.6 11.2 11.1 09.0 ME 09.4 ME 09.8 ME 09.1 ME 13.1 ME 13.2 ME 13.3 13.2 12.6 ME 12.6 ME 20.0 21.7 23.8 31.5 28.8 32.627.1 24.6 15.1 ME 16.0 15.4 15.6 ME 11.9 EOF 18.0 17.8 19.1 18.3 19.5 13.4 ME 12.9 ME 17.7 17.2 15.7 16.9 15.5 15.2 15.4 16.8 16.7 17.9 7 27.2 ME 914 BUS PARKING (29 BUS STALLS) PROPOSED BUILDING ADDITION 'B' PROPOSED BUILDING ADDITION 'G' F.F.E. = 927.4 / ARCH. 100'-0" F.F.E. = 916.86 / ARCH. 89'-512" EAST PARKING (174 STALLS) WEST PARKING (8 BUS STALLS) SOUTH PARKING (14 BUS STALLS) ACCESSIBLE PARKING (14 STALLS) 5 C2.11 6 C2.11 6 C2.11 7 C2.11 MATCH EXISTING GRADES FOR RESTORATION WORK OUTSIDE OF GRADING LIMITS (TYPICAL) MATCH EXISTING GRADES FOR RESTORATION WORK OUTSIDE OF GRADING LIMITS (TYPICAL) LEGENDNOTES: 1.REFER TO SHEET C1.34, GRADING AND DRAINAGE PLAN FIELDS, FOR GENERAL NOTES. 915 15.6 15 C2.11 19 C2.11 20 C2.11 22 C2.11 23 C2.11 17 C2.11 16 C2.11 1 C2.11 5 C2.11 LANDSCAPE ARCHITECTURE SITE PLANNING CIVIL ENGINEERING ANDERSON - JOHNSON ASSOCIATES, INC. 7575 GOLDEN VALLEY ROAD SUITE 200 MINNEAPOLIS. MN 55427 FAX (763) 544-0531 PH (763) 544-7129 DateRegistration Number Check Drawn Date: Comm I hereby certify that this plan, specification or report was prepared by me or under my direct supervision and that I am a duly Licensed under the laws of the State of Revisions Description Date Num Scale: North 501 South Eighth Street Minneapolis, MN 55404 krausanderson.com | 612 332 7281 MOUNDS VIEW HIGH SCHOOL 2019 IMPROVEMENTS 1900 Lake Valentine Road ARDEN HILLS, MINNESOTA 55112 4570 VICTORIA STREET N SHOREVIEW, MINNESOTA 55126 ISD #621: MOUNDS VIEW PUBLIC SCHOOLS PROFESSIONAL ENGINEER MINNESOTA C1.32 1" = 30' DAR MET 02/06/2019 172270 40180 02/06/2019 DAVID A. REY CENTERPLANDRAINAGEGRADING AND REFERENCE KEY TO SITE DETAILS DETAIL I.D NUMBER (TOP) DETAIL SHEET NUMBER (BOTTOM) EXISTING CONTOUR EXISTING SPOT ELEVATION PROPOSED CONTOUR PROPOSED SPOT ELEVATION ME = MATCH EXISTING EOF = EMERGENCY OVERFLOW PROPOSED GRADING LIMITS PROPOSED SAND SUBBASE AT FROST FOOTED STOOPS APPROXIMATE SOIL BORING LOCATION PROPOSED MANHOLE (MH) PROPOSED CATCH BASIN (CB) PROPOSED FLARED END SECTION (FES) PROPOSED HYDRANT (HYD) PROPOSED GATE VALVE (GV) PROPOSED BUILDING STOOP - REFER TO ARCHITECTURAL PLANS PROPERTY LINE 923923924 9 2 4 924 925925 925 925925925925 925 926926926926926 926 926926 926927 927 92 7927 927 927 91 7 918918 919920 26.9 26.9 26.8 27.4 ME 26.9 26.9 27.427.427.427.427.4 27.427.4 27.3 ME 27.427.427.427.4 26.9 26.9 26.926.9 27.427.427.427.4 26.9 27.1 23.4 25.6 25.2 25.7 26.4 23.0 24.4 24.9 26.8 26.8 26.1 25.6 26.0 25.425.6 25.1 24.0 24.8 24.8 24.4 26.9 25.0 25.4 25.9 25.9 26.6 26.7 24.4 25.2 23.3 23.7 26.2 26.1 25.8 25.7 25.1 25.5 24.6 22.2 22.4 23.2 24.1 23.5 24.2 24.7 24.4 24.0 24.5 26.5 26.4 19.1 ME 18.7 ME 18.4 ME 18.4 ME20.9 ME 18.9 ME 18.3 17.8 18.018.018.0 18.0 17.5 17.1 17.5 16.5 17.8 17.6 17.3 18.0 17.2 16.7 16.0 17.2 16.7 16.8 17.0 17.7 22.4 22.5 22.7 22.6 27.2 27.4 26.8 26.0 26.1 26.5 25.8 23.0 ME 22.7 ME 27.427.427.4 27.3 26.9 27.2 26.9 26.9 26.7 ME 26.9 26.8 ME 25.5 ME 25.0 26.2 26.6 27.2 26.8 25.5 25.8 24.7 25.3 ME 23.2 25.2 ME 22.9 17.0 ME 17.517.5 16.9 16.9 17.5 21.417.4 17.9 25.2 25.5 18.5 18.2 ME 18.2 ME 19.4 ME 16.4 17.7 17.5 18.2 17.1 16.8 16.7 18.2 26.6 ME25.7 ME 25.6 ME 25.2 ME 23.8 24.6 25.9 14.2 ME 20.2 ME 23.8 ME 17.5 ME 16.3 ME 15.5 ME 15.5 ME 16.6 ME 23.5 ME 23.8 ME 24.2 ME 23.3 ME 19.7 ME 10.9 ME 13.1 ME 22.7 ME 23.3 ME 24.8 ME 25.4 ME 25.3 ME 24.5 ME 23.5 ME 23.2 ME 22.8 ME 23.3 ME 23.9 ME 24.7 ME 28.5 ME 27.1 ME 25.0 ME 25.0 ME 24.5 ME 24.1 ME 22.4 ME 21.8 ME 21.5 ME 20.3 ME 21.6 ME 26.1 26.2 ME 26.9 ME 26.8 ME 25.9 ME 25.9 ME 25.6 25.8 26.1 27.5 26.9 25.3 25.8 26.6 25.9 25.3 26.0 26.3 25.6 26.0 25.7 24.9 27.2 ME 25.9 26.5 ME 25.7 ME 25.4 ME 24.7 ME 25.2 ME 30.6 ME 32.0 ME 30.4 ME 29.8 ME 29.6 ME 29.5 ME 29.4 ME 29.1 ME 26.6 27.1 27.2 27.1 26.4 25.9 26.3 26.1 25.4 23.8 23.4 20.0 21.7 23.8 31.5 28.8 32.6 32.1 26.0 27.1 24.6 27.0 18.0 17.8 19.1 30.6 25.7 27.2 ME 26.7 26.7 ME 26.5 ME 25.4 PROPOSED BUILDING ADDITION 'B' PROPOSED BUILDING ADDITION 'F' PROPOSED BUILDING ADDITION 'G' F.F.E. = 927.4 / ARCH. 100'-0" F.F.E. = 927.4 / ARCH. 100'-0" F.F.E. = 916.86 / ARCH. 89'-512" SOUTH PARKING (14 BUS STALLS) 5 C2.11 5 C2.11 6 C2.11 6 C2.11 6 C2.11 7 C2.11 MATCH EXISTING GRADES FOR RESTORATION WORK OUTSIDE OF GRADING LIMITS (TYPICAL) MATCH EXISTING GRADES FOR RESTORATION WORK OUTSIDE OF GRADING LIMITS (TYPICAL) MATCH EXISTING GRADES FOR RESTORATION WORK OUTSIDE OF GRADING LIMITS (TYPICAL) LEGEND NOTES: 1.REFER TO SHEET C1.34, GRADING AND DRAINAGE PLAN FIELDS, FOR GENERAL NOTES. 915 15.6 15 C2.11 19 C2.11 20 C2.11 22 C2.11 23 C2.11 17 C2.11 16 C2.11 1 C2.11 5 C2.11 LANDSCAPE ARCHITECTURE SITE PLANNING CIVIL ENGINEERING ANDERSON - JOHNSON ASSOCIATES, INC. 7575 GOLDEN VALLEY ROAD SUITE 200 MINNEAPOLIS. MN 55427 FAX (763) 544-0531 PH (763) 544-7129 DateRegistration Number Check Drawn Date: Comm I hereby certify that this plan, specification or report was prepared by me or under my direct supervision and that I am a duly Licensed under the laws of the State of Revisions Description Date Num Scale: North 501 South Eighth Street Minneapolis, MN 55404 krausanderson.com | 612 332 7281 MOUNDS VIEW HIGH SCHOOL 2019 IMPROVEMENTS 1900 Lake Valentine Road ARDEN HILLS, MINNESOTA 55112 4570 VICTORIA STREET N SHOREVIEW, MINNESOTA 55126 ISD #621: MOUNDS VIEW PUBLIC SCHOOLS PROFESSIONAL ENGINEER MINNESOTA C1.33 1" = 30' DAR MET 02/06/2019 172270 40180 02/06/2019 DAVID A. REY SOUTHPLANDRAINAGEGRADING AND REFERENCE KEY TO SITE DETAILS DETAIL I.D NUMBER (TOP) DETAIL SHEET NUMBER (BOTTOM) EXISTING CONTOUR EXISTING SPOT ELEVATION PROPOSED CONTOUR PROPOSED SPOT ELEVATION ME = MATCH EXISTING EOF = EMERGENCY OVERFLOW PROPOSED GRADING LIMITS PROPOSED SAND SUBBASE AT FROST FOOTED STOOPS APPROXIMATE SOIL BORING LOCATION PROPOSED MANHOLE (MH) PROPOSED CATCH BASIN (CB) PROPOSED FLARED END SECTION (FES) PROPOSED HYDRANT (HYD) PROPOSED GATE VALVE (GV) PROPOSED BUILDING STOOP - REFER TO ARCHITECTURAL PLANS PROPERTY LINE 1.)Top of top nut of fire hydrant, approx. 115 feet north of door #2, north of school Elevation = 920.79 feet 2.)Top of top nut of fire hydrant, west of southerly building corner Elevation = 927.71 feet 3.)Top of top nut of fire hydrant, north of Lake Valentine Rd., west of west entrance to bus garage Elevation = 918.17 feet BENCHMARKS (FIELD VERIFY BEFORE USING) 91 7 91 8 919 920920 921921 922922 923 924 925 926 927 928 929929 930930931931932932 933933933 934 935 30.0 29.6 32.6 33.0 19.6 ME 28.3 ME 35.9 ME 32.6 ME 30.6 ME 26.6 ME 26.6 ME 26.6 ME 19.6 ME 19.6 ME 29.6 ME 29.5 ME 29.2 ME 29.0 ME 29.3 ME 29.5 ME 29.1 ME 28.9 ME 29.8 ME 28.8 ME 28.5 ME 29.7 ME 16.6 ME 16.2 ME 19.7 ME 19.7 ME 19.7 ME 19.3 19.1 18.8 18.4 29.5 ME 32.9 ME 33.0 ME 33.1 ME 33.2 ME 33.0 ME 33.2 ME 33.2 ME 33.2 ME 32.7 ME 33.2 ME PROPOSED FOOTBALL / LACROSSE FIELD (180' X 360') MATCH EXISTING GRADES FOR RESTORATION WORK OUTSIDE OF GRADING LIMITS (TYPICAL) LEGEND 915 15.6 15 C2.11 19 C2.11 20 C2.11 22 C2.11 23 C2.11 17 C2.11 16 C2.11 1 C2.11 5 C2.11 GENERAL NOTES LANDSCAPE ARCHITECTURE SITE PLANNING CIVIL ENGINEERING ANDERSON - JOHNSON ASSOCIATES, INC. 7575 GOLDEN VALLEY ROAD SUITE 200 MINNEAPOLIS. MN 55427 FAX (763) 544-0531 PH (763) 544-7129 DateRegistration Number Check Drawn Date: Comm I hereby certify that this plan, specification or report was prepared by me or under my direct supervision and that I am a duly Licensed under the laws of the State of Revisions Description Date Num Scale: North 501 South Eighth Street Minneapolis, MN 55404 krausanderson.com | 612 332 7281 MOUNDS VIEW HIGH SCHOOL 2019 IMPROVEMENTS 1900 Lake Valentine Road ARDEN HILLS, MINNESOTA 55112 4570 VICTORIA STREET N SHOREVIEW, MINNESOTA 55126 ISD #621: MOUNDS VIEW PUBLIC SCHOOLS PROFESSIONAL ENGINEER MINNESOTA C1.34 1" = 30' DAR MET 02/06/2019 172270 40180 02/06/2019 DAVID A. REY FIELDPLANDRAINAGEGRADING AND 1. ALL CONSTRUCTION MUST COMPLY WITH APPLICABLE STATE AND LOCAL ORDINANCES. 2. THE CONTRACTOR WILL BE RESPONSIBLE FOR AND SHALL PAY FOR ALL CONSTRUCTION STAKING / LAYOUT. 3. THE CONTRACTOR SHALL OBTAIN AND PAY FOR ALL RELATED CONSTRUCTION PERMITS, INCLUDING THE NPDES PERMIT FROM THE MPCA. SUBMIT A COPY OF ALL PERMITS TO THE CITY. 4. CONTRACTOR SHALL BE RESPONSIBLE FOR ALL TRAFFIC CONTROL SIGNAGE (CONSTRUCTION ZONES) NECESSARY TO CONSTRUCT PROPOSED IMPROVEMENTS. ALL SIGNAGE LAYOUTS MUST BE DESIGNED BY THE CONTRACTOR AND APPROVED BY LOCAL AUTHORITIES. 5. INSTALL CONTROL FENCING AND BARRICADING AS NECESSARY TO PROTECT THE PUBLIC. 6. INSPECT SITE AND REVIEW SOIL BORINGS TO DETERMINE EXTENT OF WORK AND NATURE OF MATERIALS TO BE HANDLED. 7. REFER TO SPECIFICATIONS FOR DEWATERING REQUIREMENTS. 8. CHECK ALL PLAN AND DETAIL DIMENSIONS AND VERIFY SAME BEFORE FIELD LAYOUT. 9. REFER TO ARCHITECTURAL PLANS FOR BUILDING AND STOOP DIMENSIONS AND LAYOUT. 10. REFER TO THE STORM WATER POLLUTION PREVENTION PLAN (SWPPP) NARRATIVE, PART OF SECTION 01 89 13, FOR EROSION CONTROL REQUIREMENTS. SECTION 31 00 00 SHALL BE RESPONSIBLE FOR FULL IMPLEMENTATION OF THE SWPPP. 11. MAINTAIN ADJACENT PROPERTY AND PUBLIC STREETS CLEAN FROM CONSTRUCTION CAUSED DIRT AND DEBRIS ON A DAILY BASIS. PROTECT DRAINAGE SYSTEMS FROM SEDIMENTATION AS A RESULT OF CONSTRUCTION RELATED DIRT AND DEBRIS. 12. MAINTAIN DUST CONTROL DURING GRADING OPERATIONS. 13. ALL EROSION CONTROL METHODS SHALL COMPLY WITH MPCA AND LOCAL REGULATIONS. 14. CONTRACTOR SHALL MINIMIZE DISTURBANCE TO SITE AND PROTECT EXISTING SITE FEATURES (INCLUDING TURF AND VEGETATION) WHICH ARE TO REMAIN. 15. PROPOSED CONTOURS AND SPOT ELEVATIONS ARE SHOWN TO FINISH GRADE UNLESS OTHERWISE NOTED. 16. PROPOSED ELEVATIONS SHOWN TYPICALLY AS 15.1 OR 15 SHALL BE UNDERSTOOD TO MEAN 915.1 OR 915. 17. SPOT ELEVATIONS SHOWN IN PARKING LOTS, DRIVES AND ROADS INDICATE GUTTER GRADES, UNLESS NOTED OTHERWISE. SPOT ELEVATIONS WITH LABELS OUTSIDE THE BUILDING PERIMETER INDICATE PROPOSED GRADES OUTSIDE THE BUILDING. SPOT ELEVATIONS WITH LABELS INSIDE THE BUILDING PERIMETER INDICATE PROPOSED FINISH FLOOR ELEVATIONS. 18. THE CONTRACTOR SHALL BE SOLELY RESPONSIBLE FOR DETERMINING QUANTITIES OF CUT, FILL AND WASTE MATERIALS TO BE HANDLED, AND FOR AMOUNT OF GRADING TO BE DONE IN ORDER TO COMPLETELY PERFORM ALL WORK INDICATED ON THE DRAWINGS. IMPORT SUITABLE MATERIAL AND EXPORT UNSUITABLE / EXCESS / WASTE MATERIAL AS REQUIRED. ALL COSTS ASSOCIATED WITH IMPORTING AND EXPORTING MATERIALS SHALL BE INCIDENTAL TO THE CONTRACT. 19.NO FINISHED SLOPES SHALL EXCEED 4' HORIZONTAL TO 1' VERTICAL (4:1), UNLESS OTHERWISE NOTED. 20. ALL DISTURBED AREAS OUTSIDE THE BUILDING PAD WHICH ARE NOT DESIGNATED TO BE PAVED SHALL RECEIVE AT LEAST 6" OF TOPSOIL AND SHALL BE SODDED OR SEEDED. 21. WHERE NEW SOD MEETS EXISTING SOD, EXISTING SOD EDGE SHALL BE CUT TO ALLOW FOR A CONSISTENT, UNIFORM STRAIGHT EDGE. JAGGED OR UNEVEN EDGES WILL NOT BE ACCEPTABLE. REMOVE TOPSOIL AT JOINT BETWEEN EXISTING AND NEW AS REQUIRED TO ALLOW NEW SOD SURFACE TO BE FLUSH WITH EXISTING. 22. FAILURE OF TURF DEVELOPMENT: IN THE EVENT THE CONTRACTOR FAILS TO PROVIDE AN ACCEPTABLE TURF, THE CONTRACTOR SHALL RE-SOD OR RE-SEED ALL APPLICABLE AREAS, AT NO ADDITIONAL COST TO THE OWNER, TO THE SATISFACTION OF THE ENGINEER. 23. ANY MANHOLE, CATCH BASIN, STORM SEWER, SANITARY SEWER, DRAINTILE OR OTHER POTENTIAL SOURCE FOR CONTAMINATION SHALL BE INSTALLED AT LEAST 10 FEET HORIZONTALLY FROM ANY WATERMAIN PER MINNESOTA PLUMBING CODE. THIS ISOLATION DISTANCE SHALL BE MEASURED FROM THE OUTER EDGE OF THE PIPE TO THE OUTER EDGE OF THE CONTAMINATION SOURCE (OUTER EDGE OF STRUCTURES OR PIPING OR SIMILAR). 24. LOCATE ALL EXISTING UTILITIES, VERIFY LOCATION, SIZE AND INVERT ELEVATION OF ALL EXISTING UTILITIES. VERIFY LOCATIONS, SIZES AND ELEVATIONS OF SAME BEFORE BEGINNING CONSTRUCTION. 25. CONTRACTOR SHALL MAINTAIN DRAINAGE FROM EXISTING BUILDING AT ALL TIMES. PROVIDE TEMPORARY STORM SEWER (INCLUDING, BUT NOT LIMITED TO, CATCH BASINS, MANHOLES, PIPING, ETC.) AS REQUIRED. EXISTING STORM SEWER SHALL NOT BE REMOVED UNTIL TEMPORARY OR PERMANENT STORM SEWER IS INSTALLED AND FUNCTIONAL. COORDINATE ALL REMOVALS WITH APPROPRIATE TRADES (SITE UTILITY CONTRACTOR, MECHANICAL CONTRACTOR, ETC.) AS REQUIRED. REFERENCE KEY TO SITE DETAILS DETAIL I.D NUMBER (TOP) DETAIL SHEET NUMBER (BOTTOM) EXISTING CONTOUR EXISTING SPOT ELEVATION PROPOSED CONTOUR PROPOSED SPOT ELEVATION ME = MATCH EXISTING EOF = EMERGENCY OVERFLOW PROPOSED GRADING LIMITS PROPOSED SAND SUBBASE AT FROST FOOTED STOOPS APPROXIMATE SOIL BORING LOCATION PROPOSED MANHOLE (MH) PROPOSED CATCH BASIN (CB) PROPOSED FLARED END SECTION (FES) PROPOSED HYDRANT (HYD) PROPOSED GATE VALVE (GV) PROPOSED BUILDING STOOP - REFER TO ARCHITECTURAL PLANS PROPERTY LINE 1.)Top of top nut of fire hydrant, approx. 115 feet north of door #2, north of school Elevation = 920.79 feet 2.)Top of top nut of fire hydrant, west of southerly building corner Elevation = 927.71 feet 3.)Top of top nut of fire hydrant, north of Lake Valentine Rd., west of west entrance to bus garage Elevation = 918.17 feet BENCHMARKS (FIELD VERIFY BEFORE USING) 913 9 1 1 911 911 9129 1 2 913 9 1 3 914 9 1 4 9149159 1 6 9 0 9 9 1 0911 912913 9 1 4 91 5 915 91 6 906 907 911 912 9 1 2 913 14.8 14.7 14.3 14.2 14.1 13.8 13.7 13.5 13.4 13.2 13.1 12.9 11.8 11.2 ME 11.7 ME12.3 ME 05.4 ME 07.4 ME 07.3 ME 07.6 ME 08.7 ME 09.1 ME 12.9 ME 15.5 15.1 15.3 15.4 13.5 13.3 15.3 15.2 15.6 15.4 14.1 14.715.7 15.8 13.7 13.8 18.1 ME 17.7 15.0 ME 15.9 ME 16.6 ME 17.0 ME 12.7 ME 12.6 ME 12.3 ME 11.9 ME 11.9 ME 14.0 14.0 13.212.813.0 12.2 ME 12.2 ME 12.3 ME 12.8 ME 12.8 ME 12.4 ME 12.4 12.4 12.4 12.4 12.4 12.4 12.6 ME 12.6 ME 13.3 ME13.7 ME 13.3 ME 14.0 13.8 13.6 13.8 14.0 13.8 14.1 13.9 14.2 14.0 ME 14.8 14.1 13.9 ME 10.0 ME 11.8 ME 13.3 ME 14.3 ME 15.1 ME 15.3 ME 15.9 ME 15.8 ME 15.6 ME 15.3 ME 14.7 ME 15.9 ME 15.6 ME 16.1 ME 15.7 ME 16.7 ME 15.9 ME 15.7 ME 15.5 ME 14.8 ME 14.3 ME 13.4 ME 12.7 ME 06.2 ME 10.6 ME 10.5 ME 11.7 12.3 12.5 13.2 13.8 14.1 14.7 14.9 14.8 15.4 15.6 15.1 15.7 15.9 14.9 14.8 20.5 ME 20.5 ME 11.7 ME 12.7 ME 12.5 ME 12.6 ME 12.7 15.4 15.7 15.4 15.1 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 12.0 ME12.2 ME 12.1 ME12.5 ME 12.2 12.3 12.1 12.2 12.3 12.2 12.8 12.7 12.7 12.6 12.4 12.3 12.4 12.3 11.6 11.2 11.1 09.0 ME 09.4 ME 09.8 ME 09.1 ME 14.8 14.5 14.3 ME 14.6 ME 14.7 ME 13.1 ME 13.2 ME 13.3 13.2 12.6 ME 12.6 ME 15.1 ME 16.0 15.4 15.6 ME 11.9 EOF 13.4 ME 12.9 ME 17.2 15.7 15.5 15.2 15.4 16.8 16.7 913 914 915 903903 903903903904904904 904904 905906907 90707.8 07.8 07.8 06.6 EOF 07.8 07.8 07.8 07.8 07.8 MH 1 (EXISTING) RIM = 912.2 INV. = 901.3 INV. = 901.50 SW 48" ID R-1642 CORE DRILL CONNECTION TO EXISTING STRUCTURE - PROVIDE RUBBER BOOT AT CONNECTION MH 2 RIM = 915.1 INV. = 903.58 48" ID R-1642 100' - 6" PVC @ 2.08% WEST PARKING (8 BUS STALLS) ACCESSIBLE PARKING (14 STALLS) CONNECT TO EXISTING 8" WM AND 8" GV BD 9 (EXISTING) 12,610 S.F. MH 116 RIM = 913.2 INV. = 906.65 N INV. = 906.65 S INV. = 906.77 SE 48" ID R-1642 OCS 1 RIM = 911.50 INV. = 907.30 INV. = 907.50 DT (2) 48" ID SEE DETAIL CB 2 RIM = 916.0 INV. = 905.67 N INV. = 906.22 S INV 911 20 W CB 1 RIM = 915.1 INV. = 904.60 N INV. = 905.05 S INV. = 912.10 FD (2) 84" ID R-3067-V MH 109 RIM = 918.2 INV. = 911.60 INV. = 912.00 DT 48" ID R-1642 PROVIDE BACK WATER VALVE AT DT CONNECTION 26' - 12" PVC @ 0.77% 124' - 30" RCP @ 0.50% 18' - 12" RCP @ 2.95% REPLACE EXISTING TOP SLAB AND CASTING WITH NEW TOP SLAB AND R-3067-V CASTING CB 12 RIM = 913.2 INV. = 907.64 48" ID R-3067-V 14' - 12" RCP @ 1.00% CONNECT TO EXISTING STRUCTURE AT INV. = 907.50. REPLACE TOP SLAB AND CASTING WITH NEW TOP SLAB AND R-1642 CASTING. RECONSTRUCT AS REQUIRED. STORMWATER TRENCH AND PRETREATMENT STRUCTURE. INLET INV. = 913.30 4 C2.12 HYD 3 & 6" GV CONNECT TO EXISTING 8" WM AND 8" GV 45° BEND 8x6 TEE 11 C2.11 10 C2.11 FILTRATION AREA 7BP BOTTOM = 911.00 SURFACE AREA = 6,140 S.F. HWL = 912.50 O.E. = 911.50 EOF = 911.90 13 C2.11 14 C2.11 MH 9 (REMOVE EXISTING STRUCTURE) RIM = 912.2 INV. = 901.60 S (EXISTING - FIELD VERIFY) INV. = 901.60 NW 48" ID R-1642 FIELD VERIFY SIZE OF EXISTING EXITING PIPE.ADJUST HYDRANT TO FINISH GRADE ADJUST GATE VALVE TO FINISH GRADE ADJUST GATE VALVE TO FINISH GRADE 11 C2.15 12 6" DT @ INV. = 904.50 (TYPICAL) 56' - 33" RCP @ 0.46% FES 1 INV. = 903.50 33" APRON AND CLASS III RIP RAP (15 C.Y.)MH 101 RIM = 910.8 INV. = 903.76 NE INV. = 904.06 S 84" ID R-1642 136' - 33" RCP @ 0.40% HYD 4 CONNECT TO EXISTING HYDRANT LEAD FOLLOWING HYDRANT REMOVAL FES 2 INV. = 903.50 15" APRON FES 3 INV. = 903.00 15" APRON AND CLASS III RIP RAP (7 C.Y.) 6' - 15" RCP @ 0.00% 36' - 15" RCP @ 1.40% OCS 2 RIM = 906.60 INV. = 903.50 INV. = 902.50 (1' SUMP) 60" ID SEE DETAIL 1 C2.15 STORM WATER POND SOUTH LOBE BOTTOM = 898.00 NWL = 903.50 HWL = 906.63 EOF = 907.00 STORM WATER POND NORTH LOBE BOTTOM = 894.50 NWL = 903.50 HWL = 906.63 EOF = 907.00 NORTH PARKING (483 STALLS) MH 10 RIM = 908.8 INV. = 902.38 48" ID R-1642 MH 11 (REMOVE EXISTING STRUCTURE) RIM = 909.0 INV. = 904.50 W (EXISTING - FIELD VERIFY) INV. = 903.37 S 48" ID R-1642 FIELD VERIFY LOCATION AND SIZE OF EXISTING INCOMING PIPE. 95' - 6" PVC @ 1.04% 75' - 6" PVC @ 1.04% 1 PROVIDE TRAFFIC CONTROL PER MnDOT STANDARDS AND COORDINATE LAKE VALENTINE ROAD CONSTRUCTION WITH THE CITY 1. REFER TO SHEET C1.34, GRADING AND DRAINAGE PLAN FIELDS, FOR GENERAL NOTES. 2.ALL WATERMAIN PIPE SHALL BE DIP, CLASS 52. ALL WATERMAIN SHALL HAVE MINIMUM 8'-0" BURY (TOP OF PIPE TO FINISH GRADE). DIP SHALL BE ENCASED WITH POLYETHYLENE FILM CONFORMING TO ASTM D 1248-889. 3. ALL SANITARY SEWER PIPE SHALL BE PVC PIPE (ASTM D 3034, SDR 26), UNLESS OTHERWISE NOTED. SANITARY SEWER INSTALLATION SHALL BE IN ACCORDANCE WITH ASTM D2321. 4. ALL STORM SEWER PIPE SHALL BE RCP, CLASS III (MIN.), WITH FLEXIBLE WATERTIGHT JOINTS IN ACCORDANCE WITH ASTM C-361 OR PVC PIPE (ASTM D3034, SDR 35) INSTALLED IN ACCORDANCE WITH ASTM D2321, UNLESS OTHERWISE NOTED. 5. FLEXIBLE JOINTS AT STORM SEWER PIPE CONNECTIONS TO STRUCTURES: a. IN ACCORDANCE WITH MINNESOTA PLUMBING CODE, PROVIDE FLEXIBLE JOINTS AT ALL PIPE CONNECTIONS TO ALL STORM SEWER STRUCTURES. b. ACCEPTABLE MANUFACTURERS / PRODUCTS: i. FERNCO, “CONCRETE MANHOLE ADAPTORS” OR “LARGE-DIAMETER WATERSTOPS” ii. PRESS-SEAL, WATERSTOP GROUTING RINGS” iii. OR APPROVED EQUAL. 6. WATERMAIN SHALL BE INSTALLED AT LEAST 10 FEET HORIZONTALLY FROM ANY MANHOLE, CATCH BASIN, STORM SEWER, SANITARY SEWER, DRAINTILE OR OTHER POTENTIAL SOURCE FOR CONTAMINATION PER MINNESOTA PLUMBING CODE. THIS ISOLATION DISTANCE SHALL BE MEASURED FROM THE OUTER EDGE OF THE PIPE TO THE OUTER EDGE OF THE CONTAMINATION SOURCE (OUTER EDGE OF STRUCTURES OR PIPING OR SIMILAR). 7. ANY MANHOLE, CATCH BASIN, STORM SEWER, SANITARY SEWER, DRAINTILE OR OTHER POTENTIAL SOURCE FOR CONTAMINATION SHALL BE INSTALLED AT LEAST 10 FEET HORIZONTALLY FROM ANY WATERMAIN PER MINNESOTA PLUMBING CODE. THIS ISOLATION DISTANCE SHALL BE MEASURED FROM THE OUTER EDGE OF THE PIPE TO THE OUTER EDGE OF THE CONTAMINATION SOURCE (OUTER EDGE OF STRUCTURES OR PIPING OR SIMILAR). 8. LOCATE ALL EXISTING UTILITIES, VERIFY LOCATION, SIZE AND INVERT ELEVATION OF ALL EXISTING UTILITIES. VERIFY LOCATIONS, SIZES AND ELEVATIONS OF SAME BEFORE BEGINNING CONSTRUCTION. 9. PRIOR TO CONSTRUCTION OF PROPOSED BUILDING UTILITY SERVICES (STORM, SANITARY SEWER, WATERMAIN), VERIFY ALL PROPOSED BUILDING UTILITY SERVICE PIPE SIZES, LOCATIONS AND ELEVATIONS WITH MECHANICAL PLANS. COORDINATE CONSTRUCTION AND CONNECTIONS WITH MECHANICAL CONTRACTOR. 10. CONTRACTOR SHALL STAKE LIMITS OF WALKS AND CURBING PRIOR TO INSTALLATION OF GATE VALVES, CATCH BASINS AND MANHOLES. GATE VALVE AND MANHOLE LOCATIONS SHALL BE ADJUSTED TO AVOID PLACEMENT OF THESE STRUCTURES IN WALKS AND CURB AND GUTTER. CURB AND GUTTER SHALL BE STAKED TO ALLOW CURB INLET TYPE CATCH BASINS TO BE PROPERLY LOCATED IN LINE WITH CURBING. NOTES LEGEND REFERENCE KEY TO SITE DETAILS DETAIL I.D NUMBER (TOP) DETAIL SHEET NUMBER (BOTTOM) EXISTING CONTOUR PROPOSED CONTOUR PROPOSED SPOT ELEVATION ME = MATCH EXISTING EOF = EMERGENCY OVERFLOW PROPOSED GRADING LIMITS PROPOSED SANITARY SEWER PROPOSED STORM SEWER PROPOSED WATERMAIN PROPOSED DRAINTILE / FINGER DRAIN PROPOSED MANHOLE (MH) PROPOSED CATCH BASIN (CB) PROPOSED FLARED END SECTION (FES) PROPOSED HYDRANT (HYD) PROPOSED GATE VALVE (GV) PROVIDE MINIMUM 18" VERTICAL SEPARATION AT CROSSING - PROVIDE VERTICAL BENDS IN WATERMAIN AS REQUIRED TO ACCOMPLISH. CENTER ONE LENGTH WATERMAIN PIPE ON CROSSING. PROPOSED BUILDING STOOP - REFER TO ARCHITECTURAL PLANS PROPERTY LINE 1 915 15.6 15 C2.11 19 C2.11 20 C2.11 22 C2.11 23 C2.11 17 C2.11 16 C2.11 1 C2.11 LANDSCAPE ARCHITECTURE SITE PLANNING CIVIL ENGINEERING ANDERSON - JOHNSON ASSOCIATES, INC. 7575 GOLDEN VALLEY ROAD SUITE 200 MINNEAPOLIS. MN 55427 FAX (763) 544-0531 PH (763) 544-7129 DateRegistration Number Check Drawn Date: Comm I hereby certify that this plan, specification or report was prepared by me or under my direct supervision and that I am a duly Licensed under the laws of the State of Revisions Description Date Num Scale: North 501 South Eighth Street Minneapolis, MN 55404 krausanderson.com | 612 332 7281 MOUNDS VIEW HIGH SCHOOL 2019 IMPROVEMENTS 1900 Lake Valentine Road ARDEN HILLS, MINNESOTA 55112 4570 VICTORIA STREET N SHOREVIEW, MINNESOTA 55126 ISD #621: MOUNDS VIEW PUBLIC SCHOOLS PROFESSIONAL ENGINEER MINNESOTA C1.41 1" = 40' DAR MET 02/06/2019 172270 40180 02/06/2019 DAVID A. REY NORTHPLANUTILITY Addendum #2 02/22/2019 1 5 C2.11 11 C2.11 17B C2.11 913 9 1 1 911 911 9129 1 2 913 9 1 3 925 6 7 914 9 1 4 914 915915915 9 1 6 9 1 6 917 91 7 91 7 917918918 919920 915 91 6 906 907 911 912 9 1 2 913 27.4 ME 26.9 26.9 27.427.427.427.427.4 27.3 ME 27.1 17.5 ME 18.7 ME 19.1 ME 18.7 ME 18.4 ME 18.4 ME20.9 ME 18.9 ME 18.3 17.8 18.018.018.0 18.0 13.8 13.7 13.5 13.4 13.2 13.1 12.9 11.8 11.2 ME 11.7 ME12.3 ME 07.4 ME 07.3 ME 07.6 ME 12.9 ME 17.5 17.1 15.5 14.7 ME 17.2 17.1 16.9 16.6 16.8 16.7 15.1 15.3 15.4 13.5 13.3 15.3 15.2 15.6 17.9 17.9 17.7 20.8 20.6 21.4 17.5 16.5 17.8 17.6 17.3 18.0 17.2 16.7 16.0 17.2 16.7 16.8 16.6 15.4 14.1 14.715.7 15.8 17.0 17.7 13.7 13.8 22.4 22.5 22.7 22.6 26.8 23.0 ME 22.7 ME 19.0 ME 18.9 ME 18.1 ME 18.5 ME 17.7 18.0 18.1 15.0 ME 15.9 ME 16.6 ME 17.0 ME 12.7 ME 12.6 ME 12.3 ME 11.9 ME 11.9 ME 14.0 14.0 13.212.813.0 12.2 ME 12.2 ME 12.3 ME 12.8 ME 12.8 ME 12.4 ME 12.4 12.4 12.4 12.4 12.4 12.4 12.6 ME 12.6 ME 13.3 ME 13.7 ME 13.8 ME 13.7 ME 13.3 ME 14.0 13.8 13.6 13.8 14.0 13.8 14.1 13.9 14.2 14.0 ME 14.8 14.1 13.9 ME 17.0 ME 14.7 ME 15.9 ME 15.6 ME 16.1 ME 15.7 ME 15.7 15.9 14.9 14.8 20.5 ME 17.9 11.7 ME 12.7 ME 13.6 ME 14.3 ME 14.2 ME 13.8 ME 13.3 ME 12.5 ME 12.6 ME 13.3 13.8 14.2 13.8 13.9 ME 13.6 12.7 17.517.5 16.9 16.9 17.217.5 21.421.2 17.4 17.9 18.5 15.4 15.7 15.4 15.1 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 14.5 ME 14.5 ME 14.5 ME 14.8 ME 14.9 ME 14.5 ME14.5 ME 14.6 ME 17.2 ME 17.5 ME 16.6 ME 15.1 ME 17.4 ME 17.5 ME 18.2 ME 18.2 ME 19.4 ME 16.4 16.6 ME 16.2 ME 15.8 ME 15.6 ME 15.2 ME 15.3 ME 15.9 16.0 16.3 16.5 16.9 17.3 17.7 17.5 18.2 17.1 16.8 16.7 18.2 ME 6 E 26.5 ME 25.7 ME 25.4 ME 24.7 ME 25.2 ME 30.6 ME25 4 12.0 ME12.2 ME 12.1 ME12.5 ME 12.2 12.3 12.1 12.2 12.3 12.2 12.8 12.7 12.7 12.6 12.4 12.3 12.4 12.3 11.6 11.2 11.1 09.0 ME 09.4 ME 09.8 ME 09.1 ME 13.1 ME 13.2 ME 13.3 13.2 12.6 ME 12.6 ME 20.0 21.7 23.8 31.5 28.8 32.627.1 24.6 15.1 ME 16.0 15.4 15.6 ME 11.9 EOF 18.0 17.8 19.1 18.3 19.5 13.4 ME 12.9 ME 17.7 17.2 15.7 16.9 15.5 15.2 15.4 16.8 16.7 17.9 7 27.2 ME 914 115' - 6" PVC @ 2.04% 198' - 6"PVC @ 2.08% MH 1 (EXISTING) RIM = 912.2 INV. = 901.3 INV. = 901.50 SW 48" ID R-1642 CORE DRILL CONNECTION TO EXISTING STRUCTURE - PROVIDE RUBBER BOOT AT CONNECTION MH 2 RIM = 915.1 INV. = 903.58 48" ID R-1642 MH 3 RIM = 919.0 INV. = 907.70 48" ID R-1642 MH 4 RIM = 921.7 INV. = 909.30 48" ID R-1642 MH 5 RIM = 928.8 INV. = 911.69 48" ID R-1642 MH 6 RIM = 932.6 INV. = 914.03 NE / SW INV. = 914.28 NW 48" ID R-1642 100' - 6" PVC @ 2.08% 77' - 6" PVC @ 2.08% 119' - 6" PVC @ 2.00% BUS PARKING (29 BUS STALLS) PROPOSED BUILDING ADDITION 'B' PROPOSED BUILDING ADDITION 'G' F.F.E. = 927.4 / ARCH. 100'-0" F.F.E. = 916.86 / ARCH. 89'-512" EAST PARKING (174 STALLS) WEST PARKING (8 BUS STALLS) SOUTH PARKING (14 BUS STALLS) ACCESSIBLE PARKING (14 STALLS) CONNECT TO EXISTING 8" WM AND 8" GV CONNECT TO EXISTING 8" WM AND 8" GV BS 1 INV. = 908.74 / MECH. 81'-4" 16 DFUs 83' - 6" PVC @ 2.08% 50' - 4" PVC @ 2.08% 5.0 0 ' ( T Y P I C A L )28.06'18.69'BD 10 (EXISTING) 26,455 S.F. BD 2 (EXISTING) 11,320 S.F. BD 3 (EXISTING) 5,155 S.F. BD 6 (EXISTING) 7,729 S.F. BD 9 (EXISTING) 12,610 S.F. MH 116 RIM = 913.2 INV. = 906.65 N INV. = 906.65 S INV. = 906.77 SE 48" ID R-1642 OCS 1 RIM = 911.50 INV. = 907.30 INV. = 907.50 DT (2) 48" ID SEE DETAIL CB 2 RIM = 916.0 INV. = 905.67 N INV. = 906.22 S INV. = 911.20 W INV. = 913.00 FD (3) 72" ID R-3067-V CB 1 RIM = 915.1 INV. = 904.60 N INV. = 905.05 S INV. = 912.10 FD (2) 84" ID R-3067-V MH 109 RIM = 918.2 INV. = 911.60 INV. = 912.00 DT 48" ID R-1642 PROVIDE BACK WATER VALVE AT DT CONNECTION MH 110 RIM = 919.5 INV. = 911.80 E INV. = 911.97 S 48" ID R-1642 BD 1 (10" STORM) INV. = 912.07 = MECH 84'-8" 15,695 S.F. CB 3 RIM = 917.5 INV. = 906.49 N/S INV. = 912.30 E (EXISTING - FIELD VERIFY) INV. = 914.50 FD (3) 72" ID R-2501-C CONSTRUCT STRUCTURE OVER EXISTING STORM SEWER. PROVIDE FLEXIBLE JOINTS AT CONNECTIONS MH 102 RIM = 920.0 INV. = 906.92 NE/SE INV. = 915.90 SW (EXISTING - FIELD VERIFY) 72" ID R-1642 CONSTRUCT STRUCTURE OVER EXISTING STORM SEWER. PROVIDE FLEXIBLE JOINTS AT CONNECTIONS MH 103 RIM = 923.8 INV. = 907.33 N 72" ID R-1642 CB 4 RIM = 923.8 INV. = 907.76 INV. = 920.80 FD (2) 72" ID R-2501MH 104 RIM = 924.5 INV. = 908.02 NE/SW INV. = 919.50 NW (EXISTING - FIELD VERIFY) 72" ID R-1642 CONSTRUCT STRUCTURE OVER EXISTING STORM SEWER. PROVIDE FLEXIBLE JOINTS AT CONNECTIONS 11 6.6 W NE SE ID 42 BD 4 (16" STORM) INV. = 922.57 = MECH 95'-2" BD 5 (EXISTING 10" STORM) INV. = 919.40 = MECH 92'-0" (EXISTING - FIELD VERIFY) 27,350 S.F. H 112 IM = 925.8 NV. = 919.20 NE (EXISTING - FIELD VERIFY) NV. = 919.20 SW 8" ID -1642 ONSTRUCT STRUCTURE OVER EXISTING TORM SEWER PIPE - PROVIDE FLEXIBLE OINT AT CONNECTIONS 113' - 30" RCP @ 0.38% 95' - 30" RCP @ 0.43% 59' - 30" RCP @ 0.44% 68' - 30" RCP @ 0.40% 26' - 12" PVC @ 0.77% 114' - 30" PVC @ 0.38% 124' - 30" RCP @ 0.50% 70' - 12" PVC @ 0.57% 18' - 12" RCP @ 2.95% REPLACE EXISTING TOP SLAB AND CASTING WITH NEW TOP SLAB AND R-3067-V CASTING STORMWATER TRENCH AND PRETREATMENT STRUCTURE. INLET INV. = 913.30 4 C2.12 13' - 12" PVC @ 0.77%5.00'5.0 0 '2.08'8.0 6 ' 34.55'5.00'CONNECT TO EXISTING 8" WM AND 8" GV8" WMHYD 3 & 6" GV CONNECT TO EXISTING 8" WM AND 8" GV CONNECT TO EXISTING 8" WM AND 8" GV 45° BEND 45° BEND 45° BEND 8x6 TEE 11 C2.11 11 C2.11 11 C2.11 11 C2.11 1 1 1 1 1 1 1 10 C2.11 FILTRATION AREA 7BP BOTTOM = 911.00 SURFACE AREA = 6,140 S.F. HWL = 912.50 O.E. = 911.50 EOF = 911.90 13 C2.11 14 C2.11 R-1642 FIELD VERIFY SIZE OF EXISTING EXITING PIPE.ADJUST HYDRANT TO FINISH GRADE ADJUST GATE VALVE TO FINISH GRADE ADJUST GATE VALVE TO FINISH GRADE 11 C2.15 12 C2.11 6" DT @ INV. = 904.50 (TYPICAL) 12 C2.11 10' MIN. 1 12 C2.11 PIPE SHALL BE SOLID PVC UNTIL MIN. 10' FROM WM 5 C2.11 ADJUST RIM TO FINISH GRADE. RECONSTRUCT STRUCTURE AS REQUIRED. 10' MIN. 10' M I N . 5.0 0 ' ( T Y P I C A L ) CB 10 RIM = 916.9 INV. = 912.07 30" PVC STRUCTURE H-20 PEDESTRIAN GRATE CB 11 RIM = 916.9 INV. = 912.20 30" PVC STRUCTURE H-20 PEDESTRIAN GRATE 24' - 8" PVC @ 0.54% BS 2 INV. = 916.01 / MECH. 88'-7.25" 388 DFUs R-1642 136' - 33" RCP @ 0.40% 32' - 12" PVC @ 1.14% HYD 4 CONNECT TO EXISTING HYDRANT LEAD FOLLOWING HYDRANT REMOVAL 75' - 6" PVC @ 1.04% 1 LEGEND 1. REFER TO SHEET C1.34, GRADING AND DRAINAGE PLAN FIELDS, FOR GENERAL NOTES. 2.ALL WATERMAIN PIPE SHALL BE DIP, CLASS 52. ALL WATERMAIN SHALL HAVE MINIMUM 8'-0" BURY (TOP OF PIPE TO FINISH GRADE). DIP SHALL BE ENCASED WITH POLYETHYLENE FILM CONFORMING TO ASTM D 1248-889. 3. ALL SANITARY SEWER PIPE SHALL BE PVC PIPE (ASTM D 3034, SDR 26), UNLESS OTHERWISE NOTED. SANITARY SEWER INSTALLATION SHALL BE IN ACCORDANCE WITH ASTM D2321. 4. ALL STORM SEWER PIPE SHALL BE RCP, CLASS III (MIN.), WITH FLEXIBLE WATERTIGHT JOINTS IN ACCORDANCE WITH ASTM C-361 OR PVC PIPE (ASTM D3034, SDR 35) INSTALLED IN ACCORDANCE WITH ASTM D2321, UNLESS OTHERWISE NOTED. 5. FLEXIBLE JOINTS AT STORM SEWER PIPE CONNECTIONS TO STRUCTURES: a. IN ACCORDANCE WITH MINNESOTA PLUMBING CODE, PROVIDE FLEXIBLE JOINTS AT ALL PIPE CONNECTIONS TO ALL STORM SEWER STRUCTURES. b. ACCEPTABLE MANUFACTURERS / PRODUCTS: i. FERNCO, “CONCRETE MANHOLE ADAPTORS” OR “LARGE-DIAMETER WATERSTOPS” ii. PRESS-SEAL, WATERSTOP GROUTING RINGS” iii. OR APPROVED EQUAL. 6. WATERMAIN SHALL BE INSTALLED AT LEAST 10 FEET HORIZONTALLY FROM ANY MANHOLE, CATCH BASIN, STORM SEWER, SANITARY SEWER, DRAINTILE OR OTHER POTENTIAL SOURCE FOR CONTAMINATION PER MINNESOTA PLUMBING CODE. THIS ISOLATION DISTANCE SHALL BE MEASURED FROM THE OUTER EDGE OF THE PIPE TO THE OUTER EDGE OF THE CONTAMINATION SOURCE (OUTER EDGE OF STRUCTURES OR PIPING OR SIMILAR). 7. ANY MANHOLE, CATCH BASIN, STORM SEWER, SANITARY SEWER, DRAINTILE OR OTHER POTENTIAL SOURCE FOR CONTAMINATION SHALL BE INSTALLED AT LEAST 10 FEET HORIZONTALLY FROM ANY WATERMAIN PER MINNESOTA PLUMBING CODE. THIS ISOLATION DISTANCE SHALL BE MEASURED FROM THE OUTER EDGE OF THE PIPE TO THE OUTER EDGE OF THE CONTAMINATION SOURCE (OUTER EDGE OF STRUCTURES OR PIPING OR SIMILAR). 8. LOCATE ALL EXISTING UTILITIES, VERIFY LOCATION, SIZE AND INVERT ELEVATION OF ALL EXISTING UTILITIES. VERIFY LOCATIONS, SIZES AND ELEVATIONS OF SAME BEFORE BEGINNING CONSTRUCTION. 9. PRIOR TO CONSTRUCTION OF PROPOSED BUILDING UTILITY SERVICES (STORM, SANITARY SEWER, WATERMAIN), VERIFY ALL PROPOSED BUILDING UTILITY SERVICE PIPE SIZES, LOCATIONS AND ELEVATIONS WITH MECHANICAL PLANS. COORDINATE CONSTRUCTION AND CONNECTIONS WITH MECHANICAL CONTRACTOR. 10. CONTRACTOR SHALL STAKE LIMITS OF WALKS AND CURBING PRIOR TO INSTALLATION OF GATE VALVES, CATCH BASINS AND MANHOLES. GATE VALVE AND MANHOLE LOCATIONS SHALL BE ADJUSTED TO AVOID PLACEMENT OF THESE STRUCTURES IN WALKS AND CURB AND GUTTER. CURB AND GUTTER SHALL BE STAKED TO ALLOW CURB INLET TYPE CATCH BASINS TO BE PROPERLY LOCATED IN LINE WITH CURBING. NOTES LANDSCAPE ARCHITECTURE SITE PLANNING CIVIL ENGINEERING ANDERSON - JOHNSON ASSOCIATES, INC. 7575 GOLDEN VALLEY ROAD SUITE 200 MINNEAPOLIS. MN 55427 FAX (763) 544-0531 PH (763) 544-7129 DateRegistration Number Check Drawn Date: Comm I hereby certify that this plan, specification or report was prepared by me or under my direct supervision and that I am a duly Licensed under the laws of the State of Revisions Description Date Num Scale: North 501 South Eighth Street Minneapolis, MN 55404 krausanderson.com | 612 332 7281 MOUNDS VIEW HIGH SCHOOL 2019 IMPROVEMENTS 1900 Lake Valentine Road ARDEN HILLS, MINNESOTA 55112 4570 VICTORIA STREET N SHOREVIEW, MINNESOTA 55126 ISD #621: MOUNDS VIEW PUBLIC SCHOOLS PROFESSIONAL ENGINEER MINNESOTA C1.42 1" = 30' DAR MET 02/06/2019 172270 40180 02/06/2019 DAVID A. REY CENTERPLANUTILITY Addendum #2 02/22/2019 1Addendum #3 02/26/2019 2 REFERENCE KEY TO SITE DETAILS DETAIL I.D NUMBER (TOP) DETAIL SHEET NUMBER (BOTTOM) EXISTING CONTOUR PROPOSED CONTOUR PROPOSED SPOT ELEVATION ME = MATCH EXISTING EOF = EMERGENCY OVERFLOW PROPOSED GRADING LIMITS PROPOSED SANITARY SEWER PROPOSED STORM SEWER PROPOSED WATERMAIN PROPOSED DRAINTILE / FINGER DRAIN PROPOSED MANHOLE (MH) PROPOSED CATCH BASIN (CB) PROPOSED FLARED END SECTION (FES) PROPOSED HYDRANT (HYD) PROPOSED GATE VALVE (GV) PROVIDE MINIMUM 18" VERTICAL SEPARATION AT CROSSING - PROVIDE VERTICAL BENDS IN WATERMAIN AS REQUIRED TO ACCOMPLISH. CENTER ONE LENGTH WATERMAIN PIPE ON CROSSING. PROPOSED BUILDING STOOP - REFER TO ARCHITECTURAL PLANS PROPERTY LINE 1 915 15.6 15 C2.11 19 C2.11 20 C2.11 22 C2.11 23 C2.11 17 C2.11 16 C2.11 1 C2.11 5 C2.11 11 C2.11 17B C2.11 923923924 9 2 4 924 925925 925 925925925925 925 926926926926926 926 926926 926927 927 92 7927 927 927 9 1 6 91 7 91 7 91791918 919920 26.9 26.9 26.8 27.4 ME 26.9 26.9 27.427.427.427.427.4 27.427.4 27.3 ME 27.427.427.427.4 26.9 26.9 26.926.9 27.427.427.427.4 26.9 27.1 23.4 25.6 25.2 25.7 26.4 23.0 24.4 24.9 26.8 26.8 26.1 25.6 26.0 25.425.6 25.1 24.0 24.8 24.8 24.4 26.9 25.0 25.4 25.9 25.9 26.6 26.7 24.4 25.2 23.3 23.7 26.2 26.1 25.8 25.7 25.1 25.5 24.6 22.2 22.4 23.2 24.1 23.5 24.2 24.7 24.4 24.0 24.5 26.5 26.4 19.1 ME 18.7 ME 18.4 ME 18.4 ME20.9 ME 18.9 ME 18.3 17.8 18.018.018.0 18.0 17.5 17.1 17.2 17.1 16.9 16.6 16.8 16.7 17.9 17.9 17.7 20.8 20.6 21.4 17.5 16.5 17.8 17.6 17.3 18.0 17.2 16.7 16.0 17.2 16.7 16.8 16.6 15.4 17.0 17.7 22.4 22.5 22.7 22.6 27.2 27.4 26.8 26.0 26.1 26.5 25.8 23.0 ME 22.7 ME 19.0 ME 18.9 ME 18.1 ME 18.5 ME 17.7 27.427.427.4 27.3 26.9 27.2 26.9 26.9 26.7 ME 26.9 26.8 ME 25.5 ME 25.0 26.2 26.6 27.2 26.8 25.5 25.8 24.7 25.3 ME 23.2 25.2 ME 22.9 18.0 18.1 17.0 ME 17.9 17.517.5 16.9 16.9 17.217.5 21.421.2 17.4 17.9 25.2 25.5 18.5 15.1 18.2 ME 18.2 ME 19.4 ME 16.4 17.7 17.5 18.2 17.1 16.8 16.7 18.2 26.6 ME25.7 ME 25.6 ME 25.2 ME 23.8 24.6 25.9 14.2 ME 20.2 ME 23.8 ME 17.5 ME 16.3 ME 15.5 ME 15.5 ME 16.6 ME 23.5 ME 23.8 ME 24.2 ME 23.3 ME 19.7 ME 10.9 ME 13.1 ME 22.7 ME 23.3 ME 24.8 ME 25.4 ME 25.3 ME 24.5 ME 23.5 ME 23.2 ME 22.8 ME 23.3 ME 23.9 ME 24.7 ME 28.5 ME 27.1 ME 25.0 ME 25.0 ME 24.4 ME 24.2 ME 24.3 ME 24.5 ME 24.1 ME 22.4 ME 21.8 ME 21.5 ME 20.3 ME 21.6 ME 26.1 26.2 ME 26.9 ME 26.8 ME 25.9 ME 25.9 ME 25.6 25.8 26.1 27.5 26.9 25.3 25.8 26.6 25.9 25.3 26.0 26.3 25.6 26.0 25.7 24.9 27.2 ME 25.9 26.5 ME 25.7 ME 25.4 ME 24.7 ME 25.2 ME 30.6 ME 32.0 ME 30.4 ME 29.8 ME 29.6 ME 29.5 ME 29.4 ME 29.1 ME 26.6 27.1 27.2 27.1 26.4 25.9 26.3 26.1 25.4 23.8 23.4 20.0 21.7 23.8 31.5 28.8 32.6 32.1 26.0 27.1 24.6 27.0 18.0 17.8 19.1 18.3 19.5 17.7 17.2 16.9 16.8 16.7 17.9 30.6 25.7 27.2 ME 26.7 26.7 ME 26.5 ME 25.4 115' - 6" PVC @ 2.04% 198' - 6"PVC @ 2.08% INV. 903.58 48" ID R-1642 MH 3 RIM = 919.0 INV. = 907.70 48" ID R-1642 MH 4 RIM = 921.7 INV. = 909.30 48" ID R-1642 MH 5 RIM = 928.8 INV. = 911.69 48" ID R-1642 MH 6 RIM = 932.6 INV. = 914.03 NE / SW INV. = 914.28 NW 48" ID R-1642 MH 7 RIM = 932.1 INV. = 916.14 48" ID R-1642 MH 8 RIM = 930.6 INV. = 917.66 48" ID R-1642 BS 2 INV. = 918.82 / MECH. 91'-5" 76 DFUs 81' - 6" PVC @ 1.88% 112' - 6" PVC @ 1.88% 77' - 6" PVC @ 2.08% 119' - 6" PVC @ 2.00% PROPOSED BUILDING ADDITION 'B' PROPOSED BUILDINGADDITION 'F' PROPOSED BUILDING ADDITION 'G' F.F.E. = 927.4 / ARCH. 100'-0" F.F.E. = 927.4 / ARCH. 100'-0" F.F.E. = 916.86 / ARCH. 89'-512" SOUTH PARKING (14 BUS STALLS) CONNECT TO EXISTING 8" WM AND 8" GV BS 1 INV. = 908.74 / MECH. 81'-4" 16 DFUs 83' - 6" PVC @ 2.08% 50' - 4" PVC @ 2.08% 61' - 6" PVC @ 1.88% 5.0 0 ' ( T Y P I C A L )28.06'18.69'5.90'BD 10 (EXISTING) 26,455 S.F. BD 2 (EXISTING) 11,320 S.F. BD 7 (8" STORM) INV. = 919.40 = MECH 92'-0" 5,590 S.F. BD 3 (EXISTING) 5,155 S.F. BD 6 (EXISTING) 7,729 S.F. CB 6 RIM = 923.0 INV. = 909.76 SE INV. = 910.01 NW INV. = 920.00 FD (2) 72" ID R-3067-V CB 8 RIM = 924.6 INV. = 914.42 SE INV. = 914.77 N INV. = 918.93 E INV. = 921.60 FD (2) 48" ID R-3067-V CB 2 RIM = 916.0 INV. = 905.67 N INV. = 906.22 S INV. = 911.20 W INV. = 913.00 FD (3) 72" ID R-3067-V R 3067 V MH 109 RIM = 918.2 INV. = 911.60 INV. = 912.00 DT 48" ID R-1642 PROVIDE BACK WATER VALVE AT DT CONNECTION MH 110 RIM = 919.5 INV. = 911.80 E INV. = 911.97 S 48" ID R-1642 BD 1 (10" STORM) INV. = 912.07 = MECH 84'-8" 15,695 S.F. CB 3 RIM = 917.5 INV. = 906.49 N/S INV. = 912.30 E (EXISTING - FIELD VERI INV. = 914.50 FD (3) 72" ID R-2501-C CONSTRUCT STRUCTURE OVER EXISTING STORM SEWER. PROVIDE FLEXIBLE JOINTS AT CONNECTIONS MH 102 RIM = 920.0 INV. = 906.92 NE/SE INV. = 915.90 SW (EXISTING - FIELD VERIFY) 72" ID R-1642 CONSTRUCT STRUCTURE OVER EXISTING STORM SEWER. PROVIDE FLEXIBLE JOINTS AT CONNECTIONS MH 103 RIM = 923.8 INV. = 907.33 N 72" ID R-1642 CB 4 RIM = 923.8 INV. = 907.76 INV. = 920.80 FD (2) 72" ID R-2501MH 104 RIM = 924.5 INV. = 908.02 NE/SW INV. = 919.50 NW (EXISTING - FIELD VERIFY) 72" ID R-1642 CONSTRUCT STRUCTURE OVER EXISTING STORM SEWER. PROVIDE FLEXIBLE JOINTS AT CONNECTIONS CB 5 RIM = 925.2 INV. = 908.58 INV. = 921.40 DT INV. = 922.20 FD (2) 72" ID R-3067-V PROVIDE BACK WATER VALVE AT DT CONNECTION CB 9 RIM = 922.2 INV. = 918.20 INV. = 919.20 FD (2) 48" ID R-3067-V MH 113 RIM = 926.2 INV. = 919.30 48" ID R-1642 MH 111 RIM = 926.6 INV. = 917.80 SW INV. = 919.00 NE INV. = 922.50 SE 48" ID R-1642 BD 4 (16" STORM) INV. = 922.57 = MECH 95'-2" 62,295 S.F. MH 114 RIM = 927.2 INV. = 919.37 48" ID R-1642 BD 5 (EXISTING 10" STORM) INV. = 919.40 = MECH 92'-0" (EXISTING - FIELD VERIFY) 27,350 S.F. BD 8 INV. = 919.40 = MECH 92'-0" 60,000 S.F. MH 112 RIM = 925.8 INV. = 919.20 NE (EXISTING - FIELD VERIFY) INV. = 919.20 SW 48" ID R-1642 CONSTRUCT STRUCTURE OVER EXISTING STORM SEWER PIPE - PROVIDE FLEXIBLE JOINT AT CONNECTIONS 37' - 12" PVC @ 1.00% 10' - 12" PVC @ 1.00% 3' - 18" PVC @ 1.00% 113' - 30" RCP @ 0.38% 95' - 30" RCP @ 0.43% 143' - 30" PVC @ 0.39% 59' - 30" RCP @ 0.44% 68' - 30" RCP @ 0.40% 26' - 12" PVC @ 0.77% 114' - 30" PVC @ 0.38% 124' - 30" RCP @ 0.50% 70' - 12" PVC @ 0.57% 13' - 12" PVC @ 0.77%5.00'5.0 0 '32.08'8.0 6 ' 34.55'5.00'28. 4 4 '5.00'5.0 0 '3.00'HYD 1 & 6" GV 8" W M HYD 2 & 6" GV8" WMCONNECT TO EXISTING 8" WM AND 8" GV8" WMCONNECT TO EXISTING 8" WM AND 8" GV 11.25° BEND 22.5° BEND 45° BEND 6" X 8" TEE 45° BEND 45° BEND WITH 8x6 REDUCER 45° BEND 45° BEND 8x6 TEE PROVIDE 40' SOLID PVC TO CB 14 11 C2.11 11 C2.11 11 C2.11 11 C2.11 1 1 1 1 1 1 1 1 10 C2.11 10 C2.11 12 C2.11 10' MIN. 1 12 C2.11 PIPE SHALL BE SOLID PVC UNTIL MIN. 10' FROM WM 5 C2.11 ADJUST RIM TO FINISH GRADE. RECONSTRUCT STRUCTURE AS REQUIRED 10' MIN. 10' M I N . 5.0 0 ' ( T Y P I C A L ) 12 C2.11 5 C2.11 5.0 0 ' ( T Y P I C A L ) 12 C2.11 10' M I N .10' MIN.10' MIN.10' MIN. CB 10 RIM = 916.9 INV. = 912.07 30" PVC STRUCTURE H-20 PEDESTRIAN GRATE CB 11 RIM = 916.9 INV. = 912.20 30" PVC STRUCTURE H-20 PEDESTRIAN GRATE 24' - 8" PVC @ 0.54% BS 2 INV. = 916.01 / MECH. 88'-7.25" 388 DFUs MH 105 RIM = 925.5 INV. = 909.22 NE INV. = 909.27 NW 72" ID R-1642 MH 106 RIM = 925.0 INV. = 910.73 SE INV. = 911.43 N 48" ID R-1642 MH 107 RIM = 925.6 INV. = 911.77 SE INV. = 913.02 NW INV. = 917.20 E 60" ID R-1642 MH 108 RIM = 927.0 INV. = 915.34 S INV. = 917.39 N INV. = 919.26 E 48" ID R-1642 MH 115 RIM = 924.8 INV. = 917.79 S INV. = 917.83 W 48" ID R-1642 160' - 30" PVC @ 0.40% 124' - 27" RCP @ 0.40% 103' - 24" RCP @ 0.70% 41' - 24" RCP @ 0.83% 82' - 21" RCP @ 0.41% 40' - 18" RCP @ 1.50% CB 7 RIM = 924.4 INV. = 913.36 S INV. = 913.61 NW INV. = 918.80 NE INV. = 921.40 FD (2) 72" ID R-3067-V 40' - 18" RCP @ 1.00% 146' - 21" RCP @ 0.55% 82' - 18" RCP @ 0.70% 70' - 12" RCP @ 0.57% 65' - 12" RCP @ 0.57% 32' - 12" PVC @ 1.14% 3' - 18" PVC @ 2.33% 11' - 18" PVC @ 1.00% 11 C2.11 11 C2.11 11 C2.11 11 C2.11 11 C2.11 11 C2.11 1 1 LEGEND 1. REFER TO SHEET C1.34, GRADING AND DRAINAGE PLAN FIELDS, FOR GENERAL NOTES. 2.ALL WATERMAIN PIPE SHALL BE DIP, CLASS 52. ALL WATERMAIN SHALL HAVE MINIMUM 8'-0" BURY (TOP OF PIPE TO FINISH GRADE). DIP SHALL BE ENCASED WITH POLYETHYLENE FILM CONFORMING TO ASTM D 1248-889. 3. ALL SANITARY SEWER PIPE SHALL BE PVC PIPE (ASTM D 3034, SDR 26), UNLESS OTHERWISE NOTED. SANITARY SEWER INSTALLATION SHALL BE IN ACCORDANCE WITH ASTM D2321. 4. ALL STORM SEWER PIPE SHALL BE RCP, CLASS III (MIN.), WITH FLEXIBLE WATERTIGHT JOINTS IN ACCORDANCE WITH ASTM C-361 OR PVC PIPE (ASTM D3034, SDR 35) INSTALLED IN ACCORDANCE WITH ASTM D2321, UNLESS OTHERWISE NOTED. 5. FLEXIBLE JOINTS AT STORM SEWER PIPE CONNECTIONS TO STRUCTURES: a. IN ACCORDANCE WITH MINNESOTA PLUMBING CODE, PROVIDE FLEXIBLE JOINTS AT ALL PIPE CONNECTIONS TO ALL STORM SEWER STRUCTURES. b. ACCEPTABLE MANUFACTURERS / PRODUCTS: i. FERNCO, “CONCRETE MANHOLE ADAPTORS” OR “LARGE-DIAMETER WATERSTOPS” ii. PRESS-SEAL, WATERSTOP GROUTING RINGS” iii. OR APPROVED EQUAL. 6. WATERMAIN SHALL BE INSTALLED AT LEAST 10 FEET HORIZONTALLY FROM ANY MANHOLE, CATCH BASIN, STORM SEWER, SANITARY SEWER, DRAINTILE OR OTHER POTENTIAL SOURCE FOR CONTAMINATION PER MINNESOTA PLUMBING CODE. THIS ISOLATION DISTANCE SHALL BE MEASURED FROM THE OUTER EDGE OF THE PIPE TO THE OUTER EDGE OF THE CONTAMINATION SOURCE (OUTER EDGE OF STRUCTURES OR PIPING OR SIMILAR). 7. ANY MANHOLE, CATCH BASIN, STORM SEWER, SANITARY SEWER, DRAINTILE OR OTHER POTENTIAL SOURCE FOR CONTAMINATION SHALL BE INSTALLED AT LEAST 10 FEET HORIZONTALLY FROM ANY WATERMAIN PER MINNESOTA PLUMBING CODE. THIS ISOLATION DISTANCE SHALL BE MEASURED FROM THE OUTER EDGE OF THE PIPE TO THE OUTER EDGE OF THE CONTAMINATION SOURCE (OUTER EDGE OF STRUCTURES OR PIPING OR SIMILAR). 8. LOCATE ALL EXISTING UTILITIES, VERIFY LOCATION, SIZE AND INVERT ELEVATION OF ALL EXISTING UTILITIES. VERIFY LOCATIONS, SIZES AND ELEVATIONS OF SAME BEFORE BEGINNING CONSTRUCTION. 9. PRIOR TO CONSTRUCTION OF PROPOSED BUILDING UTILITY SERVICES (STORM, SANITARY SEWER, WATERMAIN), VERIFY ALL PROPOSED BUILDING UTILITY SERVICE PIPE SIZES, LOCATIONS AND ELEVATIONS WITH MECHANICAL PLANS. COORDINATE CONSTRUCTION AND CONNECTIONS WITH MECHANICAL CONTRACTOR. 10. CONTRACTOR SHALL STAKE LIMITS OF WALKS AND CURBING PRIOR TO INSTALLATION OF GATE VALVES, CATCH BASINS AND MANHOLES. GATE VALVE AND MANHOLE LOCATIONS SHALL BE ADJUSTED TO AVOID PLACEMENT OF THESE STRUCTURES IN WALKS AND CURB AND GUTTER. CURB AND GUTTER SHALL BE STAKED TO ALLOW CURB INLET TYPE CATCH BASINS TO BE PROPERLY LOCATED IN LINE WITH CURBING. NOTES LANDSCAPE ARCHITECTURE SITE PLANNING CIVIL ENGINEERING ANDERSON - JOHNSON ASSOCIATES, INC. 7575 GOLDEN VALLEY ROAD SUITE 200 MINNEAPOLIS. MN 55427 FAX (763) 544-0531 PH (763) 544-7129 DateRegistration Number Check Drawn Date: Comm I hereby certify that this plan, specification or report was prepared by me or under my direct supervision and that I am a duly Licensed under the laws of the State of Revisions Description Date Num Scale: North 501 South Eighth Street Minneapolis, MN 55404 krausanderson.com | 612 332 7281 MOUNDS VIEW HIGH SCHOOL 2019 IMPROVEMENTS 1900 Lake Valentine Road ARDEN HILLS, MINNESOTA 55112 4570 VICTORIA STREET N SHOREVIEW, MINNESOTA 55126 ISD #621: MOUNDS VIEW PUBLIC SCHOOLS PROFESSIONAL ENGINEER MINNESOTA C1.43 1" = 30' DAR MET 02/06/2019 172270 40180 02/06/2019 DAVID A. REY SOUTHPLANUTILITY Addendum #2 02/22/2019 1 1 Addendum #3 02/26/2019 2 REFERENCE KEY TO SITE DETAILS DETAIL I.D NUMBER (TOP) DETAIL SHEET NUMBER (BOTTOM) EXISTING CONTOUR PROPOSED CONTOUR PROPOSED SPOT ELEVATION ME = MATCH EXISTING EOF = EMERGENCY OVERFLOW PROPOSED GRADING LIMITS PROPOSED SANITARY SEWER PROPOSED STORM SEWER PROPOSED WATERMAIN PROPOSED DRAINTILE / FINGER DRAIN PROPOSED MANHOLE (MH) PROPOSED CATCH BASIN (CB) PROPOSED FLARED END SECTION (FES) PROPOSED HYDRANT (HYD) PROPOSED GATE VALVE (GV) PROVIDE MINIMUM 18" VERTICAL SEPARATION AT CROSSING - PROVIDE VERTICAL BENDS IN WATERMAIN AS REQUIRED TO ACCOMPLISH. CENTER ONE LENGTH WATERMAIN PIPE ON CROSSING. PROPOSED BUILDING STOOP - REFER TO ARCHITECTURAL PLANS PROPERTY LINE 1 915 15.6 15 C2.11 19 C2.11 20 C2.11 22 C2.11 23 C2.11 17 C2.11 16 C2.11 1 C2.11 5 C2.11 11 C2.11 17B C2.11 91390 9 9 1 0 911912913 9 1 4 91 5 915 91 6 906 907 912 913 14.8 14.7 14.3 14.2 14.1 13.8 13.7 13.5 13.4 13.2 13.1 12.9 05.4 ME 07.4 ME 07.3 ME 07.6 ME 08.7 ME 09.1 ME 12.9 ME 13.5 13.3 12.7 ME 12.6 ME 12.3 ME 11.9 ME 11.9 ME 13 212 813 0 12.2 ME 12.2 ME 10.0 ME 11.8 ME 13.3 ME 14.3 ME 15.1 ME 15.3 ME 15.9 ME 15.8 ME 15.6 ME 15.3 ME 14.7 ME 15.9 ME 15.6 ME 16.1 ME 15.7 ME 16.7 ME 15.9 ME 15.7 ME 15.5 ME 14.8 ME 14.3 ME 13.4 ME 12.7 ME 06.2 ME 10.6 ME 10.5 ME 11.7 12.3 12.5 13.2 13.8 14.1 14.7 14.9 14.8 15.4 15.6 15.1 15.7 15.9 14.9 14.8 20.5 ME 20.5 ME 12.0 ME12.2 ME 12.1 ME12.5 ME 12.2 12.3 12.1 12.2 12.3 12.2 12.8 12.7 12.7 12.6 12.3 12.4 14.8 14.5 14.3 ME 14.6 ME 14.7 ME 13.1 ME 13.2 ME 13.3 13.2 12.6 ME 12.6 ME 15.1 ME 16.0 15.4 15.6 ME 13.4 ME 12.9 ME 913 914 915 903903903904904904 904905906907 90707.8 07.8 07.8 06.6 EOF 07.8 07.8 07.8 07.8 07.8 A A A A A A A PROVIDE AN ADDITIONAL 2 INLET CONTROL DEVICES AT THE 2 CATCH BASINS ON THE SOUTH SIDE OF LAKE VALENTINE ROAD APPROXIMATELY 100' AND 200' FROM THIS POINT 1 C2.11 1 C2.11 2 C2.11 1 C2.11 1 C2.11 1 C2.11 1 C2.11 1 C2.11 NORTH PARKING (483 STALLS) PROVIDE DAILY SWEEPING OF ALL PAVED AREAS 1. REFER TO SHEET C1.34, GRADING AND DRAINAGE PLAN FIELDS, FOR GENERAL NOTES. 2.REFER TO SWPPP NARRATIVE (SECTION 01 89 13) FOR CONSTRUCTION SEQUENCING AND EROSION CONTROL REQUIREMENTS. 3. MAINTAIN ADJACENT PROPERTY AND PUBLIC STREETS CLEAN FROM CONSTRUCTION CAUSED DIRT AND DEBRIS ON A DAILY BASIS. PROTECT DRAINAGE SYSTEMS FROM SEDIMENTATION AS A RESULT OF CONSTRUCTION RELATED DIRT AND DEBRIS. 4. MAINTAIN DUST CONTROL DURING GRADING OPERATIONS. 5. ALL EROSION CONTROL METHODS SHALL COMPLY WITH MPCA AND OTHER LOCAL REGULATIONS. 6. IF EROSION AND SEDIMENT CONTROL MEASURES TAKEN ARE NOT ADEQUATE AND RESULT IN DOWNSTREAM SEDIMENT, THE CONTRACTOR SHALL BE RESPONSIBLE FOR CLEANING OUT DOWNSTREAM STORM SEWERS AS NECESSARY, INCLUDING ASSOCIATED RESTORATION. 7. SEDIMENT CONTROL DEVICE AT STORM SEWER INLETS. AT THE INLETS TO ALL STORM SEWER STRUCTURES, PROVIDE A PRODUCT FROM THE FOLLOWING LIST. ACCEPTABLE PRODUCTS: A.WIMCO TOP SLAB™ MODEL RD 27. B. INFRASAFE® SEDIMENT CONTROL BARRIER, DISTRIBUTED BY ROYAL ENVIRONMENTAL SYSTEMS, INC. SCB'S SHALL BE SIZED SPECIFICALLY FOR THE STRUCTURE AND CASTING SPECIFIED. SCB'S SHALL BE EQUIPPED WITH FRAME AND PERFORATED SHROUD AND SHALL BE WRAPPED ON THE OUTSIDE, COVERING THE PERFORATED WALL ONLY, WITH A GEOTEXTILE SOCK. C.DANDY BAG® OR DANDY BAG II® DISTRIBUTED BY BROCK WHITE COMPANY, ST. PAUL, MN (615) 647-0950. DANDY BAG SHALL BE USED ONLY FOR CURB INLETS AFTER PAVEMENT (BINDER COURSE OR WEAR COURSE) IS INSTALLED OR AT EXISTING PAVED AREAS. D. INFRASAFE® DEBRIS COLLECTION DEVICE BY ROYAL ENVIRONMENTAL SYSTEMS, INC., DISTRIBUTED BY ESS BROTHERS, 9350 COUNTY ROAD 19, CORCORAN, MN 55357 DCD'S SHALL BE SIZED SPECIFICALLY FOR THE STRUCTURE AND CASTING SPECIFIED. PROVIDE FILTER BAGS AND TIES FOR COMPLETE INSTALLATION. E. OR APPROVED EQUAL. NOTESLEGEND REFERENCE KEY TO SITE DETAILS DETAIL I.D NUMBER (TOP) DETAIL SHEET NUMBER (BOTTOM) EXISTING CONTOUR PROPOSED CONTOUR PROPOSED SPOT ELEVATION ME = MATCH EXISTING EOF = EMERGENCY OVERFLOW PROPOSED GRADING LIMITS PROPOSED STORM SEWER PROPOSED MANHOLE (MH) PROPOSED CATCH BASIN (CB) PROPOSED FLARED END SECTION (FES) PROPOSED SILT FENCE PROPOSED SEDIMENT CONTROL LOG PROPOSED ROCK CONSTRUCTION ENTRANCE SEDIMENT CONTROL DEVICE AT STORM SEWER INLET PROPOSED BUILDING STOOP - REFER TO ARCHITECTURAL PLANS PROPERTY LINE A 15 C2.11 19 C2.11 20 C2.11 22 C2.11 23 C2.11 915 15.6 1 C2.11 LANDSCAPE ARCHITECTURE SITE PLANNING CIVIL ENGINEERING ANDERSON - JOHNSON ASSOCIATES, INC. 7575 GOLDEN VALLEY ROAD SUITE 200 MINNEAPOLIS. MN 55427 FAX (763) 544-0531 PH (763) 544-7129 DateRegistration Number Check Drawn Date: Comm I hereby certify that this plan, specification or report was prepared by me or under my direct supervision and that I am a duly Licensed under the laws of the State of Revisions Description Date Num Scale: North 501 South Eighth Street Minneapolis, MN 55404 krausanderson.com | 612 332 7281 MOUNDS VIEW HIGH SCHOOL 2019 IMPROVEMENTS 1900 Lake Valentine Road ARDEN HILLS, MINNESOTA 55112 4570 VICTORIA STREET N SHOREVIEW, MINNESOTA 55126 ISD #621: MOUNDS VIEW PUBLIC SCHOOLS PROFESSIONAL ENGINEER MINNESOTA C1.51 1" = 30' DAR MET 02/06/2019 172270 40180 02/06/2019 DAVID A. REY NORTHPLANCONTROLAND SEDIMENTPREVENTIONEROSION 1 C2.11 2 C2.11 3 C2.11 Addendum #2 02/22/2019 1 913 9 1 1 911 911 9129 1 2 913 9 1 3 925 6 7 914 9 1 4 914 915915915 9 1 6 9 1 6 917 91 7 91 7 917918918 919920 915 91 6 906 907 911 912 9 1 2 913 27.4 ME 26.9 26.9 27.427.427.427.427.4 27.3 ME 27.1 17.5 ME 18.7 ME 19.1 ME 18.7 ME 18.4 ME 18.4 ME20.9 ME 18.9 ME 18.3 17.8 18.018.018.0 18.0 13.8 13.7 13.5 13.4 13.2 13.1 12.9 11.8 11.2 ME 11.7 ME12.3 ME 07.4 ME 07.3 ME 07.6 ME 12.9 ME 17.5 17.1 15.5 14.7 ME 17.2 17.1 16.9 16.6 16.8 16.7 15.1 15.3 15.4 13.5 13.3 15.3 15.2 15.6 17.9 17.9 17.7 20.8 20.6 21.4 17.5 16.5 17.8 17.6 17.3 18.0 17.2 16.7 16.0 17.2 16.7 16.8 16.6 15.4 14.1 14.715.7 15.8 17.0 17.7 13.7 13.8 22.4 22.5 22.7 22.6 26.8 23.0 ME 22.7 ME 19.0 ME 18.9 ME 18.1 ME 18.5 ME 17.7 18.0 18.1 15.0 ME 15.9 ME 16.6 ME 17.0 ME 12.7 ME 12.6 ME 12.3 ME 11.9 ME 11.9 ME 14.0 14.0 13.212.813.0 12.2 ME 12.2 ME 12.3 ME 12.8 ME 12.8 ME 12.4 ME 12.4 12.4 12.4 12.4 12.4 12.4 12.6 ME 12.6 ME 13.3 ME 13.7 ME 13.8 ME 13.7 ME 13.3 ME 14.0 13.8 13.6 13.8 14.0 13.8 14.1 13.9 14.2 14.0 ME 14.8 14.1 13.9 ME 17.0 ME 14.7 ME 15.9 ME 15.6 ME 16.1 ME 15.7 ME 15.7 15.9 14.9 14.8 20.5 ME 17.9 11.7 ME 12.7 ME 13.6 ME 14.3 ME 14.2 ME 13.8 ME 13.3 ME 12.5 ME 12.6 ME 13.3 13.8 14.2 13.8 13.9 ME 13.6 12.7 17.517.5 16.9 16.9 17.217.5 21.421.2 17.4 17.9 18.5 15.4 15.7 15.4 15.1 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 14.5 ME 14.5 ME 14.5 ME 14.8 ME 14.9 ME 14.5 ME14.5 ME 14.6 ME 17.2 ME 17.5 ME 16.6 ME 15.1 ME 17.4 ME 17.5 ME 18.2 ME 18.2 ME 19.4 ME 16.4 16.6 ME 16.2 ME 15.8 ME 15.6 ME 15.2 ME 15.3 ME 15.9 16.0 16.3 16.5 16.9 17.3 17.7 17.5 18.2 17.1 16.8 16.7 18.2 ME 6 E 26.5 ME 25.7 ME 25.4 ME 24.7 ME 25.2 ME 30.6 ME25 4 12.0 ME12.2 ME 12.1 ME12.5 ME 12.2 12.3 12.1 12.2 12.3 12.2 12.8 12.7 12.7 12.6 12.4 12.3 12.4 12.3 11.6 11.2 11.1 09.0 ME 09.4 ME 09.8 ME 09.1 ME 13.1 ME 13.2 ME 13.3 13.2 12.6 ME 12.6 ME 20.0 21.7 23.8 31.5 28.8 32.627.1 24.6 15.1 ME 16.0 15.4 15.6 ME 11.9 EOF 18.0 17.8 19.1 18.3 19.5 13.4 ME 12.9 ME 17.7 17.2 15.7 16.9 15.5 15.2 15.4 16.8 16.7 17.9 7 27.2 ME 914 BUS PARKING (29 BUS STALLS) PROPOSED BUILDING ADDITION 'B' PROPOSED BUILDING ADDITION 'G' EAST PARKING (174 STALLS) WEST PARKING (8 BUS STALLS) SOUTH PARKING (14 BUS STALLS) ACCESSIBLE PARKING (14 STALLS) A A A A A A A A A A A A 3 C2.11 PROVIDE AN ADDITIONAL 2 INLET CONTROL DEVICES AT THE 2 CATCH BASINS ON LAKE VALENTINE ROAD APPROXIMATELY 25' DOWNSTREAM OF THIS POINT A 1 C2.11 1 C2.11 1 C2.11 2 C2.11 2 C2.11 1 C2.11 1 C2.11 1 C2.11 1 C2.11 A A 1 C2.11 A PROVIDE CURB INLET PROTECTION AT EACH PRETREATMENT STRUCTURE (4) 1. REFER TO SHEET C1.34, GRADING AND DRAINAGE PLAN FIELDS, FOR GENERAL NOTES. 2.REFER TO SWPPP NARRATIVE (SECTION 01 89 13) FOR CONSTRUCTION SEQUENCING AND EROSION CONTROL REQUIREMENTS. 3. MAINTAIN ADJACENT PROPERTY AND PUBLIC STREETS CLEAN FROM CONSTRUCTION CAUSED DIRT AND DEBRIS ON A DAILY BASIS. PROTECT DRAINAGE SYSTEMS FROM SEDIMENTATION AS A RESULT OF CONSTRUCTION RELATED DIRT AND DEBRIS. 4. MAINTAIN DUST CONTROL DURING GRADING OPERATIONS. 5. ALL EROSION CONTROL METHODS SHALL COMPLY WITH MPCA AND OTHER LOCAL REGULATIONS. 6. IF EROSION AND SEDIMENT CONTROL MEASURES TAKEN ARE NOT ADEQUATE AND RESULT IN DOWNSTREAM SEDIMENT, THE CONTRACTOR SHALL BE RESPONSIBLE FOR CLEANING OUT DOWNSTREAM STORM SEWERS AS NECESSARY, INCLUDING ASSOCIATED RESTORATION. 7. SEDIMENT CONTROL DEVICE AT STORM SEWER INLETS. AT THE INLETS TO ALL STORM SEWER STRUCTURES, PROVIDE A PRODUCT FROM THE FOLLOWING LIST. ACCEPTABLE PRODUCTS: A.WIMCO TOP SLAB™ MODEL RD 27. B. INFRASAFE® SEDIMENT CONTROL BARRIER, DISTRIBUTED BY ROYAL ENVIRONMENTAL SYSTEMS, INC. SCB'S SHALL BE SIZED SPECIFICALLY FOR THE STRUCTURE AND CASTING SPECIFIED. SCB'S SHALL BE EQUIPPED WITH FRAME AND PERFORATED SHROUD AND SHALL BE WRAPPED ON THE OUTSIDE, COVERING THE PERFORATED WALL ONLY, WITH A GEOTEXTILE SOCK. C.DANDY BAG® OR DANDY BAG II® DISTRIBUTED BY BROCK WHITE COMPANY, ST. PAUL, MN (615) 647-0950. DANDY BAG SHALL BE USED ONLY FOR CURB INLETS AFTER PAVEMENT (BINDER COURSE OR WEAR COURSE) IS INSTALLED OR AT EXISTING PAVED AREAS. D. INFRASAFE® DEBRIS COLLECTION DEVICE BY ROYAL ENVIRONMENTAL SYSTEMS, INC., DISTRIBUTED BY ESS BROTHERS, 9350 COUNTY ROAD 19, CORCORAN, MN 55357 DCD'S SHALL BE SIZED SPECIFICALLY FOR THE STRUCTURE AND CASTING SPECIFIED. PROVIDE FILTER BAGS AND TIES FOR COMPLETE INSTALLATION. E. OR APPROVED EQUAL. NOTESLEGEND LANDSCAPE ARCHITECTURE SITE PLANNING CIVIL ENGINEERING ANDERSON - JOHNSON ASSOCIATES, INC. 7575 GOLDEN VALLEY ROAD SUITE 200 MINNEAPOLIS. MN 55427 FAX (763) 544-0531 PH (763) 544-7129 DateRegistration Number Check Drawn Date: Comm I hereby certify that this plan, specification or report was prepared by me or under my direct supervision and that I am a duly Licensed under the laws of the State of Revisions Description Date Num Scale: North 501 South Eighth Street Minneapolis, MN 55404 krausanderson.com | 612 332 7281 MOUNDS VIEW HIGH SCHOOL 2019 IMPROVEMENTS 1900 Lake Valentine Road ARDEN HILLS, MINNESOTA 55112 4570 VICTORIA STREET N SHOREVIEW, MINNESOTA 55126 ISD #621: MOUNDS VIEW PUBLIC SCHOOLS PROFESSIONAL ENGINEER MINNESOTA C1.52 1" = 30' DAR MET 02/06/2019 172270 40180 02/06/2019 DAVID A. REY CENTERPLANCONTROLAND SEDIMENTPREVENTIONEROSION Addendum #2 02/22/2019 1 1 REFERENCE KEY TO SITE DETAILS DETAIL I.D NUMBER (TOP) DETAIL SHEET NUMBER (BOTTOM) EXISTING CONTOUR PROPOSED CONTOUR PROPOSED SPOT ELEVATION ME = MATCH EXISTING EOF = EMERGENCY OVERFLOW PROPOSED GRADING LIMITS PROPOSED STORM SEWER PROPOSED MANHOLE (MH) PROPOSED CATCH BASIN (CB) PROPOSED FLARED END SECTION (FES) PROPOSED SILT FENCE PROPOSED SEDIMENT CONTROL LOG PROPOSED ROCK CONSTRUCTION ENTRANCE SEDIMENT CONTROL DEVICE AT STORM SEWER INLET PROPOSED BUILDING STOOP - REFER TO ARCHITECTURAL PLANS PROPERTY LINE A 15 C2.11 19 C2.11 20 C2.11 22 C2.11 23 C2.11 915 15.6 1 C2.11 1 C2.11 2 C2.11 3 C2.11 923923924 9 2 4 924 925925 925 925925925925 925 926926926926926 926 926926 926927 927 92 7927 927 927 91 7 91 7 917918919920 26.9 26.9 26.8 27.4 ME 26.9 26.9 27.427.427.427.427.4 27.427.4 27.3 ME 27.427.427.427.4 26.9 26.9 26.926.9 27.427.427.427.4 26.9 27.1 23.4 25.6 25.2 25.7 26.4 23.0 24.4 24.9 26.8 26.8 26.1 25.6 26.0 25.425.6 25.1 24.0 24.8 24.8 24.4 26.9 25.0 25.4 25.9 25.9 26.6 26.7 24.4 25.2 23.3 23.7 26.2 26.1 25.8 25.7 25.1 25.5 24.6 22.2 22.4 23.2 24.1 23.5 24.2 24.7 24.4 24.0 24.5 26.5 26.4 18.7 18.4 ME 18.4 ME20.9 ME 18.9 ME 18.3 17.8 18.018.018.0 18.0 17.5 17.1 17.2 17.1 16.9 16.6 16.8 16.7 17.9 17.9 17.7 20.8 20.6 21.4 17.5 16.5 17.8 17.6 17.3 18.0 17.2 16.7 16.0 17.2 16.7 16.8 16.6 17.7 22.4 22.5 22.7 22.6 27.2 27.4 26.8 26.0 26.1 26.5 25.8 23.0 ME 22.7 ME 19.0 ME 18.9 ME 18.1 ME 18.5 ME 17.7 27.427.427.4 27.3 26.9 27.2 26.9 26.9 26.7 ME 26.9 26.8 ME 25.5 ME 25.0 26.2 26.6 27.2 26.8 25.5 25.8 24.7 25.3 ME 23.2 25.2 ME 22.9 18.0 18.1 17.9 17.517.5 16.9 16.9 17.217.5 21.421.2 17.4 17.9 25.2 25.5 18.5 18.2 ME 18.2 ME 19.4 ME 16.4 17.5 18.2 17.1 16.8 16.7 18.2 26.6 ME25.7 ME 25.6 ME 25.2 ME 23.8 24.6 25.9 14.2 ME 20.2 ME 23.8 ME 17.5 ME 16.3 ME 15.5 ME 15.5 ME 16.6 ME 23.5 ME 23.8 ME 24.2 ME 23.3 ME 19.7 ME 10.9 ME 13.1 ME 22.7 ME 23.3 ME 24.8 ME 25.4 ME 25.3 ME 24.5 ME 23.5 ME 23.2 ME 22.8 ME 23.3 ME 23.9 ME 24.7 ME 28.5 ME 27.1 ME 25.0 ME 25.0 ME 24.4 ME 24.2 ME 24.3 ME 24.5 ME 24.1 ME 22.4 ME 21.8 ME 21.5 ME 20.3 ME 21.6 ME 26.1 26.2 ME 26.9 ME 26.8 ME 25.9 ME 25.9 ME 25.6 25.8 26.1 27.5 26.9 25.3 25.8 26.6 25.9 25.3 26.0 26.3 25.6 26.0 25.7 24.9 27.2 ME 25.9 26.5 ME 25.7 ME 25.4 ME 24.7 ME 25.2 ME 30.6 ME 32.0 ME 30.4 ME 29.8 ME 29.6 ME 29.5 ME 29.4 ME 29.1 ME 26.6 27.1 27.2 27.1 26.4 25.9 26.3 26.1 25.4 23.8 23.4 20.0 21.7 23.8 31.5 28.8 32.6 32.1 26.0 27.1 24.6 27.0 18.0 17.8 19.1 18.3 19.5 17.7 17.2 16.9 16.8 16.7 17.9 30.6 25.7 27.2 ME 26.7 26.7 ME 26.5 ME 25.4 PROPOSED BUILDING ADDITION 'B' PROPOSED BUILDING ADDITION 'F' PROPOSED BUILDING ADDITION 'G' SOUTH PARKING (14 BUS STALLS) A A A A 1 C2.11 1 C2.11 1 C2.11 1 C2.11 A A A A A A A 1 C2.11 1 C2.11 1 C2.11 1 C2.11 1 C2.11 1. REFER TO SHEET C1.34, GRADING AND DRAINAGE PLAN FIELDS, FOR GENERAL NOTES. 2.REFER TO SWPPP NARRATIVE (SECTION 01 89 13) FOR CONSTRUCTION SEQUENCING AND EROSION CONTROL REQUIREMENTS. 3. MAINTAIN ADJACENT PROPERTY AND PUBLIC STREETS CLEAN FROM CONSTRUCTION CAUSED DIRT AND DEBRIS ON A DAILY BASIS. PROTECT DRAINAGE SYSTEMS FROM SEDIMENTATION AS A RESULT OF CONSTRUCTION RELATED DIRT AND DEBRIS. 4. MAINTAIN DUST CONTROL DURING GRADING OPERATIONS. 5. ALL EROSION CONTROL METHODS SHALL COMPLY WITH MPCA AND OTHER LOCAL REGULATIONS. 6. IF EROSION AND SEDIMENT CONTROL MEASURES TAKEN ARE NOT ADEQUATE AND RESULT IN DOWNSTREAM SEDIMENT, THE CONTRACTOR SHALL BE RESPONSIBLE FOR CLEANING OUT DOWNSTREAM STORM SEWERS AS NECESSARY, INCLUDING ASSOCIATED RESTORATION. 7. SEDIMENT CONTROL DEVICE AT STORM SEWER INLETS. AT THE INLETS TO ALL STORM SEWER STRUCTURES, PROVIDE A PRODUCT FROM THE FOLLOWING LIST. ACCEPTABLE PRODUCTS: A.WIMCO TOP SLAB™ MODEL RD 27. B. INFRASAFE® SEDIMENT CONTROL BARRIER, DISTRIBUTED BY ROYAL ENVIRONMENTAL SYSTEMS, INC. SCB'S SHALL BE SIZED SPECIFICALLY FOR THE STRUCTURE AND CASTING SPECIFIED. SCB'S SHALL BE EQUIPPED WITH FRAME AND PERFORATED SHROUD AND SHALL BE WRAPPED ON THE OUTSIDE, COVERING THE PERFORATED WALL ONLY, WITH A GEOTEXTILE SOCK. C.DANDY BAG® OR DANDY BAG II® DISTRIBUTED BY BROCK WHITE COMPANY, ST. PAUL, MN (615) 647-0950. DANDY BAG SHALL BE USED ONLY FOR CURB INLETS AFTER PAVEMENT (BINDER COURSE OR WEAR COURSE) IS INSTALLED OR AT EXISTING PAVED AREAS. D. INFRASAFE® DEBRIS COLLECTION DEVICE BY ROYAL ENVIRONMENTAL SYSTEMS, INC., DISTRIBUTED BY ESS BROTHERS, 9350 COUNTY ROAD 19, CORCORAN, MN 55357 DCD'S SHALL BE SIZED SPECIFICALLY FOR THE STRUCTURE AND CASTING SPECIFIED. PROVIDE FILTER BAGS AND TIES FOR COMPLETE INSTALLATION. E. OR APPROVED EQUAL. NOTES LEGEND LANDSCAPE ARCHITECTURE SITE PLANNING CIVIL ENGINEERING ANDERSON - JOHNSON ASSOCIATES, INC. 7575 GOLDEN VALLEY ROAD SUITE 200 MINNEAPOLIS. MN 55427 FAX (763) 544-0531 PH (763) 544-7129 DateRegistration Number Check Drawn Date: Comm I hereby certify that this plan, specification or report was prepared by me or under my direct supervision and that I am a duly Licensed under the laws of the State of Revisions Description Date Num Scale: North 501 South Eighth Street Minneapolis, MN 55404 krausanderson.com | 612 332 7281 MOUNDS VIEW HIGH SCHOOL 2019 IMPROVEMENTS 1900 Lake Valentine Road ARDEN HILLS, MINNESOTA 55112 4570 VICTORIA STREET N SHOREVIEW, MINNESOTA 55126 ISD #621: MOUNDS VIEW PUBLIC SCHOOLS PROFESSIONAL ENGINEER MINNESOTA C1.53 1" = 30' DAR MET 02/06/2019 172270 40180 02/06/2019 DAVID A. REY SOUTHPLANCONTROLAND SEDIMENTPREVENTIONEROSION Addendum #2 02/22/2019 1 REFERENCE KEY TO SITE DETAILS DETAIL I.D NUMBER (TOP) DETAIL SHEET NUMBER (BOTTOM) EXISTING CONTOUR PROPOSED CONTOUR PROPOSED SPOT ELEVATION ME = MATCH EXISTING EOF = EMERGENCY OVERFLOW PROPOSED GRADING LIMITS PROPOSED STORM SEWER PROPOSED MANHOLE (MH) PROPOSED CATCH BASIN (CB) PROPOSED FLARED END SECTION (FES) PROPOSED SILT FENCE PROPOSED SEDIMENT CONTROL LOG PROPOSED ROCK CONSTRUCTION ENTRANCE SEDIMENT CONTROL DEVICE AT STORM SEWER INLET PROPOSED BUILDING STOOP - REFER TO ARCHITECTURAL PLANS PROPERTY LINE A 15 C2.11 19 C2.11 20 C2.11 22 C2.11 23 C2.11 915 15.6 1 C2.11 1 C2.11 2 C2.11 3 C2.11 91 7 91 8 919 920920 921921 922922 923 924 925 926 927 928 929929 930930931931932932 933933933 934 935 30.0 29.6 32.6 33.0 19.6 ME 28.3 ME 35.9 ME 32.6 ME 30.6 ME 26.6 ME 26.6 ME 26.6 ME 19.6 ME 19.6 ME 29.6 ME 29.5 ME 29.2 ME 29.0 ME 29.3 ME 29.5 ME 29.1 ME 28.9 ME 29.8 ME 28.8 ME 28.5 ME 29.7 ME 16.6 ME 16.2 ME 19.7 ME 19.7 ME 19.7 ME 19.3 19.1 18.8 18.4 29.5 ME 32.9 ME 33.0 ME 33.1 ME 33.2 ME 33.0 ME 33.2 ME 33.2 ME 33.2 ME 32.7 ME 33.2 ME PROPOSED FOOTBALL / LACROSSE FIELD (180' X 360') A 1 C2.11 1 C2.11 1 C2.11 1 C2.11 1 C2.11 1 C2.11 1 C2.11 1 C2.11 SILT FENCE = 5,050 L.F. SEDIMENT CONTROL LOG = 720 L.F. ROCK CONSTRUCTION ENTRANCE = 75 C.Y. SEDIMENT CONTROL DEVICE AT STORM SEWER INLET = 48 APPROXIMATE EROSION CONTROL DEVICE QUANTITIES 1. REFER TO SHEET C1.34, GRADING AND DRAINAGE PLAN FIELD, FOR GENERAL NOTES. 2.REFER TO SWPPP NARRATIVE (SECTION 01 89 13) FOR CONSTRUCTION SEQUENCING AND EROSION CONTROL REQUIREMENTS. 3. MAINTAIN ADJACENT PROPERTY AND PUBLIC STREETS CLEAN FROM CONSTRUCTION CAUSED DIRT AND DEBRIS ON A DAILY BASIS. PROTECT DRAINAGE SYSTEMS FROM SEDIMENTATION AS A RESULT OF CONSTRUCTION RELATED DIRT AND DEBRIS. 4. MAINTAIN DUST CONTROL DURING GRADING OPERATIONS. 5. ALL EROSION CONTROL METHODS SHALL COMPLY WITH MPCA AND OTHER LOCAL REGULATIONS. 6. IF EROSION AND SEDIMENT CONTROL MEASURES TAKEN ARE NOT ADEQUATE AND RESULT IN DOWNSTREAM SEDIMENT, THE CONTRACTOR SHALL BE RESPONSIBLE FOR CLEANING OUT DOWNSTREAM STORM SEWERS AS NECESSARY, INCLUDING ASSOCIATED RESTORATION. 7. SEDIMENT CONTROL DEVICE AT STORM SEWER INLETS. AT THE INLETS TO ALL STORM SEWER STRUCTURES, PROVIDE A PRODUCT FROM THE FOLLOWING LIST. ACCEPTABLE PRODUCTS: A.WIMCO TOP SLAB™ MODEL RD 27. B. INFRASAFE® SEDIMENT CONTROL BARRIER, DISTRIBUTED BY ROYAL ENVIRONMENTAL SYSTEMS, INC. SCB'S SHALL BE SIZED SPECIFICALLY FOR THE STRUCTURE AND CASTING SPECIFIED. SCB'S SHALL BE EQUIPPED WITH FRAME AND PERFORATED SHROUD AND SHALL BE WRAPPED ON THE OUTSIDE, COVERING THE PERFORATED WALL ONLY, WITH A GEOTEXTILE SOCK. C.DANDY BAG® OR DANDY BAG II® DISTRIBUTED BY BROCK WHITE COMPANY, ST. PAUL, MN (615) 647-0950. DANDY BAG SHALL BE USED ONLY FOR CURB INLETS AFTER PAVEMENT (BINDER COURSE OR WEAR COURSE) IS INSTALLED OR AT EXISTING PAVED AREAS. D. INFRASAFE® DEBRIS COLLECTION DEVICE BY ROYAL ENVIRONMENTAL SYSTEMS, INC., DISTRIBUTED BY ESS BROTHERS, 9350 COUNTY ROAD 19, CORCORAN, MN 55357 DCD'S SHALL BE SIZED SPECIFICALLY FOR THE STRUCTURE AND CASTING SPECIFIED. PROVIDE FILTER BAGS AND TIES FOR COMPLETE INSTALLATION. E. OR APPROVED EQUAL. NOTESLEGEND EXCERPT FROM THE SWPPP NARRATIVE The following is from the Storm Water Pollution Prevention Plan Narrative, Section 01 89 13 of the Project Manual. In accordance with Section 31 00 00, the Contractor shall be responsible for full implementation of and maintenance required by the SWPPP Narrative until the Notice of Termination is approved by the MPCA. Should differences arise between the SWPPP Narrative information described below and the information contained within the SWPPP Narrative, bound into the Project Manual, the SWPPP in the Project Manual shall govern. V.General Construction Sequence A.Erosion Control Devices, noted herein, include: 1.Silt fence 2.Sediment Control Device at storm sewer inlets 3.Sediment log 4.Rock construction entrance 5.Rock check dams 6.Rip rap 7.Storm water treatment basins 8.Temporary sediment basins 9.Storm sewer systems 10.Temporary outlet pipes 11.Erosion control blanket 12.Temporary seeding 13.Final seeding / sodding 14.Temporary / permanent vegetation 15.Other features identified by the Minnesota Pollution Control Agency, City or Engineer as a Best Management Practice (BMP) device. B.Contractor shall apply for NPDES Phase II Permit within 24 hours of award of Contract. 1.The Contractor shall post the permit in the job site trailer or other suitable temporary storage area. C.Review the SWPPP and its sequencing and requirements. The Contractor shall notify the Engineer if site conditions, construction sequencing, or other items are different or require modification from this written SWPPP. The Engineer will review the suggested modifications and amend the SWPPP accordingly. D.Following review of the SWPPP plans commence with the following construction sequence: 1.Install perimeter silt fence where indicated on the Drawings. Silt fence shall be as specified in Section 31 25 00. 2.Prior to construction, delineate turf and vegetated areas not to be disturbed with orange snow fence. No construction traffic, equipment or materials shall be permitted to utilize, access, or otherwise enter the areas designated not to be disturbed. Minimize soil compaction and disruption of topsoil in areas outside the construction limits to comply with MN Construction Stormwater General Permit. 3.Locally strip topsoil and push topsoil into minimum 2 foot high temporary berms at perimeter silt fence locations for redundant erosion protection. Where possible, leave an undisturbed vegetation strip between the temporary topsoil berm and the silt fence. Silt fence shall be located downslope from the temporary berm. a.Provide temporary seed and mulch on temporary berms as described herein. 4.Construct Sediment Control Devices at existing storm sewer inlets (hay bales around castings and silt fence under castings will not be acceptable). 5.Construct the rock construction entrances. 6.Have silt fence and other erosion control devices inspected by local authorities, as required by the local authority. 7.Begin work at the building additions to allow for critical path construction of buildings footings, foundations, and the remainder of the buildings. a.Remove existing surface features (pavements, curbing, etc.). Minimize disturbance to minimize erosion potential. b.Strip and stockpile topsoil from the building additions and its oversize area. Provide temporary seed and mulch on stockpile as described herein. c.Establish a concrete truck washout area and post with a sign. d.Rough grade the building pads. e.Complete the grading of the building pads. f.Begin footing excavations. g.Provide temporary seed and mulch on all stockpiles as described herein. 8.Construct the sanitary sewer systems. a.Remove existing surface features (pavements, curbing, etc.). Minimize disturbance to minimize erosion potential. b.Strip and stockpile topsoil. Provide temporary seed and mulch on stockpile as described herein. c.Stockpile excavated soils away from drainage swales. d.Backfill excavations at the end of each day. 9.Construct the watermain systems. a.Remove existing surface features (pavements, curbing, etc.). Minimize disturbance to minimize erosion potential. b.Strip and stockpile topsoil. Provide temporary seed and mulch on stockpile as described herein. c.Stockpile excavated soils away from drainage swales. d.Backfill excavations at the end of each day. 10.Begin work on the west / south perimeter drives, northeast parking, parking area north of Lake Valentine Road, and bus parking areas, and surrounding areas. Work may occur simultaneously. a.Strip and stockpile topsoil. Provide temporary seed and mulch on stockpile as described herein. b.Remove existing surface features (pavements, curbing, etc.). Minimize disturbance to minimize erosion potential. c.Rough grade the parking lots and drive areas. d.Construct proposed storm sewer system. (1)Construct Sediment Control Devices at proposed storm sewer inlets (hay bales around castings and silt fence under castings will not be acceptable). e.Construct the underground stormwater systems. (1)Protect the underground retention systems during construction. (2)Construct a temporary berm around the open excavations to prevent construction site sediment from reaching the underground retention systems. The temporary berms can be a simple wind-row of soil pushed into a berm from the adjacent areas. (3)Do not allow sediment to reach the underground systems. Maintenance of Sediment Control Devices is critical until the upslope areas are stabilized. (4)Once backfilling the underground retention systems is complete, remove the temporary berm. f.Establish subgrade elevation at the parking lot and drive areas, and prepare these areas for subsequent courses. g.Once pavement subgrade testing is complete, construct the stabilized aggregate base course. This will serve as temporary stabilization for the parking lot and drive areas. h.Construct curb and gutter, driveway entrance, and concrete walks. This will serve as permanent stabilization for the walk areas. i.Construct the first lift of pavement in the parking lot and drive areas. This will serve as permanent stabilization for the bituminous paved areas. j.Once the upslope areas are stabilized, Construct the Filtration Area. (1)The parking lot relies on this area for storm drainage. Therefore, it is critical to maintain or enhance the infiltrating properties of the soils within this area. Options to accomplish include the following: (a)Limit construction traffic within these areas as much as possible to avoid contaminating and compacting the soils in these areas. (b)Use a toothed bucket backhoe to excavate soils. Use off road trucks to haul and dump soils to other parts of the site. (c)Use a bucket and backhoe to place soils (where fill is required). (d)Use a toothed bucket for rough grading. (e)Use manual labor for finish grading. (f)Do not use equipment on the surface of the areas as this will compact the soils. Minimize smearing of the soils with mechanical equipment. (g)No stockpiling of soils or other materials shall occur within the areas. (2)Rough grade the filtration area to specified tolerances and in accordance with the procedures listed in Section 31 00 00 Earthwork. (a)Access the area at a single location to minimize disturbance to the surrounding areas. (b)Use of self propelled equipment shall be limited within the Filtration Area. Self propelled equipment will compact the soils and adversely affect infiltration. As much as possible, access work in the filtration area from the edges, outside of the filtration area limits. (c)Use a backhoe with long reach ability for final excavation that reaches from outside the areas). (d)Remove all debris by hand. (e)Scarify the existing underlying soils as specified in Section 31 00 00 Earthwork. (3)Provide final grading and final restoration at the Filtration Area, including: (a)Access the areas at a single location to minimize disturbance to the surrounding areas. (b)Use of self propelled equipment shall be as described above. Do not use skid steer equipment within the area. (c)Final grade by hand. (d)Prepare this area for final restoration. (e)Provide final seed and mulch. This will serve as permanent stabilization for the slopes adjacent to the Filtration Area. (f)Sod the areas by hand. (g)Establish vegetation by watering with a temporary irrigation system. Refer to Section 31 00 00 Earthwork for additional information. 11.Spread topsoil and finish grade turf grass areas (except around the building addition until exterior building work is complete). 12.Install landscaping and plantings. 13.Sod the turf grass areas except for the areas around the building. Use a temporary irrigation system to keep sod adequately watered. This will serve as permanent stabilization for the turf grass areas. 14.Complete exterior building work. 15.Spread topsoil around the building area. 16.Finish grade topsoil and prepare these areas for sod. 17.Sod the areas around the building. Use a temporary irrigation system to keep sod adequately watered. 18.Provide final lift of pavement and pavement markings. 19.Provide final stabilization and cleanup of the site. E.Provide maintenance to erosion control devices and BMP’s to comply with the requirements of the permit. F.Re-install all sediment control practices that have been adjusted or removed to accommodate short-term activates, such as passage of construction vehicles or equipment, immediately after the short-term activity has been completed. All sediment control practices shall be re-installed before the next precipitation event if the short term activity is not complete. G.Inspect erosion control devices and provide routine maintenance as follows: 1.Inspect erosion control a minimum of once per week and after each rain event measuring 0.5" or more. Record inspection on log posted in Contractor’s construction trailer or other suitable temporary storage area. a.Records of each inspection and maintenance activity shall include: (1)Date and time of inspections (2)Name of person conducting inspection (3)Findings of inspections, including recommendations for corrective actions (4)Findings shall include photographs, accurate description of the observations (i.e., color, odor, settled or suspended solids, oil sheen, or other pollutants), and a map describing the locations of the observations (5)Corrective actions taken (including dates, times, and party completing maintenance activities (6)Date and amount of all rainfall events greater than one quarter inch (0.25 inch) in 24 hours (7)Documentation of changes made to the SWPPP as required by the NPDES General Stormwater Permit for Construction Activity (MN R100001) b.Inspections are not required where the ground is frozen. The required inspections and maintenance schedule must begin within 24 hours after runoff occurs at the site or 24 hours prior to resuming construction, whichever comes first. c. Inspections of areas with permanent cover may be reduced to once per month, even if construction activity continues on other portions of the site. Once all construction activity is complete, monthly inspections may be terminated after one year following completion of all construction activities. 2.Provide maintenance for all devices as follows: a.Silt fences, sediment logs, and erosion control devices at storm sewer inlets shall be inspected for depth of sediment, tears, to see if fabric is securely attached to support posts or structure, and to see that posts and devices are securely in place. b.Silt fences, sediment logs and erosion control devices at storm sewer inlets, and other erosion control devices shall be cleaned when sediment reaches 1/3 the height of the erosion control device, within 24 hours. c.Rock construction entrances shall be inspected for clogging of river rock. River rock that has become clogged with sediment shall be removed and replaced with fresh river rock. d.Repairs or replacements to all erosion control devices shall occur within 24 hours of discovery. e.Temporary diversion berms shall be inspected and any breaches promptly repaired. f.Tracked sediment from construction vehicles on to public streets and paved areas (including paved areas on the construction site) shall be removed within 24 hours of discovery. g.Removal of sediment and restabilization of Surface Waters shall be accomplished within 7 days of discovery (note: surface waters include curb and gutter, pavements, storm sewer, swales, or other similar storm water conveyance devices). h.Inlet protection may be removed if a local unit of government directs the permitee to do so because of a specific safety concern. H.Provide dewatering of excavations as identified in Section 31 00 00. I.Temporary Soil Stockpiles: 1.Temporary soil stockpiles shall not be placed in surface waters of the state, including surface conveyances such as curb and gutter, swales, or ditches. 2.Install silt fence at the base of the temporary soil stockpile (full perimeter). 3.Temporary soil stockpiles shall be seeded with temporary seed mix and hydromulch when stockpiles are left inactive for seven (7) days. Note, this does not apply to aggregate stockpiles or other stockpiles without significant silt, clay or organic components (clean aggregate stockpiles, clean rock, clean sand and similar clean aggregates). J.Stabilize denuded areas, initiated immediately, within the following number of days of last construction activity (temporary or permanent) in that area: 1.Within 7 days, except: a.Temporary soil stockpiles shall be treated with appropriate erosion control measure, including silt fence and temporary seeding when stockpiles are left inactive for periods longer than 7 days. Note, this does not apply to aggregate stockpiles or other stockpiles without significant silt, clay or organic components (clean aggregate stockpiles, clean rock, clean sand and similar clean aggregates). K.Provide maintenance of all seeded and sodded areas until fully established. L.Provide cleaning of storm sewer system at the completion of the project. Cleaning shall include removal of accumulated sediment from all surface waters as defined by the permit (for example, curb and gutter, pavements, swales, and storm sewer piping and structures). M.Remove silt fence and erosion control devices at storm sewer inlets following full establishment of site vegetation. Dispose materials properly off-site. N.Apply for Notice of Termination (NOT) with MPCA. NOT must be submitted within 30 days after: 1.Site has undergone Final Stabilization (at least 80% vegetative cover), and 2.Removal of all temporary erosion control measures (silt fence, etc.), and 3.Final cleanout and maintenance of all permanent storm water facilities, and 4.Completion of all maintenance activities and site cleanup. LANDSCAPE ARCHITECTURE SITE PLANNING CIVIL ENGINEERING ANDERSON - JOHNSON ASSOCIATES, INC. 7575 GOLDEN VALLEY ROAD SUITE 200 MINNEAPOLIS. MN 55427 FAX (763) 544-0531 PH (763) 544-7129 DateRegistration Number Check Drawn Date: Comm I hereby certify that this plan, specification or report was prepared by me or under my direct supervision and that I am a duly Licensed under the laws of the State of Revisions Description Date Num Scale: North 501 South Eighth Street Minneapolis, MN 55404 krausanderson.com | 612 332 7281 MOUNDS VIEW HIGH SCHOOL 2019 IMPROVEMENTS 1900 Lake Valentine Road ARDEN HILLS, MINNESOTA 55112 4570 VICTORIA STREET N SHOREVIEW, MINNESOTA 55126 ISD #621: MOUNDS VIEW PUBLIC SCHOOLS PROFESSIONAL ENGINEER MINNESOTA C1.54 1" = 30' DAR MET 02/06/2019 172270 40180 02/06/2019 DAVID A. REY FIELDPLANCONTROLAND SEDIMENTPREVENTIONEROSION REFERENCE KEY TO SITE DETAILS DETAIL I.D NUMBER (TOP) DETAIL SHEET NUMBER (BOTTOM) EXISTING CONTOUR PROPOSED CONTOUR PROPOSED SPOT ELEVATION ME = MATCH EXISTING EOF = EMERGENCY OVERFLOW PROPOSED GRADING LIMITS PROPOSED STORM SEWER PROPOSED MANHOLE (MH) PROPOSED CATCH BASIN (CB) PROPOSED FLARED END SECTION (FES) PROPOSED SILT FENCE PROPOSED SEDIMENT CONTROL LOG PROPOSED ROCK CONSTRUCTION ENTRANCE SEDIMENT CONTROL DEVICE AT STORM SEWER INLET PROPOSED BUILDING STOOP - REFER TO ARCHITECTURAL PLANS PROPERTY LINE A 15 C2.11 19 C2.11 20 C2.11 22 C2.11 23 C2.11 915 15.6 1 C2.11 1 C2.11 2 C2.11 3 C2.11 Addendum #2 02/22/2019 1 913 9 1 1 911 911 9129 1 2 913 9 1 3 923924 925 925 926 926927927 914 9 1 4 914 915915915 9 1 6 9 1 6 917 91 7 91 7 917918918 919 920 9 09 9 1 0911 912913 9 1 4 91 5 915 91 6 906 907 911 912 9 1 2 913 913 914 915 903903 903903903904904904 904904 905906907 90 7 BUS PARKING (29 BUS STALLS) PROPOSED BUILDING ADDITION 'B' EAST PARKING (174 STALLS) WEST PARKING (8 BUS STALLS) REFER TO 10 / C2.15 FOR DETAILED VIEW OF FILTRATION PLANTINGS NATIVE SEED RSS WALLS NATIVE SEED RSS WALL NATIVE SEED RSS WALLS PATCH SOD AS REQUIRED FOR AREAS DISTURBED BY TREE PLANTING NORTH PARKING (483 STALLS) 5 AN 2 QB QB 1 IV 8 SL 5 AI 5 AM3 5 IW 7 LG 7 AT 9 LS 10 12 MB CR 6 EJ 11 LG 8 AM3 7 SL 6 LC 6 11 RS 5 VA 6 SL MB 10 AI 9 7 CR AM3 3 AM3 4 8 EJ IW 5 5 LC 7 SL 15 IV AT 12 3 AM TW 4 1 CO 1 CO 4 TR CV 1 SR 3 AN 1 MP 2 AN 1 3 SR 1 AN 2 MP 1 AN AS 1 2 AS 2 QE QB 3 1 QM QM QA 4 AS 2 MP 4 PL 3 JB 10 HB 5 HD 7 6 HB AM 1 2 QC QC 1 QM 2 AS 3 5 AS QB 4 2 QC 2 AM AS 5AM 3 QM 1 PR 3 TR 5 PR 5 QM 1QB 3 LL 5QM 2 LL 4 PB 6 TW 4 2 QC 5 AF 2 PB 2 PR 3 QB 3 AS 4 QA QE 3 LANDSCAPE ARCHITECTURE SITE PLANNING CIVIL ENGINEERING ANDERSON - JOHNSON ASSOCIATES, INC. 7575 GOLDEN VALLEY ROAD SUITE 200 MINNEAPOLIS. MN 55427 FAX (763) 544-0531 PH (763) 544-7129 DateRegistration Number Check Drawn Date: Comm I hereby certify that this plan, specification or report was prepared by me or under my direct supervision and that I am a duly Licensed under the laws of the State of Revisions Description Date Num Scale: North 501 South Eighth Street Minneapolis, MN 55404 krausanderson.com | 612 332 7281 MOUNDS VIEW HIGH SCHOOL 2019 IMPROVEMENTS 1900 Lake Valentine Road ARDEN HILLS, MINNESOTA 55112 4570 VICTORIA STREET N SHOREVIEW, MINNESOTA 55126 ISD #621: MOUNDS VIEW PUBLIC SCHOOLS LANDSCAPE ARCHITECT MINNESOTA L1.11 1" = 50' LJD LJD 02/06/2019 172270 53753 02/06/2019 LAURA J. DETZLER NORTHPLANLANDSCAPING NOTES:LEGEND REFERENCE KEY TO SITE DETAILS DETAIL I.D NUMBER (TOP) DETAIL SHEET NUMBER (BOTTOM) APPROXIMATE SOD LIMITS PROPOSED SEED MIX #1 PROPOSED SEED MIX #2 PROPOSED NATIVE SEEDING PROPOSED SHRUB / MULCH BED PROPERTY LINE 1. REFER TO SHEET C1.34, GRADING AND DRAINAGE PLAN FIELD, FOR GENERAL NOTES. 2. REFER TO SWPPP NARRATIVE FOR CONSTRUCTION SEQUENCING AND EROSION CONTROL REQUIREMENTS. 3. LANDSCAPE ARCHITECT MUST INSPECT AND APPROVE FINISH GRADING BEFORE CONTRACTOR PROCEEDS WITH SODDING. 4. ALL DISTURBED AREAS OUTSIDE THE BUILDING PAD WHICH ARE NOT DESIGNATED TO BE PAVED OR RECEIVE AGLIME SHALL RECEIVE AT LEAST 6" OF TOPSOIL AND SHALL BE SODDED. 5. WHERE NEW SOD MEETS EXISTING TURF, EXISTING TURF EDGE SHALL BE CUT TO ALLOW FOR A CONSISTENT, UNIFORM STRAIGHT EDGE. JAGGED OR UNEVEN EDGES WILL NOT BE ACCEPTABLE. REMOVE TOPSOIL AT JOINT BETWEEN EXISTING AND NEW AS REQUIRED TO ALLOW NEW SOD SURFACE TO BE FLUSH WITH EXISTING. 6. FAILURE OF TURF DEVELOPMENT: IN THE EVENT THE CONTRACTOR FAILS TO PROVIDE AN ACCEPTABLE TURF, THE CONTRACTOR SHALL RE-SOD ALL APPLICABLE AREAS, AT NO ADDITIONAL COST TO THE OWNER, TO THE SATISFACTION OF THE ENGINEER. 7. BEGIN TURF ESTABLISHMENT IMMEDIATELY AFTER SODDING, REFER TO SPECIFICATION FOR PROCEDURE. 8. ALL TREES TO BE BALLED AND BURLAPPED. 9. ALL TREES AND SHRUBS SHALL RECEIVE 4" DEPTH OF CLEAN SHREDDED HARDWOOD MULCH, UNLESS OTHERWISE SPECIFIED. 10. ALL PLANT MATERIALS SHALL BE NO. 1 QUALITY, NURSERY GROWN AND SPECIMENS MUST BE MATCHED. ALL OVERSTORY TREES ADJACENT TO DRIVE AND IN PARKING LOT SHALL BEGIN BRANCHING NO LOWER THAN 6'. 1 C2.11 TREES COMMON NAME / BOTANICAL NAME CONT CAL SIZE QTY AN Northwood Maple / Acer rubrum `Northwood`B&B 3"12 AM Green Mountain Sugar Maple / Acer saccharum `Green Mountain` TM B&B 3"9 AS Sienna Glen Maple / Acer x freemanii `Sienna`B&B 3"21 CS Northern Catalpa / Catalpa speciosa B&B 3"8 CO Common Hackberry / Celtis occidentalis B&B 3"4 CV Thornless Cockspur Hawthorn / Crataegus crus-galli inermis TM B&B 3"4 QA White Oak / Quercus alba B&B 3"11 QB Swamp White Oak / Quercus bicolor B&B 3"17 QE Northern Pin Oak / Quercus ellipsoidalis B&B 3"11 QC Heritage Oak / Quercus macdanielli `Clemons` TM B&B 3"10 QM Burr Oak / Quercus macrocarpa B&B 3"12 TR Redmond American Linden / Tilia americana `Redmond`B&B 3"12 CONIFEROUS TREES COMMON NAME / BOTANICAL NAME CONT CAL SIZE QTY AF Fraser Fir / Abies fraseri B&B 8` H 5 LL Tamarack / Larix laricina B&B 8` H 9 PB Black Hills Spruce / Picea glauca densata B&B 8` H 12 PR Norway Pine / Pinus resinosa B&B 8` H 10 TW White Cedar / Thuja occidentalis `White Cedar`B&B 8` H 8 ORNAMENTAL TREES COMMON NAME / BOTANICAL NAME CONT CAL SIZE QTY MP Perfect Purple Crab Apple / Malus `Perfect Purple`B&B 2"8 SR Japanese Tree Lilac Clump / Syringa reticulata B&B 2"6 SHRUBS COMMON NAME / BOTANICAL NAME CONT QTY AM3 Glossy Black Chokeberry / Aronia melanocarpa elata #5 19 CR Red Twig Dogwood / Cornus sericea #5 13 IW Winterberry / Ilex verticillata #5 12 JB Blue Prince Juniper / Juniperus horizontalis `Blue Prince`#5 10 PL Lemon Candy Dwarf Ninebark / Physocarpus opulifolius `Lemon Candy` #5 3 VA American Cranberrybush / Viburnum trilobum #5 5 PERENNIALS / ORNAMENTAL GRASSES COMMON NAME / BOTANICAL NAME CONT QTY AI Swamp Milkweed / Asclepias incarnata #1 14 AT Butterfly Milkweed / Asclepias tuberosa #1 21 EJ Joe Pye Weed / Eupatorium maculatum #1 19 HD Big Daddy Hosta / Hosta x `Big Daddy`#1 7 HB Bridal Falls Hosta / Hosta x `Bridal Falls`#1 11 IV Blue Flag / Iris versicolor #1 23 LG Prairie Blazing Star / Liatris pycnostachya #1 20 LC Cardinal Flower / Lobelia cardinalis #1 11 LS Great Blue Lobelia / Lobelia siphilitica #1 10 MB Wild Bergamot / Monarda fistulosa #1 22 RS Sweet Black-eyed Susan / Rudbeckia subtomentosa #1 11 SL Little Bluestem Grass / Schizachyrium scoparium #1 24 PLANT SCHEDULE 8 C2.15 Addendum #2 02/22/2019 1 6 C2.15 5 C2.15 6 C2.15 7 C2.15 9 C2.15 EXISTING SIGNIFICANT TREES TO BE REMOVED: INVENTORIED TREES = 6,675 CALIPER INCHES CALIPER INCHES REMOVED = 2,842 PROPOSED TREE REPLACEMENT: DECIDUOUS TREES = 393 CALIPER INCHES CONIFEROUS TREES (8' HIGH = 2") = 88 CALIPER INCHES ORNAMENTAL TREES = 28 CALIPER INCHES TOTAL = 509 CALIPER INCHES PROVIDED (1,089 REQUIRED) TREE INVENTORY INFORMATION: DENSE VEGETATION INVENTORIED = 5.51 ACRES DENSE VEGETATION NOT INVENTORIED = 11.46 ACRES TREE REPLACEMENT STATISTICS: 9239 2 4 924 925925 925925925925 925 926926926926 926 926926 926927 927 92 77 927 927 91 7 91 8 919 920920 921921 922922 923 924 925 926 927 928 929929 930930931931932932 933933933 934 935 26.9 26.9 26.8 27.4 ME 26.9 26.9 27.427.427.427.427.4 27.427.4 27.3 ME 27.427.427.427.4 26.9 26.9 26.926.9 27.427.427.427.4 26.9 27.1 23.4 25.6 25.2 25.7 26.4 23.0 24.4 24.9 26.8 26.8 26.1 25.6 26.0 25.425.6 25.1 24.0 24.8 24.8 24.4 26.9 25.0 25.4 25.9 25.9 26.6 26.7 24.4 25.2 23.3 23.7 26.2 26.1 25.8 25.7 25.1 25.5 24.6 24.0 24.5 26.5 26.4 30.0 29.6 32.6 33.0 19.6 ME 28.3 ME 27.2 27.4 26.8 26.0 26.1 26.5 25.8 27.3 27.2 26.9 26.9 26.7 ME 25.0 26.2 26.6 24.7 25.2 25.5 16.3 ME 15.5 ME 15.5 ME 16.6 ME 23.5 ME 23.8 ME 24.2 ME 23.3 ME 19.7 ME 10.9 ME 13.1 ME 22.7 ME 23.3 ME 24.8 ME 25.4 ME 25.3 ME 24.5 ME 23.5 ME 23.2 ME 22.8 ME 23.3 ME 23.9 ME 24.7 ME 28.5 ME 27.1 ME 25.0 ME 25.0 ME 26.1 26.2 ME 26.9 ME 26.8 ME 25.9 ME 25.9 ME 25.6 25.8 26.9 25.3 25.8 26.6 25.9 25.3 26.0 26.3 25.6 26.0 25.7 24.9 27.2 ME 25.9 26.5 ME 25.7 ME 25.4 ME 24.7 ME 25.2 ME 30.6 ME 32.0 ME 30.4 ME 29.8 ME 29.6 ME 29.5 ME 29.4 ME 29.1 ME 26.6 27.1 27.2 27.1 26.4 25.9 26.3 26.1 25.4 23.8 23.4 20.0 21.7 23.8 31.5 28.8 32.6 32.1 26.0 27.1 24.6 30.6 25.7 27.2 ME 26.7 26.7 ME 26.5 ME 25.4 35.9 ME 32.6 ME 30.6 ME 26.6 ME 26.6 ME 26.6 ME 19.6 ME 19.6 ME 29.6 ME 29.5 ME 29.2 ME 29.0 ME 29.3 ME 29.5 ME 29.1 ME 28.9 ME 29.8 ME 28.8 ME 28.5 ME 29.7 ME 16.6 ME 16.2 ME 19.7 ME 19.7 ME 19.7 ME 19.3 19.1 18.8 18.4 29.5 ME 32.9 ME 33.0 ME 33.1 ME 33.2 ME 33.0 ME 33.2 ME 33.2 ME 33.2 ME 32.7 ME 33.2 ME PROPOSED FOOTBALL / LACROSSE FIELD (180' X 360') PROPOSED BUILDINGADDITION 'F' SOUTH PARKING (14 BUS STALLS) NATIVE SEED RSS WALLS NATIVE SEED RSS WALLS STAGING AREA - TILL AS REQUIRED TO REMOVE COMPACTION. RETURN TO EXISTING GRADES. 1 CO CV 3 QM 1 QA 1 QM 1 QE 3 3 QC AN 3 QA 2 QB 1 4 CS 2 QM 3 TR PB 4 1 QM CS 2 1 CO QE 2 CS 2 1 QE LANDSCAPE ARCHITECTURE SITE PLANNING CIVIL ENGINEERING ANDERSON - JOHNSON ASSOCIATES, INC. 7575 GOLDEN VALLEY ROAD SUITE 200 MINNEAPOLIS. MN 55427 FAX (763) 544-0531 PH (763) 544-7129 DateRegistration Number Check Drawn Date: Comm I hereby certify that this plan, specification or report was prepared by me or under my direct supervision and that I am a duly Licensed under the laws of the State of Revisions Description Date Num Scale: North 501 South Eighth Street Minneapolis, MN 55404 krausanderson.com | 612 332 7281 MOUNDS VIEW HIGH SCHOOL 2019 IMPROVEMENTS 1900 Lake Valentine Road ARDEN HILLS, MINNESOTA 55112 4570 VICTORIA STREET N SHOREVIEW, MINNESOTA 55126 ISD #621: MOUNDS VIEW PUBLIC SCHOOLS LANDSCAPE ARCHITECT MINNESOTA L1.12 1" = 50' LJD LJD 02/06/2019 172270 53753 02/06/2019 LAURA J. DETZLER SOUTHPLANLANDSCAPING NOTES:LEGEND 1. REFER TO SHEET C1.34, GRADING AND DRAINAGE PLAN FIELD, FOR GENERAL NOTES. 2.REFER TO SWPPP NARRATIVE FOR CONSTRUCTION SEQUENCING AND EROSION CONTROL REQUIREMENTS. 3. LANDSCAPE ARCHITECT MUST INSPECT AND APPROVE FINISH GRADING BEFORE CONTRACTOR PROCEEDS WITH SODDING. 4. ALL DISTURBED AREAS OUTSIDE THE BUILDING PAD WHICH ARE NOT DESIGNATED TO BE PAVED OR RECEIVE AGLIME SHALL RECEIVE AT LEAST 6" OF TOPSOIL AND SHALL BE SODDED. 5. WHERE NEW SOD MEETS EXISTING TURF, EXISTING TURF EDGE SHALL BE CUT TO ALLOW FOR A CONSISTENT, UNIFORM STRAIGHT EDGE. JAGGED OR UNEVEN EDGES WILL NOT BE ACCEPTABLE. REMOVE TOPSOIL AT JOINT BETWEEN EXISTING AND NEW AS REQUIRED TO ALLOW NEW SOD SURFACE TO BE FLUSH WITH EXISTING. 6. FAILURE OF TURF DEVELOPMENT: IN THE EVENT THE CONTRACTOR FAILS TO PROVIDE AN ACCEPTABLE TURF, THE CONTRACTOR SHALL RE-SOD ALL APPLICABLE AREAS, AT NO ADDITIONAL COST TO THE OWNER, TO THE SATISFACTION OF THE ENGINEER. 7. BEGIN TURF ESTABLISHMENT IMMEDIATELY AFTER SODDING, REFER TO SPECIFICATION FOR PROCEDURE. 8. ALL TREES TO BE BALLED AND BURLAPPED. 9. ALL TREES AND SHRUBS SHALL RECEIVE 4" DEPTH OF CLEAN SHREDDED HARDWOOD MULCH, UNLESS OTHERWISE SPECIFIED. 10. ALL PLANT MATERIALS SHALL BE NO. 1 QUALITY, NURSERY GROWN AND SPECIMENS MUST BE MATCHED. ALL OVERSTORY TREES ADJACENT TO DRIVE AND IN PARKING LOT SHALL BEGIN BRANCHING NO LOWER THAN 6'. TREES COMMON NAME / BOTANICAL NAME CONT CAL SIZE QTY AN Northwood Maple / Acer rubrum `Northwood`B&B 3"12 AM Green Mountain Sugar Maple / Acer saccharum `Green Mountain` TM B&B 3"9 AS Sienna Glen Maple / Acer x freemanii `Sienna`B&B 3"21 CS Northern Catalpa / Catalpa speciosa B&B 3"8 CO Common Hackberry / Celtis occidentalis B&B 3"4 CV Thornless Cockspur Hawthorn / Crataegus crus-galli inermis TM B&B 3"4 QA White Oak / Quercus alba B&B 3"11 QB Swamp White Oak / Quercus bicolor B&B 3"17 QE Northern Pin Oak / Quercus ellipsoidalis B&B 3"11 QC Heritage Oak / Quercus macdanielli `Clemons` TM B&B 3"10 QM Burr Oak / Quercus macrocarpa B&B 3"12 TR Redmond American Linden / Tilia americana `Redmond`B&B 3"12 CONIFEROUS TREES COMMON NAME / BOTANICAL NAME CONT CAL SIZE QTY AF Fraser Fir / Abies fraseri B&B 8` H 5 LL Tamarack / Larix laricina B&B 8` H 9 PB Black Hills Spruce / Picea glauca densata B&B 8` H 12 PR Norway Pine / Pinus resinosa B&B 8` H 10 TW White Cedar / Thuja occidentalis `White Cedar`B&B 8` H 8 ORNAMENTAL TREES COMMON NAME / BOTANICAL NAME CONT CAL SIZE QTY MP Perfect Purple Crab Apple / Malus `Perfect Purple`B&B 2"8 SR Japanese Tree Lilac Clump / Syringa reticulata B&B 2"6 SHRUBS COMMON NAME / BOTANICAL NAME CONT QTY AM3 Glossy Black Chokeberry / Aronia melanocarpa elata #5 19 CR Red Twig Dogwood / Cornus sericea #5 13 IW Winterberry / Ilex verticillata #5 12 JB Blue Prince Juniper / Juniperus horizontalis `Blue Prince`#5 10 PL Lemon Candy Dwarf Ninebark / Physocarpus opulifolius `Lemon Candy` #5 3 VA American Cranberrybush / Viburnum trilobum #5 5 PERENNIALS / ORNAMENTAL GRASSES COMMON NAME / BOTANICAL NAME CONT QTY AI Swamp Milkweed / Asclepias incarnata #1 14 AT Butterfly Milkweed / Asclepias tuberosa #1 21 EJ Joe Pye Weed / Eupatorium maculatum #1 19 HD Big Daddy Hosta / Hosta x `Big Daddy`#1 7 HB Bridal Falls Hosta / Hosta x `Bridal Falls`#1 11 IV Blue Flag / Iris versicolor #1 23 LG Prairie Blazing Star / Liatris pycnostachya #1 20 LC Cardinal Flower / Lobelia cardinalis #1 11 LS Great Blue Lobelia / Lobelia siphilitica #1 10 MB Wild Bergamot / Monarda fistulosa #1 22 RS Sweet Black-eyed Susan / Rudbeckia subtomentosa #1 11 SL Little Bluestem Grass / Schizachyrium scoparium #1 24 PLANT SCHEDULE REFERENCE KEY TO SITE DETAILS DETAIL I.D NUMBER (TOP) DETAIL SHEET NUMBER (BOTTOM) APPROXIMATE SOD LIMITS PROPOSED SEED MIX #1 PROPOSED SEED MIX #2 PROPOSED NATIVE SEEDING PROPOSED SHRUB / MULCH BED PROPERTY LINE 1 C2.11 8 C2.15 Addendum #2 02/22/2019 1 6 C2.15 5 C2.15 6 C2.15 7 C2.15 9 C2.15 ENGINEERED FILL12"6"UNSUITABLE SOIL TOPSOIL 1'-0" (TYP) 5'-0" 1 1 VARIESNOTE: BOTTOM OF EXCAVATION MUST BE APPROVED BY THE SOILS ENGINEER PRIOR TO PLACEMENT OF ANY FILL. 4" SLAB FINISH FLOOR FINISH SUBGRADEFINISH GRADE (TURF) MINIMUM EXCAVATION LIMITS FOOTING SUITABLE SOIL ENGINEERED FILL 8" STABILIZED AGGREGATE BASE (NO RECYCLED ASPHALT) 6 C2.11 GRADING - BELOW GRADE BUILDING WALLS BUILDING PAD (ENGINEERED FILL) 1 1 FINISH GRADE (TURF AREAS)FINISH FLOOR ELEVATION BACKFILL AT BELOW GRADE WALLS FOOTING (REFER TO STRUCTURAL PLANS) FINISH FLOOR ELEVATION REFER TO ARCHITECTURAL PLANS FOR VERIFICATION IN LOWER LEVEL FINISH FLOOR ELEVATIONS AND LOCATIONS OF VARIATIONS 2'-0" 30°0'0"6"MINIMUM 6" TOPSOIL 6" TOPSOIL 18" LOW PERMEABILITY CLAY SOILS C2.11 7 6 C2.11 SAND SUBBASE/ DRAIN TILE AT DOORS & FROST FOOTED STOOPS 5'-0"20'-0"5'-0"6'-0"4"NOTE: REFER TO GRADING AND DRAINAGE PLAN FOR LIMITS OF SAND SUB-BASE FINISH GRADE AT EDGE OF STOOP FINISH GRADE OF PAVEMENT ADJACENT TO FOOTED STOOP STOOP FOOTING REFER TO STRUCTURAL DRAWINGS 6" DRAIN TILE (WHERE INDICATED ON DRAWINGS) - EXTEND TO STORM SEWER STRUCTURE WHERE INDICATED ON DRAWINGS SUBGRADE SOILS SAND SUBBASE 5 C2.11 6 C2.13 NOTE: ATTACH TRACER WIRE WITH BROWN STRIPE TO PIPE AT 3' O.C. WITH PLASTIC ZIP-TIES (OR APPROVED EQUAL). CLEANOUT ASSEMBLY MCDONALD 74M "A" SERIES CAST IRON METER PIT FRAME AND COVER FITTING HUB WITH 4" THREADED PLUG. APPLY TEFLON THREAD TAPE, OR APPROVED EQUAL, OVER THREADS. FINISH GRADE LEAVE 24" OF EXCESS WIRE AT SURFACE TRACER WIRE MAINREFER TO PLAN15" 11 12"4"24" DIA. x 8" THICK CONCRETE SLABPOURED AROUND CASTING (FLUSH WITH PAVEMENT/TURF GRADE) 12 C2.11 BACKWATER VALVE FLOW BACKWATER VALVE SOLVENT WELD BACKWATER VALVE TO DRAINTILE PROVIDE FLEXIBLE JOINT - REFER TO SPECS 6" DRAINTILE CONNECT DRAINTILE TO STRUCTURE AT ELEVATION SHOWN ON THE DRAWING. GROUT SECURE TO STRUCTURE WALL MINIMIZE STUB THROUGH WALL. STUB ONLY AS REQUIRED TO ALLOW BACKWATER VALVE TO BE CONNECTED TO DRAINTILE PROVIDE FLEXIBLE JOINT AT CONNECTION - REFER TO SPECS REFER TO PLAN FOR STRUCTURE TYPE 10 C2.11 ROCK CONSTRUCTION ENTRANCE NOTE: PROVIDE WHERE CONSTRUCTION TRAFFIC ENTERS OR EXITS THE CONSTRUCTION SITE 6" MINIMUM THICKNESS 50' M I N I M U M AS RE Q UI R E D EXISTING PAVEMENT TO REMAIN PROPERTY/R.O.W. LINE 2" TO 3" WASHED ROCK GEOTEXTILE FABRIC C2.11 3 SANITARY SEWER MANHOLE 5" MIN.1'-4"4'-0"27" 4'-0"16" O.C.BASES SHALL BE 8" INTEGRAL CAST, REINFORCED STANDARD PRECAST WITH 2" LEAN GROUT7"VARIABLE16" MAX.CL FLOW FLOW SLOPE @ 2 IN./FT. (TYP) COVER SHALL BE STAMPED "SANITARY SEWER" METAL SEWER CASTING - REFER TO PLAN FOR TYPE MIN. 2 AND MAX. 5 ADJUSTING RINGS. GROUT BETWEEN RINGS, CASTING, AND ALONG OUTSIDE. PRECAST CONCRETE CONE SECTION STEPS ON DOWNSTREAM SIDE RUBBER GASKET - TYP AT ALL JOINTS SLOPE AT 2 IN./FT. (TYP) RUBBER BOOT - REFER TO MNDOT STANDARD PLATE NO. 4007C RUBBER BOOT - REFER TO MNDOT STANDARD PLATE NO. 4007C GROUT TO 1/2 PIPE INTEGRAL BASE SECTION C2.11 15 STORM SEWER MANHOLE BASES SHALL BE 8" STANDARD PRECAST WITH 2" LEAN GROUT, OR POURED 8" SLAB REINFORCED WITH 6" x 6" 10/10 MESH16" O.C.VARIABLE 27"4'-0"VARIABLE5" MIN. COVER SHALL BE STAMPED "STORM SEWER" METAL SEWER CASTING - REFER TO PLAN FOR TYPE MIN. 2 AND MAX. 5 ADJUSTING RINGS. GROUT BETWEEN RINGS, CASTING, AND ALONG OUTSIDE. PRECAST CONCRETE CONE SECTION STEPS ON DOWNSTREAM SIDE RUBBER GASKET, TYP ALL JOINTS GROUT SHELF AND CHANNELS PROVIDE FLEXIBLE JOINT AT CONNECTION - REFER TO SPECS C2.11 19 CATCH BASIN VARIES FLOW FLOW 61 "RIM ELEVATION" PRECAST COVER - 8" THICK STEPS - INSTALL ON DOWNSTREAM SIDE @ 16" O.C. RUBBER GASKET - TYP AT ALL JOINTS PRECAST CONCRETE SECTION GROUT SHELF AND CHANNELSBASES SHALL BE 8" STANDARD PRECAST WITH 2" LEAN GROUT, OR POURED 8" SLAB REINFORCED WITH 6" x 6" 10/10 MESH PROVIDE FLEXIBLE JOINT AT CONNECTION - REFER TO SPECS STORM SEWER PIPE- REFER TO PLAN FOR LOCATION, INVERT, AND SIZES MIN. 2 AND MAX. 5 ADJUSTING RINGS. GROUT BETWEEN RINGS, CASTING, AND ALONG OUTSIDE. METAL SEWER CASTING - REFER TO PLAN FOR TYPE C2.11 20 TEMPORARY DIVERSION BERM PLAN VIEW SECTION A-A A A DISTURBED EARTH 2' MIN.24" MIN.2' MIN.UNDISTURBED EARTH DISTURBED EARTH 2:1 SLOPE OR FLATTER 2:1 SLOPE OR FLATTER SILT FENCE SILT FENCE 21 WHERE POSSIBLE, 10' UNDISTURBED EARTH UPHILL OF SILT FENCE 1 C2.11 C2.11 4 SEDIMENT CONTROL LOG FLOW 24" MIN.2' O.C.MAX.FL O W FL O W STAKE DETAIL INSTALLATION DETAIL SEDIMENT CONTROL LOG STAKE TO BE PLACED AT TOE OF SLOPE, BOTH SIDES WOOD STAKE BOTTOM OF SWALE WOOD STAKE TO PENETRATE NETTING MATERIAL ONLY SEDIMENT CONTROL LOG C2.11 2 SILT FENCE NORMAL USE POSTS: (IF USED WITHOUT SUPPORT FENCE) WOOD 2" SQ. (MIN) @ 4' (MAX) SPACING METAL 0.95 lbs/lf (MIN.) @ 6' (MAX) SPACING DIRECTION OF RUNOFF FLOW NOTE: DEPENDING UPON CONFIGURATION, ATTACH TO WIRE MESH WITH HOG RINGS, STEEL POSTS WITH TIE WIRES, OR WOOD POSTS WITH STAPLES 5' MIN. LENGTH POST (METAL) 4' MIN. LENGTH POST (WOOD) SILT FENCE FABRIC OVERLAP FABRIC 6" AND FASTEN @ 2' INTERVALS EXTEND WIRE MESH INTO TRENCH FABRIC ANCHORAGE TRENCH BACKFILL WITH TAMPED NATURAL SOIL 6" MIN. 6" MIN.NATURAL SOIL 24" MIN. BURY DEPTH (METAL) 18" MIN BURY DEPTH (WOOD) 30" MIN. METAL STAKE OR WOOD POST OPTIONAL SUPPORT FENCE (WIRE MESH) 1 C2.11 STRUCTURE WITH HOODED OUTLET COVER VARIES REFER TO PLANS FLOW FLOW SUMP VARIES REFER TO PLANS PROVIDE FLEXIBLE JOINT (TYP.) - REFER TO SPECS PRECAST CONCRETE SECTION SIMILAR TO RUBBER GASKET - TYP AT ALL JOINTS PROVIDE ANTI-SIPHON DEVICE PRECAST COVER - 8" THICK "RIM ELEVATION"METAL SEWER CASTING - REFER TO PLANS FOR TYPE MIN. 2 AND MAX. 5 ADJUSTING RINGS. GROUT BETWEEN RINGS, CASTING, AND ALONG OUTSIDE. HOODED OUTLET COVER INLET PIPES - ADJUST OPENING IN STRUCTURE AS REQUIRED TO ALLOW ADEQUATE SPACE FOR HOODED OUTLET COVER. REFER TO PLANS FOR PIPE SIZES AND ALIGNMENT BASES SHALL BE 8" STANDARD PRECAST WITH 2" LEAN GROUT, OR POURED 8" SLAB REINFORCED WITH 6" x 6" 10/10 MESH C2.11 20 C2.11 21 TYPICAL SECTION THRU FILTRATION AREA 3" DEPTH MIN. SHREDDED WOOD MULCH (MnDOT TYPE 6) PLANTS WITH MULCH FILTRATION AREA LIMITS AS SHOWN ON PLAN GRASS ROOT BALL OR POT FILTRATION SYSTEM SOIL MIXTURE - SEE BELOW SEE NOTE 7 OF 19 / C1.71 FOR ENGINEERED SOIL MIXTURE 6" DEPTH TOPSOIL PLACE SEDIMENT LOG AT EDGE OF FILTRATION AREA - FULL PERIMETER , AND REMOVE ONCE ALL UPSLOPE AREAS ARE FULLY STABILIZED (PERMANENT STABILIZATION) LANDSCAPING EDGING (TYPICAL) FLAT BOTTOM 1 1 EXCAVATE TO SUBGRADE ELEVATION WITH A TOOTHED BUCKET BACKHOE. RIP SOILS 6" TO 9" TO REMOVE COMPACTION UTILITY TRACER WIRE (TYPICAL) 6" DRAIN TILE WITH 3" MIN. PEA ROCK SURROUNDING, WRAPPED IN GEOTEXTILE FABRIC - REFER TO PLAN FOR LOCATION AND INVERT6" MIN.30" MIN.13 C2.11 FILTRATION AREA CONSTRUCTION NOTES FILTRATION AREA CONSTRUCTION SHALL COMPLY WITH THE FOLLOWING: 1.FILTRATION AREA LIMITS SHALL BE SURVEYED AND A VISUAL BARRIER, SUCH AS ORANGE SNOW FENCE, SHALL BE PLACED AROUND THE FULL PERIMETER TO KEEP ALL CONSTRUCTION TRAFFIC, EQUIPMENT AND MATERIAL STOCKPILES OUT OF THE PROPOSED FILTRATION AREA. THE VISUAL BARRIER MUST BE INSTALLED BEFORE NEW CONSTRUCTION BEGINS AND SHALL BE MAINTAINED THROUGH THE DURATION OF THE PROJECT. 2. DELIVER SAMPLE MATERIALS ONSITE FOR PRIOR APPROVAL. PRIOR TO BEGINNING THE INSTALLATION, SUFFICIENT MATERIAL QUANTITIES SHALL BE ONSITE TO COMPLETE THE INSTALLATION AND STABILIZE EXPOSED SOIL AREAS WITHOUT DELAY. 3. CARE MUST BE TAKEN TO AVOID CONTAMINATION OF ENGINEERED SOILS WITH SEDIMENT, IN-SITU OR TOPSOIL DURING AND AFTER INSTALLATION. MATERIALS MUST BE SEGREGATED. 4. INSTALLATION WITH DRY SOIL CONDITIONS IS CRITICAL TO PREVENT SMEARING AND COMPACTION. SCHEDULE WORK FOR PERIODS OF DRY WEATHER. DO NOT WORK IF SOIL CONDITIONS ARE WET. EXCAVATION, SOIL PLACEMENT AND RAPID STABILIZATION OF PERIMETER SLOPES WITH TURF SOD MUST COMPLETED BEFORE THE NEXT PRECIPITATION EVENT. TURF SOD PLACED IN FLOW PATHS SHALL BE SECURED WITH AT LEAST 6 STAKES PER SQUARE YARD. PLACE STAKES ALONG UPHILL SEAM EDGES TO PREVENT UNDERMINING FLOWS UNTIL SOD ROOTS ESTABLISH. 5. DO NOT LEAVE STORMWATER AREAS AND / OR PERIMETER SLOPES EXPOSED OVERNIGHT. SECURE THE SITE FROM RISK OF PRECIPITATION DAMAGES AT THE END OF EVERY WORK DAY. IN THE EVENT OF RAIN, TAKE ACTION TO DIVERT STORMWATER AWAY FROM THE WORK AREA AND TEMPORARILY COVER OF ALL EXPOSED SOILS WITH FILTER FABRIC OR IMPERMEABLE SHEETING. 6. FIELD OBSERVATION OF EXCAVATION AND SOIL PLACEMENT IS REQUIRED. NOTIFY GEOTECHNICAL ENGINEER PRIOR TO DIGGING. USE BACKHOE WITH TOOTH BUCKET FOR CELL EXCAVATION TO AVOID COMPACTING OR SMEARING OF SOILS. (DO NOT USE SKID STEER FOR EXCAVATION WITHIN THE CELL) USE TOOTH BUCKET TO SCARIFY (RIP) UNDERLYING SOILS 6" TO 9" DEEP TO REMOVE COMPACTION. GENTLY MIX THE FIRST LIFT OF ENGINEERED SOILS WITH THE LOOSENED UNDERLYING SOILS TO AVOID STRATIFICATION AND PROMOTE PERMEABILITY. USE EXCAVATOR BUCKET TO PLACE MATERIALS. CONSTRUCTION EQUIPMENT SHALL NOT BE ALLOWED INTO THE STORMWATER AREAS. LEVELING AND FINAL GRADING WITHIN THE CELL MUST BE COMPLETED BY HAND. 7. FILTRATION AREA SOIL MIX SHALL BE MINNESOTA STORMWATER MANUAL 4.1.2 MIX B: ENHANCED FILTRATION BLEND (WELL BLENDED MIXTURE OF 70% ASTM C-33 COARSE WASHED SAND (MN/DOT 3126) AND 30% MN/DOT 3890 GRADE 2 LEAF LITTER COMPOST. THE MATERIAL SUPPLIER SHALL PROVIDE DOCUMENTATION THAT THE COMPOST HAS BEEN SAMPLED AND TESTED AS REQUIRED BY THE SEAL OF TESTING ASSURANCE (STA) PROGRAM OF THE UNITED STATES COMPOSTING COUNCIL (USCC) AND A GRADATION SIEVE ANALYSIS FOR THE WASHED SAND. THE ENGINEERED SOIL SHALL NOT CONTAIN ANY TOPSOIL OR FILTER AGGREGATE WITH FINES. 8. INSTALL PLANTINGS BY HAND. 9. INSTALLED SOD AND PLANTINGS REQUIRE A TOTAL OF 1" OF WATER PER WEEK AND ACTIVE WEED MANAGEMENT UNTIL WELL ESTABLISHED. WATERING COSTS ARE CONSIDERED INCIDENTAL TO SOD AND PLANTING INSTALLATION. CONSTRUCT A TEMPORARY IRRIGATION SYSTEM, CONSISTING OF ABOVE GROUND HEADS, PIPING, VALVES, ETC., FOR WATERING UNTIL VEGETATION IS ESTABLISHED. DO NOT USE A WATER TRUCK AS THE FORCE OF THE WATER WILL ADVERSELY AFFECT THE STORMWATER AREA SOILS. 10. REMOVAL OF ACCUMULATED SEDIMENT AND DEBRIS SHALL BE DONE BY HAND OR, IF SELF-PROPELLED EQUIPMENT IS REQUIRED, FROM OUTSIDE THE PERIMETER OF THE FILTRATION AREAS. C2.11 14 GATE VALVE BOX 8" AS REQUIRED ADJUST TOP TO 1/2" BELOW FINISHED PAVEMENT GRADE OR 1" BELOW FINISHED TURF GRADE. SET SO AS TO PROVIDE 12" OF UPWARD ADJUSTMENT. COVER SHALL BE STAMPED WITH "WATER" FINISH GRADE VALVE BOX GATE VALVE REFER TO DRAWINGS FOR SIZES WATERMAIN CONCRETE THRUST BLOCK 16 C2.11 FIRE HYDRANT8'-0" MINIMUM3'-0"8'-0" MIN. COVERHYDRANT MARKER HYDRANT, HEIGHT VARIES FINISH GRADE TRAFFIC FLANGE 2" ABOVE GRADE REFER TO DETAIL 4" x 4" VERTICAL BLOCK 4" x 4" THRUST BLOCK 1 CU. YD. GRAVEL 3/4"+ COVER WITH POLYETHLENE TEE 6" D.I.P. LEAD MECH. JOINTS 6" GATE VALVE 8" CONCRETE THRUST BLOCKS 2-3/4" TIE RODS C2.11 16 C2.11 17 WATERMAIN OFFSET PROPOSED / EXISTING SEWER - REFER TO PLAN FOR SIZES AND LOCATIONS ONE LENGTH OF PROPOSED WATERMAIN PIPE CENTERED AT CROSSING TRANSITION TO SPECIFIED DEPTH (TYP). INSTALL VERTICAL BENDS AS REQUIRED18" MIN.WATERMAIN SHALL HAVE 8' MINIMUM COVER 45 ° BEND (TYP) RESTRAINT AT EVERY JOINT 17B C2.11 THRUST BLOCK BEND CROSS TEE45° BEND WYE NOTES: 1.CONCRETE THRUST BLOCKING TO BE POURED AGAINST UNDISTURBED EARTH. 2. KEEP CONCRETE CLEAR OF PIPE JOINTS, NUTS AND BOLTS. 3. IF NOT SHOWN ON PLANS, REQUIRED BEARING AT FITTING SHALL BE AS INDICATED ABOVE, ADJUSTED IF NECESSARY, TO CONFORM TO THE TEST PRESSURE(S) AND ALLOWABLE SOIL BEARING STRESS(ES). 4. BEARING AREAS AND SPECIAL BLOCKING DETAILS SHOWN ON PLANS TAKE PRECEDENCE OVER BEARING AREAS AND BLOCKING DETAILS SHOWN THIS STANDARD DETAIL. 5. ABOVE BEARING AREAS BASED ON TEST PRESSURE OF 150 P.S.I. AND AN ALLOWABLE SOIL BEARING STRESS OF 2000 POUNDS PER SQUARE FOOT. TO COMPUTE BEARING AREAS FOR DIFFERENT TEST PRESSURES AND SOIL BEARING STRESSES, USE THE FOLLOWING EQUATION: BEARING AREA = (TEST PRESSURE/150) X (200/SOIL BEARING STRESS) X (TABLE VALUE). PLUGGED CROSS PLUGGED CROSS PLUGGED TEE PLUG OR CAP NOMINAL FITTING SIZE (INCHES) TEE, WYE, PLUG, OR CAP 90° BEND, PLUGGED CROSS TEE PLUGGED ON RUN A1 A2 45° BEND 22.5° BEND 11.25° BEND 4 1.0 1.4 1.9 1.4 1.0 - - 6 2.1 3.0 4.3 3.0 1.6 1.0 - 10 5.9 8.4 11.8 8.4 4.6 2.6 1.2 12 8.5 12.0 17.0 12.0 6.6 3.4 1.7 14 11.5 16.3 23.0 16.3 8.9 4.6 2.3 16 15.0 21.3 30.0 21.3 11.6 6.0 3.0 18 19.0 27.0 38.0 27.0 14.6 7.6 3.6 20 23.5 33.3 47.0 33.3 18.1 9.4 4.7 24 34.0 48.0 68.0 48.0 26.2 13.6 6.8 8 3.8 5.3 7.6 5.4 2.9 1.5 1.0 1/4" PLYWOOD OVER FACE OF BOLTS A1 A2 UNDISTURBED SIDE OF TRENCH (TYP.) BEDDING MATERIAL (TYP.) 18 C2.11 RCP FLARED END SECTION (FES) PIPE SIZE 21" & LESS 24" TO 36" 42" TO 54" 60" & GREATER "U" BOLT DIA. 1/2" 5/8" 3/4" 1" WIDTH 24" 24" 24" 24" "U" BOLT REQUIREMENTS NOTES: 2 - "U" BOLT FASTENERS TO BE INSTALLED ACROSS EACH JOINT, ONE EACH SIDE OF PIPE AT 60° FROM THE TOP OF THE PIPE. FASTEN FIRST THREE JOINTS AS SHOWN. CONCRETE PIPE TIES ("U" BOLTS) TRASH GUARD WITH 5/8" DIA. RODS AT 6" ON CENTER. FASTEN TO FES WITH 3 HOT DIPPED GALV. CLIPS RIPRAP - REFER TO DETAIL C2.11 23 C2.11 22 RIPRAP - FLARED END SECTIOND51 5D2'-0"D5D12"PLAN SECTION A - A SECTION B - B12"18"B B AA CLASS III RIPRAP GEOTEXTILE FABRIC PLAN FINISH GRADE CLASS III RIPRAP GEOTEXTILE FABRIC PLAN FINISH GRADE FABRIC SHALL COVER THE AREA OF THE RIPRAP AND EXTEND UNDER THE CULVERT APRON 3' C2.11 23 8 C2.11 CLASS B PIPE BEDDING CITY STANDARD PLATE 4005 9 C2.11 CLASS C PIPE BEDDING CITY STANDARD PLATE 4005 LANDSCAPE ARCHITECTURE SITE PLANNING CIVIL ENGINEERING ANDERSON - JOHNSON ASSOCIATES, INC. 7575 GOLDEN VALLEY ROAD SUITE 200 MINNEAPOLIS. MN 55427 FAX (763) 544-0531 PH (763) 544-7129 DateRegistration Number Check Drawn Date: Comm I hereby certify that this plan, specification or report was prepared by me or under my direct supervision and that I am a duly Licensed under the laws of the State of Revisions Description Date Num Scale: North 501 South Eighth Street Minneapolis, MN 55404 krausanderson.com | 612 332 7281 MOUNDS VIEW HIGH SCHOOL 2019 IMPROVEMENTS 1900 Lake Valentine Road ARDEN HILLS, MINNESOTA 55112 4570 VICTORIA STREET N SHOREVIEW, MINNESOTA 55126 ISD #621: MOUNDS VIEW PUBLIC SCHOOLS PROFESSIONAL ENGINEER MINNESOTA C2.11 NOT TO SCALE DAR MET 02/06/2019 172270 40180 02/06/2019 DAVID A. REY DETAILSSITE Addendum #2 02/22/2019 1 FINGER DRAIN 3"3"3"CURB AND GUTTER BITUMINOUS PAVEMENT SECTION REFER TO DETAIL 6" 3" MINIMUM UNDER TILE WRAP TRENCH AND PEAROCK WITH GEOTEXTILE FABRIC PEA ROCK AROUND TILE 6" DRAIN TILE - LENGTH OF INDIVIDUAL FINGER DRAIN SHALL BE 30' MINIMUM UNLESS NOTED OTHERWISE. 11 C2.11 1 C2.13 10 C2.13 11 C2.13 2 C2.13 12 C2.13 RETAINING WALL AND FENCEVARIESGEOSYNTHETIC REINFORCEMENT WALL BASE 5'-0" MINIMUM EXCAVATION4'-0"18" MAX. CHAIN LINK FENCE DRAINTILE - CONNECT TO STORM SEWER (REFER TO UTILITY PLAN) 6" MINIMUM COMPACTED AGGREGATE BASE FREE DRAINING AGGREGATE SLOPE VARIES CAP BLOCK - MAX. ELEVATION CHANGE AT TOP OF WALL IS 4" - DOUBLE STACK CAP BLOCKS AS NECESSARY BLOCK UNITS FENCE POST FOUNDATION SYSTEM REFER TO SPECS - COORDINATE LOCATION WITH FENCING CONTRACTOR 24 C2.11 C2.13 18 1 C2.12 REINFORCED SOIL SLOPE Mn/DOT STANDARD PLAN 5-297.646 2 C2.12 REINFORCED SOIL SLOPE DETAILS Mn/DOT STANDARD PLAN 5-297.649 3 C2.12 REINFORCED SOIL SLOPE SECTIONS Mn/DOT STANDARD PLAN 5-297.648 4 C2.12 STORMWATER TRENCH AND PRETREATMENT STRUCTURE STRUCTURE LANDSCAPE ARCHITECTURE SITE PLANNING CIVIL ENGINEERING ANDERSON - JOHNSON ASSOCIATES, INC. 7575 GOLDEN VALLEY ROAD SUITE 200 MINNEAPOLIS. MN 55427 FAX (763) 544-0531 PH (763) 544-7129 DateRegistration Number Check Drawn Date: Comm I hereby certify that this plan, specification or report was prepared by me or under my direct supervision and that I am a duly Licensed under the laws of the State of Revisions Description Date Num Scale: North 501 South Eighth Street Minneapolis, MN 55404 krausanderson.com | 612 332 7281 MOUNDS VIEW HIGH SCHOOL 2019 IMPROVEMENTS 1900 Lake Valentine Road ARDEN HILLS, MINNESOTA 55112 4570 VICTORIA STREET N SHOREVIEW, MINNESOTA 55126 ISD #621: MOUNDS VIEW PUBLIC SCHOOLS PROFESSIONAL ENGINEER MINNESOTA C2.12 NOT TO SCALE DAR MET 02/06/2019 172270 40180 02/06/2019 DAVID A. REY DETAILSSITE CURB TRANSITION SURMOUNTABLE TO B-61210' TRAN SI TI O N PROVIDE EXPANSION JOINT AT ENDS OF TRANSITION (TYP.) 4 C2.13 1 C2.13 2 C2.13 CONCRETE WALK 1"NOTES: 1) PROVIDE WIRE MESH REINFORCEMENT IN PANELS WITH DIMENSIONS TO JOINTS GREATER THAN 6' - REINFORCEMENT SHALL BE UNIFORMLY SUSPENDED 2" BELOW CONCRETE FINISH GRADE. 2) PROVIDE EXPANSION JOINT AND CAULK SEALANT AT ALL WALK, BUILDING, AND STOOP JOINTS. REFER TO SPECS. WALK WIDTH AS LABELED ON PLAN BITUMINOUS PAVEMENT CONCRETE CURB AND GUTTER WALK FLUSH WITH TOP OF CURB AND PROVIDE TOOLED EDGE (WITH EXPANSION JOINT) 5" CONCRETE WALK MIN. 4" SAND BASE OR STABILIZED AGGREGATE BASE THICKENED TO BOTTOM OF CURB WHERE APPLICABLE TYPICAL AT ALL GRASS AREAS PREPARED SUBGRADE PROVIDE 2% CROSS SLOPE (MAX.) REFER TO GRADING PLAN FOR DIRECTION 12"MIN. 4"DEPTH6 C2.13 C2.13 11 C2.13 10 C2.13 1 CONCRETE SLAB 36"12"8"CAULK AT SURFACE 6" STABILIZED AGGREGATE BASE TO BE PLACED BY PAVING CONTRACTOR STRUCTURE 8" CONCRETE SLAB 6" (MIN.) STABILIZED AGGREGATE BASE TO BE PLACED BY PAVING CONTRACTOR THICKENED SLAB AT ALL SIDES NOT ADJACENT TO BUILDING PREPARED SUBGRADE CONCRETE FLUSH WITH BITUMINOUS PAVEMENT EXPANSION JOINT 7 C2.13 11 C2.13 4 PLAN VIEW OF PERPENDICULAR RAMP DOME SPACINGDOME SECTION 3 2 2 1 NOTES: SECTION A-A ELEVATION OF RAMP PEDESTRIAN CURB RAMP 3'-8" 2 CONCRETE WALK 3'-8" A 4'-0"MIN.4' - 0 "MIN4'-0" MIN4'-0" UNLESS OTHERWISE NOTED ON PLAN 5'-8"5'-8"2'-0"4 36'-0"(6" CURB4'-0"(4" CURB)CONCRETE WALK A 6'-3" (6" CURB) 4'-2" (4" CURB) 4'-0" UNLESS OTHERWISE NOTED ON PLAN 6'-3" (6" CURB) 4'-2" (4" CURB) 1 6'-0" (6" CURB) 4'-0" (4" CURB)4'-0" 7/8" - 1-7/16" 1/5" 50%-60% OF BASE DIAMETER 5/8" MIN.2'-0"5/8" MIN. 15/16" (TYP.) 1 5/8" - 2 3/8" 1 5/8" - 2 3/8" 15/16" (TYP.) 6'-3" (6" CURB & 0.08 FT./FT. SLOPE) 4'-2" (4" CURB & 0.08 FT./FT. SLOPE) 4'-0"6'-3" (6" CURB & 0.08 FT./FT. SLOPE) 4'-2" (4" CURB & 0.08 FT./FT. SLOPE) 1/2 INCH PREFORMED JOINT FILLER MATERIAL, AASHTO M 213. PROVIDE A PATH OF TRAVEL 4' 0" WIDE BEHIND THE PEDESTRIAN RAMP. A RELATIVELY FLAT 4' X 4' LANDING WILL ALLOW WHEELCHAIRS TO NAVIGATE AROUND THE PEDESTRIAN RAMP. 6" TO 8" IS THE REQUIRED OFFSET OF THE DETECTABLE WARNINGS/ TRUNCATED DOME AREA FROM THE FRONT FACE OF CURB, OR PLACE THE DETECTABLE WARNINGS AT THE BACK OF CURB. ADA REQUIRED TRUNCATED DOME AREA SHALL BE 2' 0" MIN. IN DIRECTION OF TRAVEL AND SHALL EXTEND THE FULL WIDTH (4' 0" TYP.) OF THE CURB RAMP. THIS 2' 0" BY 4' 0" WIDTH (TYP.) TRUNCATED DOME AREA SHALL CONTRAST VISUALLY WITH THE ADJACENT WALKING SURFACE. THE ENTIRE TRUNCATED DOME AREA SHALL BE A LIGHT COLOR (LIGHT GRAY, WHITE, OR YELLOW) WHEN THE ADJACENT SIDEWALK IS A DARK COLOR. THE ENTIRE TRUNCATED DOME AREA SHALL BE A DARK COLOR (RED, BLACK, DARK GRAY, OR BRIGHT YELLOW) WHEN THE ADJACENT SIDEWALK IS A "WHITE" OR LIGHT GRAY CEMENT COLOR. DISTURBED MINIMUM OUTER LIMITS OF CONCRETE WALK BACK OF CURB FRONT FACE OF CURB ROUND ALL SLOPED INTERSECTIONS0.08 FT./FT. SLOPE OF FLARED SIDE CURB OR, CURB AND GUTTER 0.083 FT./FT. OR FLATTER 0.02 FT./FT. MAX DOME (TYP)6"9 C2.13 6 C2.13 D-412 CURB & GUTTER 12"6"6"R12"4"7"AGGREGATE BASE TO BE PLACED BY PAVING CONTRACTOR (4" MIN.) 12" NOTE: 1. DIRECTION OF TRANSVERSE GUTTER SLOPE TO MATCH DIRECTION OF ADJACENT PAVEMENT SLOPE. CONSTRUCT WITH CURBING MACHINE. 1 2 SLOPE 34" PER FOOT TOWARDS PAVEMENT ON HIGH SIDE OF LOT/DRIVE (TIP OUT) - SLOPE 34" PER FOOT TOWARDS BACK OF CURB FACE ON LOW SIDE OF LOT/DRIVE (TIP BACK) FACE OF CURB C2.13 2 B-612 CURB AND GUTTER NOTE: 1. DIRECTION OF TRANSVERSE GUTTER SLOPE TO MATCH DIRECTION OF ADJACENT PAVEMENT SLOPE. CONSTRUCT WITH CURBING MACHINE. 2. AT CURB INLET CATCH BASINS, ADJUST CASTING TO BE 1" BELOW GUTTER GRADE. SLOPE GUTTER 5' EACH SIDE OF CATCH BASIN. PROVIDE POSITIVE DRAINAGE TO CATCH BASINS. 12"6"7 1/2"13 1/2"6"12" 1 2 AGGREGATE BASE TO BE PLACED BY PAVING CONTRACTOR (4" MIN.)7"FACE OF CURB 12" RADIUS 3" RADIUS SLOPE 34" PER FOOT TOWARDS PAVEMENT ON HIGH SIDE OF LOT/DRIVE (TIP OUT) - SLOPE 34" PER FOOT TOWARDS BACK OF CURB FACE ON LOW SIDE OF LOT/DRIVE (TIP BACK) 12" RADIUS 1:3 BATTER C2.13 1 ACCESSIBLE PARKING SIGN AND POST WITH BOLLARD NOTE: SIGN SHALL BE PLACED NOT MORE THAN 96" FROM FACE OR EDGE OF PAVEMENT AT THE ACCESSIBLE STALL.2"3'-6"3'-0"12"18"SIGN: WHITE LEGEND AND BORDER ON BLUE BACKGROUND FULLY REFLECTORIZED CL 1'-6"1'-0"POST TOP METAL SIGN ACCORDING TO MN STATE STATUTE 169.346 "VAN-ACCESSIBLE" LABELING (MNMUTCD R7-8b) PROVIDE AT ONE STALL 3 1/2" FLANGED CHANNEL SIGN POST PER Mn/DOT 3401 5" O.D. STEEL PIPE BOLLARD WITH TWO COATS SIGN ENAMEL (COLOR TO BE APPROVED BY OWNER). FILL ANNULAR SPACE WITH GROUT. 10° SLOPE CONCRETE (MN/DOT 3A32 OR EQUAL)60" - 66"C2.13 13 MEDIUM DUTY BITUMINOUS PAVEMENT11.5"1.5" BITUMINOUS WEAR COURSE TACK COAT 2" BITUMINOUS BINDER COURSE 8" AGGREGATE BASE COURSE 12" SUBGRADE PREPARATION C2.13 10 6" 6" 12" 12" 12'-0" TAPER B-612 CURB TERMINATOR SLOPE TOP OF CURB DOWN TO GUTTER 5 C2.13 1 C2.13 LAKE VALENTINE ROAD BITUMINOUS PAVEMENT13"1.5" 2331 TYPE 41A BITUMINOUS WEAR COURSE TACK COAT 2" 2331 TYPE 31B BITUMINOUS BASE COURSE 8" CLASS 5A AGGREGATE BASE 12" SUBGRADE PREPARATION 1.5" 2331 TYPE 41b BITUMINOUS BINDER COURSE 12" SAND SUBBASE TACK COAT 12 C2.13 B-618 CURB AND GUTTER NOTE: DIRECTION OF TRANSVERSE GUTTER SLOPE TO MATCH DIRECTION OF ADJACENT PAVEMENT SLOPE. 12"6"7 12"1'-1 12"6" 18" 1 2 AGGREGATE BASE TO BE PLACED BY PAVING CONTRACTOR (4" MIN.) FACE OF CURB 1:3 BATTER 3" RADIUS 12" RADIUS SLOPE 34" PER FOOT TOWARDS PAVEMENT ON HIGH SIDE OF LOT/DRIVE (TIP OUT) - SLOPE 34" PER FOOT TOWARDS BACK OF CURB FACE ON LOW SIDE OF LOT/DRIVE (TIP BACK) 12" RADIUS C2.13 3 TRAFFIC SIGN AND POST WITH BOLLARD2"7'-0" - VERIFYWITH LOCAL CODE3'-0"1'-6" POST TOP REFER TO PLAN FOR MESSAGE METAL SIGN 5" O.D. STEEL PIPE WITH TWO COATS SIGN ENAMEL (COLOR TO BE APPROVED BY OWNER). FILL ANNULAR SPACE WITH GROUT. 3 1/2" FLANGED CHANNEL SIGN POST PER Mn/DOT 3401 10° SLOPE CONCRETE (MN/DOT 3A32 OR EQUAL)3'-6"1'-0"C2.13 15 TRAFFIC SIGN AND POST WITH BREAKAWAY SIGN BASE2"7'-0" - VERIFYWITH LOCAL CODEPOST TOP REFER TO PLAN FOR MESSAGE METAL SIGN 2" x 2" 12 GAUGE SQUARE POST PER Mn/DOT 3402 BREAKAWAY SIGN BASE BOLTED TO CONCRETE SURFACE - REFER TO SPECIFICATIONS C2.13 16 TRAFFIC SIGN AND POST IN GRASS2"7'-0" - VERIFYWITH LOCAL CODE2'-6"POST TOP REFER TO PLAN FOR MESSAGE METAL SIGN 3 1/2" FLANGED CHANNEL SIGN POST PER Mn/DOT 3401 C2.13 17 CHAIN LINK FENCEREFER TO PLAN FOR HEIGHTNOTES: 1. END, CORNER, AND PULL POSTS SHALL BE 4". LINE POSTS SHALL BE 2 1/2". 2. ALL FENCING SHALL RECEIVE 2" x 2" #9 GAUGE FABRIC UNLESS NOTED OTHERWISE. 3. LINE POSTS MAY BE AIR DRIVEN. 4. POST SPACING SHALL NOT EXCEED 10' O.C. 5. BOTTOM RAIL SHALL BE PLACED NO MORE THAN 2" ABOVE FINISH GRADE.6"1 5/8" TOP RAIL CHAIN LINK FENCE 1 5/8" BOTTOM RAIL FINISH GRADE CONCRETE MAINTENANCE STRIP (UNLESS OTHERWISE NOTED) CONCRETE FOOTING 12" x 48" FOR END, CORNER, AND PULL POSTS 18 C2.13 20 C2.13 CONCRETE MAINTENANCE STRIP 1'-3"4"3"2"PLAN SECTION 1/2" RADIUS (TYPICAL) FINISH GRADE AT MAINTENANCE STRIP SHALL BE 1" ABOVE SOD AND FLUSH WITH CONCRETE WALK WHERE APPLICABLE. (2) #4 REBAR 1" DEPTH TOOLED CONSTRUCTION JOINT TOPSOIL 1" BELOW CONCRETE COMPACTED SUBGRADE TOOLED CONSTRUCTION JOINT SHALL BE CUT TO 1"DEPTH AND SHALL OCCUR AT EACH POST AND AT MIDPOINT BETWEEN POSTS POST (2) #4 REBAR 20 C2.13 6 C2.13 ACCESSIBLE PARKING SIGN POST WITH BREAKAWAY BASE2"60"-66" TO BOTTOM OF SIGN12"18"SIGN: WHITE LEGEND AND BORDER ON BLUE BACKGROUND FULLY REFLECTORIZED POST TOP METAL SIGN ACCORDING TO MN STATE STATUTE 169.346 2" X 2" 12 GAUGE SQUARE POST PER Mn/DOT 3402 PROVIDE "VAN-ACCESSIBLE" LABELING (MNMUTCD R7-8b) PROVIDE AT ONE STALL NOTE: SIGN SHALL BE PLACED NOT MORE THAN 96" FROM FACE OR EDGE OF PAVEMENT AT THE ACCESSIBLE STALL. BREAKAWAY SIGN BASE BOLTED TO CONCRETE SURFACE - REFER TO SPECIFICATIONS C2.13 14 DECORATIVE METAL FENCE 112" x 1 716" RIBBED CHANNEL RAIL PICKET #1WM46 3" TYPICAL512"7'-8"4'-0"FINISH GRADE4'-0"19 C2.13 C2.13 20 8 C2.13 DRIVEWAY APRON CITY STANDARD PLATE 2002 CONCRETE STAIRS AT RETAINING WALL EXPANSION JOINT HANDRAIL CENTERED ON 6" CURB STAIR NOSING REFER TO SPECS EXPANSION JOINT TURF ALL HANDRAIL PIPE SHALL BE 1-1/2" O.D. STD. PIPE WELD AND GRIND SMOOTH JOINTS STAIR NOSING (TYPICAL) REFER TO SPECS TREAD REINFORCEMENT #3 REBAR @ 16" O.C. SLOPE DOWN @ 1/4" PER TREAD COARSE BROOM FINISH #4 REBAR @ 3" FROM BOTTOM AND EDGE OF FOOTING #4 REBAR @ 16" O.C. PREPARED SUBGRADE 8" SAND BASE #4 CONTINUOUS REBAR (TYPICAL) EACH WAY CAST SLEEVE TO RECIEVE HANDRAIL #4 REBAR (TYPICAL) EXPANSION JOINT CONTINUOUS NOSING BAR 2'-0" 16"534"6" 2'-0" 1'-0" 34" STAIR SETBACK 2'-0" SECTION A-A 1'-4"1'-6"1'-0" TURF TURF 6" CURB FLUSHWITH TOP OF STEPS6" CURB FLUSHWITH TOP OF STEPSPLAN VIEW AA 21 C2.13 C2.13 6 C2.13 6 C2.11 24 C2.11 24 CONCRETE VALLEY GUTTER5 12"7"2'-0" 1'-0" CONCRETE VALLEY GUTTER MIN. 6" AGGREGATE BASE COURSE TO BE PLACED BY PAVING CONTRACTOR 22 C2.13 12 C2.13 LANDSCAPE ARCHITECTURE SITE PLANNING CIVIL ENGINEERING ANDERSON - JOHNSON ASSOCIATES, INC. 7575 GOLDEN VALLEY ROAD SUITE 200 MINNEAPOLIS. MN 55427 FAX (763) 544-0531 PH (763) 544-7129 DateRegistration Number Check Drawn Date: Comm I hereby certify that this plan, specification or report was prepared by me or under my direct supervision and that I am a duly Licensed under the laws of the State of Revisions Description Date Num Scale: North 501 South Eighth Street Minneapolis, MN 55404 krausanderson.com | 612 332 7281 MOUNDS VIEW HIGH SCHOOL 2019 IMPROVEMENTS 1900 Lake Valentine Road ARDEN HILLS, MINNESOTA 55112 4570 VICTORIA STREET N SHOREVIEW, MINNESOTA 55126 ISD #621: MOUNDS VIEW PUBLIC SCHOOLS PROFESSIONAL ENGINEER MINNESOTA C2.13 NOT TO SCALE DAR MET 02/06/2019 172270 40180 02/06/2019 DAVID A. REY DETAILSSITE Addendum #2 02/22/2019 1 HEAVY DUTY PAVEMENT14"2" 2" PAVEMENT EDGE AS SHOWN ON PLAN TYPICAL EDGE TREATMENT WITHOUT CURB AND GUTTER 1.5" BITUMINOUS WEAR COURSE TACK COAT 2.5" BITUMINOUS BINDER COURSE 10" AGGREGATE BASE COURSE 12" SUBGRADE PREPARATION C2.13 11 TYPICAL SECTION THROUGH MEDIAN EXPANSION JOINT 5'-0"12 C2.13 7 C2.13 2 C2.13 C2.13 23 LANDSCAPE ARCHITECTURE SITE PLANNING CIVIL ENGINEERING ANDERSON - JOHNSON ASSOCIATES, INC. 7575 GOLDEN VALLEY ROAD SUITE 200 MINNEAPOLIS. MN 55427 FAX (763) 544-0531 PH (763) 544-7129 DateRegistration Number Check Drawn Date: Comm I hereby certify that this plan, specification or report was prepared by me or under my direct supervision and that I am a duly Licensed under the laws of the State of Revisions Description Date Num Scale: North 501 South Eighth Street Minneapolis, MN 55404 krausanderson.com | 612 332 7281 MOUNDS VIEW HIGH SCHOOL 2019 IMPROVEMENTS 1900 Lake Valentine Road ARDEN HILLS, MINNESOTA 55112 4570 VICTORIA STREET N SHOREVIEW, MINNESOTA 55126 ISD #621: MOUNDS VIEW PUBLIC SCHOOLS PROFESSIONAL ENGINEER MINNESOTA C2.14 NOT TO SCALE DAR MET 02/06/2019 172270 40180 02/06/2019 DAVID A. REY DETAILSSITE Addendum #2 02/22/2019 1 1 C2.14 MnDOT PEDESTRIAN CURB RAMP 1 STANDARD PLAN 5-297.250 2 C2.14 MnDOT PEDESTRIAN CURB RAMP 2 STANDARD PLAN 5-297.250 3 C2.14 MnDOT PEDESTRIAN CURB RAMP 3 STANDARD PLAN 5-297.250 4 C2.14 MnDOT PEDESTRIAN CURB RAMP 4 STANDARD PLAN 5-297.250 9 1 1 911 911 9129 1 2 913 9 1 3 914 9 1 4 9149156 911 9 1 2 11.8 11.2 ME 11.7 ME12.3 ME 16.6 15.4 14.1 14.7 15.8 7 8 1.9 ME 13.2 12.2 ME 12.2 ME 12.3 ME 12.8 ME 12.8 ME 12.4 ME 12.4 12.4 12.4 12.4 12.4 12.4 12.6 ME 12.6 ME 13.3 ME 13.7 ME 13.8 ME 13.7 ME 13.3 ME 14.0 13.8 13.6 13.8 14.0 13.8 14.1 13.9 14.2 14.0 ME 14.8 14.1 13.9 ME 11.7 ME 12.7 ME 13.6 ME 13.6 12.7 5.4 15.4 15.1 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 11.0 12.2 12.3 12.1 12.2 12.3 12.2 12.8 12.7 12.7 12.6 12.4 12.3 11.6 11.2 11.1 09.0 ME 09.4 ME 09.8 ME 09.1 ME 11.9 EOF 16.9 BUS PARKING (29 BUS STALLS) LG5 5 AN 2 QB QB 1 IV 8 SL 5 AI 5 AM3 5 IW 7 LG 7 AT 9 LS 10 12 MB CR 6 EJ 11 LG 8 AM3 7 SL 6 LC 6 11 RS 5 VA 6 SL MB 10 AI 9 7 CR AM3 3 AM3 4 8 EJ IW 5 5 LC 7 SL 15 IV AT 12 AM 1 FIELD MARKING PINS INSTALL AT CORNERS OF ALL FIELDS AND AT OUTFIELD FOUL LINES OF SOFTBALL FIELDS PINS SHALL BE INSTALLED BY A REGISTERED LAND SURVEYOR6"1'-6"FINISH GRADE OF FIELD 3/4" DIAM. REBAR C2.15 4 1'-0" MIN 1'-0" MIN 2.5 X BALL DIA. MIN. DECIDUOUS TREE SET TREE WITH ROOT COLLAR AT FINISH GRADE - ADJUST TREE AS REQUIRED SO THAT ROOT COLLAR STANDS LEVEL TO OR SLIGHTLY ABOVE FINISHED GRADE SHREDDED HARDWOOD MULCH (4" MIN DEPTH) PLANTING SOIL (MIN. DIMENSION SHOWN) SOIL SAUCER: USED PREPARED SOIL (4" MIN.) ROPES AT TOP OF BALL SHALL BE CUT. REMOVE TOP 1/3 OF BURLAP. NON-BIODEGRADABLE MATERIAL SHALL BE TOTALLY REMOVED. PREPARED SUBSOIL TO FORM PEDESTAL TO PREVENT SETTLING. C2.15 6 SHRUB 2 X BALL DIA. MIN. 9" (MIN.) 9" (MIN.) 4" SHREDDED HARDWOOD MULCH EDGING (5 STAKES PER 20' LENGTH MINIMUM) AND WEED BARRIER ROOT BALL OR POT PLANTING SOIL (MIN. DIMENSION SHOWN) UNDISTURBED SOIL OR COMPACTED SUBGRADE C2.15 7 SHRUB BED EDGING6" MIN.FINISH GRADE TOPSOIL EDGING FINISH GRADE LANDSCAPE ROCK COMPACTED SUBGRADE GEOTEXTILE WEED BARRIER - WRAP SIDES, TYPICAL 8 C2.15 GROUNDCOVER AND PERENNIALS6"EQUALEQUALPLAN SECTION12"PLANTER EDGE ALL GROUND COVER AND ANNUALS SHALL BE PLANTED AT EQUAL TRIANGULAR SPACING AS INDICATED ON LANDSCAPE PLAN. LANDSCAPE ROCK CULTIVATE TO A 12" DEPTH AND AMEND PER SPECIFICATIONS TO FORM PREPARED PLANTING MIX C2.15 9 CONIFEROUS TREE6"1'-0" MIN 1'-0" MIN 2.5 X BALL DIA. MIN. SET TREE AT FINISH GRADE SHREDDED HARDWOOD MULCH (4" MIN. DEPTH) PLANTING SOIL (MIN. DIMENSION SHOWN) SOIL SAUCER: USED PREPARED SOIL (4" MIN.) ROPES AT TOP OF BALL SHALL BE CUT. REMOVE TOP 1/3 OF BURLAP. NON-BIODEGRADABLE MATERIAL SHALL BE TOTALLY REMOVED. PREPARED SUBSOIL TO FORM PEDESTAL TO PREVENT SETTLING. 5 C2.15 LANDSCAPE ARCHITECTURE SITE PLANNING CIVIL ENGINEERING ANDERSON - JOHNSON ASSOCIATES, INC. 7575 GOLDEN VALLEY ROAD SUITE 200 MINNEAPOLIS. MN 55427 FAX (763) 544-0531 PH (763) 544-7129 DateRegistration Number Check Drawn Date: Comm I hereby certify that this plan, specification or report was prepared by me or under my direct supervision and that I am a duly Licensed under the laws of the State of Revisions Description Date Num Scale: North 501 South Eighth Street Minneapolis, MN 55404 krausanderson.com | 612 332 7281 MOUNDS VIEW HIGH SCHOOL 2019 IMPROVEMENTS 1900 Lake Valentine Road ARDEN HILLS, MINNESOTA 55112 4570 VICTORIA STREET N SHOREVIEW, MINNESOTA 55126 ISD #621: MOUNDS VIEW PUBLIC SCHOOLS PROFESSIONAL ENGINEER MINNESOTA C2.15 NOT TO SCALE DAR MET 02/06/2019 172270 40180 02/06/2019 DAVID A. REY DETAILSSITE 10 C2.15 FILTRATION AREA PLANTINGS DETAILED VIEW 1" = 20' Addendum #2 02/22/2019 1 4'-0" "RIM" ELEVATION = 911.50 1'-0"SUMPSTORM SEWER PIPE- REFER TO UTILITY PLANS FOR PIPE LENGTHS AND SLOPES PROVIDE FLEXIBLE JOINT - REFER TO SPECS 12" PIPE OUT INV. = 907.30 OUTLET CONTROL STRUCTURE (OCS 1) SECTION PLAN 1-1/4"GRATE DETAIL 4' INSIDE DIAM. PROVIDE 6-1/2" SS ANCHOR BOLTS W/CLIPS 1 1/2" x3/8" OUTER RING 1 1/2"x3/8" STEEL BARS @4" O.C. MAX EACH WAY 1/4"x1/4" STEEL BAR, WELD TO EACH MEMBER HOT-DIPPED GALVANIZED GRATE IN 2 SECTIONS BASES SHALL BE 8" STANDARD PRECAST WITH 2" LEAN GROUT, OR POURED 8" SLAB REINFORCED WITH 6" x 6" 10/10 MESH PRECAST CONCRETE SECTION PROVIDE FLEXIBLE JOINT - REFER TO SPECS 4'-0" "RIM" ELEVATION = 911.50 1'-0"SUMPPROVIDE FLEXIBLE JOINT - REFER TO SPECS 12" PIPE OUT INV. = 907.30 BASES SHALL BE 8" STANDARD PRECAST WITH 2" LEAN GROUT, OR POURED 8" SLAB REINFORCED WITH 6" x 6" 10/10 MESH PRECAST CONCRETE SECTION PROVIDE FLEXIBLE JOINT AT CONNECTION - REFER TO SPECS 12" PIPE OUT INV. = 907.30 6" DT IN INV. = 907.50 PROVIDE FLEXIBLE JOINT AT CONNECTION - REFER TO SPECS 6" DT IN INV. = 907.50 6" DT IN INV. = 907.50 6" DT IN INV. = 907.50 11 C2.15 PEDESTRIAN CROSSWALK FLASHER SYSTEM 24" X 12" W16-7PR STATIC SIGN ALUMINUM POLE CAP BACK TO BACK 30" W11-2 STATIC SIGNS BACK TO BACK RRFB LIGHT BARS 24" X 12" W16-7PL STATIC SIGN RADIO ANTENNA ALUMINUM CONTROL CABINET (MUST BE MOUNTED SO ANTENNA SIGNAL IS NOT OBSTRUCTED FOR PROPER RADIO RECEPTION) YELLOW PUSH BUTTON KIT 4-1/2" O.D. ALUMINUM POLE PACKAGE NOTES: 1)ALL DIMENSIONS ARE FOR REFERENCE ONLY. 2) CONTROL CABINET HEIGHT MAY VARY. 3) SNAP LOCKS ARE PROVIDED, STANDARD 34" S/S BANDING IS RECOMMENDED. 4)J-BOLTS NOT SHOWN. 5) PROVIDE DETECTION SENSOR, FLIR TRAFIONE 195 OR APPROVED EQUAL, PER SPECIFICATIONS C2.15 12 Addendum #3 02/26/2019 2 5'-0" STORM SEWER PIPE- REFER TO UTILITY PLANS FOR PIPE LENGTHS AND SLOPES OUTLET CONTROL STRUCTURE (OCS 2) SECTION PLAN 1-1/4"GRATE DETAIL 5' INSIDE DIAM. PROVIDE 6-1/2" SS ANCHOR BOLTS W/CLIPS 1 1/2" x3/8" OUTER RING 1 1/2"x3/8" STEEL BARS @4" O.C. MAX EACH WAY 1/4"x1/4" STEEL BAR, WELD TO EACH MEMBER HOT-DIPPED GALVANIZED GRATE IN 2 SECTIONS BASES SHALL BE 8" STANDARD PRECAST WITH 2" LEAN GROUT, OR POURED 8" SLAB REINFORCED WITH 6" x 6" 10/10 MESH PRECAST CONCRETE SECTION PROVIDE FLEXIBLE JOINT - REFER TO SPECS 5-0" "RIM" ELEVATION = 906.60 BASES SHALL BE 8" STANDARD PRECAST WITH 2" LEAN GROUT, OR POURED 8" SLAB REINFORCED WITH 6" x 6" 10/10 MESH PRECAST CONCRETE SECTION PROVIDE FLEXIBLE JOINT - REFER TO SPECS 6" ORIFICE INV. = 903.50 PROVIDE FLEXIBLE JOINT AT CONNECTION - REFER TO SPECS 15" PIPE IN INV. = 903.50 15" PIPE OUT INV. = 903.50 6" ORIFICE INV. = 903.50 WEIR CREST INV. = 905.20 CONCRETE BAFFLE WITH #4 REBAR 12" O.C. BOTH WAYS DOWELED INTO SIDE WALLS OF INSIDE OF STRUCTURE AND BOTTOM SLAB. WEIR WALL SHALL BE CAST IN FIELD BY CONTRACTOR. CONCRETE BAFFLE WITH #4 REBAR 12" O.C. BOTH WAYS DOWELED INTO SIDE WALLS OF INSIDE OF STRUCTURE AND BOTTOM SLAB. WEIR WALL SHALL BE CAST IN FIELD BY CONTRACTOR. WEIR CREST INV. = 905.20 HWL = 906.63 15" PIPE IN INV. = 903.50 WEIR CREST INV. = 905.20 15" PIPE OUT INV. = 903.50 PROVIDE FLEXIBLE JOINT - REFER TO SPECS 15" PIPE OUT INV. = 903.50 1' SUMP "RIM" ELEVATION = 906.60 HWL = 906.63 15" PIPE IN INV. = 903.50 6" ORIFICE INV. = 903.50 1' SUMP 1 C2.15 2 C2.15 NOT USED 3 C2.15 NOT USED LANDSCAPE ARCHITECTURE SITE PLANNING CIVIL ENGINEERING ANDERSON - JOHNSON ASSOCIATES, INC. 7575 GOLDEN VALLEY ROAD SUITE 200 MINNEAPOLIS. MN 55427 FAX (763) 544-0531 PH (763) 544-7129 DateRegistration Number Check Drawn Date: Comm I hereby certify that this plan, specification or report was prepared by me or under my direct supervision and that I am a duly Licensed under the laws of the State of Revisions Description Date Num Scale: North 501 South Eighth Street Minneapolis, MN 55404 krausanderson.com | 612 332 7281 MOUNDS VIEW HIGH SCHOOL 2019 IMPROVEMENTS 1900 Lake Valentine Road ARDEN HILLS, MINNESOTA 55112 4570 VICTORIA STREET N SHOREVIEW, MINNESOTA 55126 ISD #621: MOUNDS VIEW PUBLIC SCHOOLS PROFESSIONAL ENGINEER MINNESOTA C2.16 NOT TO SCALE DAR MET 02/06/2019 172270 40180 02/06/2019 DAVID A. REY DETAILSSITE 2 C2.16 MnDOT PEDESTRIAN CURB RAMP 6 STANDARD PLAN 5-297.250 1 C2.16 MnDOT PEDESTRIAN CURB RAMP 5 STANDARD PLAN 5-297.250 3 C2.16 MnDOT CONCRETE APPROACH NOSE DETAIL STANDARD PLATE NO. 7113A BASEML 100'-0" T.O. MASONRY 124'-0" BASEUL 111'-2 3/4" 4321 BRICK LEDGE 98'-8" TYP 03.98 08.5904.0107.38 08.99 TYP 04.96 TYP 04.96 TYP 26.97 _______1 37008 TYP 3.9 08.01 BASEML 100'-0" T.O. MASONRY 124'-0" BASEUL 111'-2 3/4" V.1 V.2 Y.1 Y.2 Z.1 AA.1 DD.2 BRICK LEDGE 98'-8" 04.0104.01 TYP 07.3808.99 TYP 04.96 08.54 TYP _______1 37008 04.01 TYP TYP CC.9V.3 BB.1Z.9 BASEML 100'-0" BASEUL 111'-2 3/4" T.O. MASONRY 124'-8" BASELL 88'-5 1/2" 03.04 04.02 TYP 07.38 TYP 6'-0" BRICK LEDGE 91'-4" 1 38003 _______ TYP TYP8"TOP OF NEW METAL COPING TO ALIGN WITH EXISTING 04.0204.0204.02 T.O. PRECAST 112'-3" B.O. PRECAST 110'-7" 6'-0" 6'-0" 6'-0" 6'-0" BASEML 100'-0" BASEUL 111'-2 3/4" T.O. MASONRY 124'-8" (1961) BASELL 89'-5 1/2" TYP 04.0204.0203.04 NE ADDITION ENTRY 90'-8" 07.38 04.0204.0204.02 08.59 TYP SKEWED SEE E2/A5.102 08.51 08.92 TYP TYP 08.53 TYP BRICK LEDGE 90'-0" SEE E3/A5.102 TYP 6'-0" 1 38003 _______ TYP 8"ALIGN PRECAST WITH EXISTING, TYP T.O. PRECAST 112'-3" TOP OF NEW METAL COPING TO ALIGN WITH EXISTING 1 32004 _______ TYP 1 32003 _______ TYP PRECAST SHAPE #1B PRECAST SHAPE #2A B.O. PRECAST 110'-7"8"BASEML 100'-0" BASEUL 111'-2 3/4" BASELL 89'-5 1/2" AB SEE E3/A5.102 SKEWED VIEW BRICK LEDGE 90'-0" TYP T.O. UHPC 125'-4" B.O. UHPC 108'-0" NE ADDITION ENTRY 90'-8" 08.54 TYP 08.95 TYP 08.93 TYP 08.94 TYP 07.95 04.96 TYPTYP 07.39 XA XB C4 A5.102 B1 A5.102 B3 A5.102 C 1 A 5 .1 0 2 E2A5.102E3A5.102F1 A5.102 F3 A5.102 F6 A5.102 E5 A5.102 C7 A5.102E1 A 5 .1 0 2 B6 A5.102 BRICK LEDGE 90'-0" BASEML 100'-0" BASEUL 111'-2 3/4" T.O. MASONRY 124'-8" 03.04 04.02 TYP NE ADDITION ENTRY 90'-8" T.O. CANOPY 101'-2" B.O. CANOPY 98'-8" T.O. PRECAST 112'-3" 03.98 TYP 07.3808.88 TYP 6'-0" 1 38003 _______ TYP _______1 37008 04.0204.0204.0207.39 07.38SEE C7/A5.102 SKEWED B.O. PRECAST 110'-7" 08.01 07.09 PENTHOUSE 121'-8" T.O. PENTHOUSE 139'-4" 07.06 YZAABBCCDDEE 07.38 TYP DD.1 PENTHOUSE 121'-8" T.O. PENTHOUSE 139'-4" 07.06 13 12 11 TYP 07.38 08.5908.01 T.O. PENTHOUSE 139'-4" 08.59 W Y Z AA BB CC DD EE TYP 07.38 07.06 T.O. MASONRY 121'-8" T.O. PENTHOUSE 139'-4" 07.06 131211 TYP 05.9607.38 19 04.0103.98 BRICK LEDGE 90'-0" T.O. UHPC 125'-4" B.O. CANOPY 98'-8" T.O. CANOPY 101'-2" B.O. UHPC 108'-0" NE ADDITION ENTRY 90'-8" 07.95 TYP 26.9708.01 BASEUL 111'-2 3/4" 07.3907.39 SEE E3/A5.102 SKEWED BRICK LEDGE 90'-0" BASEML 100'-0" BASEUL 111'-2 3/4" T.O. MASONRY 124'-8" GROUND FLOOR 91'-4" T.O. CANOPY 101'-2" B.O. CANOPY 98'-8" 04.02 03.04 07.38 TYP TYP 6'-0" 1 38003 _______ TYP T.O. PRECAST 112'-3" 04.0204.0204.02 B.O. PRECAST 110'-7" 4 3 2 1 T.O. MASONRY 124'-0" 07.3807.06 3.9 KEYED SHEET NOTESGENERAL SHEET NOTES 1. PROPOSED ROUTING OF NEW UTILITY SECONDARY FEEDING EXISTING MSB. ROUTE SHALL RISE ALONG EXTERIOR WALL AND CONTINUE ON BUILDINGS ROOF TO EXISTING 480/277V MSB. COORDINATE ALL ROOF PENETRATIONS WITH STRUCTURAL. ACTUAL ROUTE MAY VARY. SEE RISER DIAGRAM FOR SIZING OF SECONDARY. 2. PROVIDE 20A 277V BRANCH CIRCUIT FROM EXISTING BUILDING PANELBOARD. HOMERUN SHALL BE 1-1/4"C - 2#8 + #10G. TO PANELBOARD. VERIFY LOCATION OF PANELBOARD IN FIELD. UPDATE PANELBOARD DIRECTORY WITH ALL CHANGES. 3. UTILIZE EXISTING HANDHOLE TO FEED NEW LIGHTING ASSEMBLIES. 4. PROVIDE 1" C - 2#10 + #10 G MINIMUM TO ALL LIGHTING ASSEMBLIES ON CIRCUIT SERVING FIXTURES. TYPICAL. 5. PROVIDE RACEWAY STUB-OUT TO 3'-0" BEYOND BASE AND CAP. PROVIDE STEEL STAKE AT END FOR FUTURE LOCATION. 6. PROVIDE HANDHOLE TO INTERCEPT EXISTING BRANCH CIRCUITRY. EXTEND TO NEW ASSEMBLIES. MATCH EXISTING RACEWAY AND CONDUCTORS. 7. REUSE EXISTING AREA LIGHTING CIRCUITRY/CONTROLS FOR NEW LIGHTING. UPDATE PANELBOARD SCHEDULE. 8. RECONNECT EXISTING LIGHTING ASSEMBLIES TO NEW CIRCUIT. PROVIDE NEW CONDUCTORS THROUGHOUT. 9. MAINTAIN CIRCUIT CONTINUITY TO EXISTING FIXTURE. 10. PROVIDE EXTENSION OF RACEWAY TO EXISTING AREA LIGHTING ASSUMBLIES TO REMAIN. PROVIDE NEW CONDUCTORS THROUGHOUT.8"CLAYST SC O U N T Y R O A D F C O U N T Y R O A D F L A K E V A L E N T I N E R D.WW WWW WWWW WW W W W W(P) W(P)W(P)W(P)W(P)W(P)W(P)WGAS GASGAS GAS GAS GAS GAS GAS GASGASGAS4"PVC DRAIN TILE AROUND FIELD (TYP) 4"PVC DRAIN TILE AROUND FIELD (TYP)4"PVC DRAIN TILE AROUND FIELD (TYP) 4"PVC DRAIN TILE AROUND FIELD (TYP) 12" RC P ST S 15"PVCST S6"PVCST S12"RCP ST S12" PV C ST S 6"P VC ST S 12 " R C P S T S12"RCPST S12"PEP ST S1 2 "P E P S T S 8 "P V C S T S 1 2 "P V C S T S 12"RCPST S12"RCPST S12"RCP ST S 12" RC P ST S 15"RCP ST S 4" P V C S T S 12"PVC ST S 15"R CP INV= 904.8 15"RCPST S12"RCPST S18"RCPST S18"RCPST S12" RC P ST S 15"PVC ST S12" RC P ST S 15"FE S INV= 908.8 RD1 2 "P E P S T S 12"PVC ST S12"RCP ST SSAN S SAN S SAN S SAN SSAN SSAN SUGC UGC UGCUGCOHE O H P OHEUGEUGEUGEUGEUGE UGE UGEUGEUGEUGE U G E UGE UGE UGE U G E UGEU G E UGE UGEU G E UGEUGEU G EUGE U G E UGEUGE UGE UGE U G E U G E UGEU G EUGE UGEUGEUGEOHEOHEOHE O H E OHENEW LOCATION OF UTILITY TRANSFORMER 174 NEW ADDITION NEW ADDITION EXISTING BUILDING MOUNDSVIEW HIGH SCHOOL 1900 &1901 LAKE VALENTINE RD. T 174 UGE MSB-MS 1 1 174 BUS PARKING (29 BUS STALLS) PROPOSED BUILDING ADDITION 'B' PROPOSED BUILDING ADDITION 'F' PROPOSED BUILDING ADDITION 'G' EAST PARKING (174 STALLS) SOUTH PARKING (6 BUS STALLS) ACCESSIBLE PARKING (16 STALLS)BB3 BB3 BB3 BB3 AA4 AA4 AA4 AA4 AA4 AA3R AA4 EX EX EX EX EX EX 3 HH 26 26 26 26 26 26 26 3030 30 30 1 1 1 1 1 1 1 1 1 11 1 1 1 1 1 1 BB4 BB4 HH 56 9 EX 7 BB3 30 BB3 30 5 8 UGE UGE UGE UGE UGE UGE UGE UGE UGE UGE UGE UGE UGE UGE UGE UGEUGE UGE UGEUGE UGE 3 3 3 3 5 3 UGE 10 10 3 3 BB3 30 A. ALL LIGHTING AND POWER CONDUCTORS SHALL BE INSTALLED BETWEEN 24" (MINIMUM) AND 36" (MAXIMUM) BELOW FINISHED GRADE. B. ALL COMMUNICATIONS CONDUIT AND CABLES SHALL BE INSTALLED 36" (MINIMUM) BELOW FINISHED GRADE. C. ALL CONDUCTORS FOR EXTERIOR LIGHTING AND POWER CIRCUITS SHALL BE #10 AWG MINIMUM. D. PROVIDE PRV-40 IN GREEN SPACES AND PVC-80 UNDER HARD SURFACES. E. PROVIDE PULL WIRE IN ALL EMPTY CONDUITS. F. PROVIDE DETECTABLE UNDEGROUND TAPE ABOVE EACH UNDERGROUND CONDUIT. G. SET BACK CENTER OF POLE BASES 3 FEET FROM FACE OF CURB OR SIDEWALK. H. SEE LIGHTING PLANS FOR EXACT LOCATIONS OF BUILDING MOUNTED LIGHTING. I. HANDHOLES AND PULLBOXES MAY NOT BE INDICATED ON PLANS. PROVIDE AS REQUIRED FOR INSTALLATION. MOUNDS VIEW HIGH SCHOOL - ELECTRICAL SITE PLANS - LIGHTING CALCULATIONSDesigner T.BERNSTEIN Date 03/27/2019 Scale SEE DRAWINGS Drawing No. Summary 3 of 3 Schedule Label QTY Catalog Number Description Lamp Number Lamps Lumens per Lamp LLF Wattage AA3 RS 1 VP-S-36L-80-4K7-2-HSS-90-LR Small Viper with HSS - 90 and Type 2 Lens. (Blocking the Left Side of the Distribution) - Parking Lot Area Lighting X-70-CRI 1 6505 0.85 85.3 AA4 8 VP-S-36L-80-4K7-4 Small Viper Type IV Distribution - Parking Lot Area Lighting X-70-CRI DATA SHOWN IS SCALED FROM TEST 11604137.07 1 9052 0.85 81 AA5 14 VP-S-36L-80-4K7-5QM Small Viper Type V Distribution - Parking Lot Area Lighting X-70-CRI DATA SHOWN IS SCALED FROM TEST 11604137.09 1 9219 0.85 81 BB3 6 VP-S-24L-55-4K7-3 Small Viper Type III Distribution - Walkway Area Lighting X-70-CRI DATA SHOWN IS SCALED FROM TEST 11604137.05 1 6138 0.85 54 BB4 1 VP-S-24L-55-4K7-4 Small Viper Type IV Distribution - Walkway Area Lighting X-70-CRI DATA SHOWN IS SCALED FROM TEST 11604137.07 1 6035 0.85 54 Luminaire Locations Label MH AA3RS 27.50 AA5 32.75 AA5 32.75 AA5 32.75 AA5 32.75 AA5 32.75 AA5 32.75 AA5 32.75 AA4 27.50 AA4 27.50 AA4 27.50 AA4 27.50 AA4 27.50 AA4 27.50 AA4 27.50 AA4 27.50 AA5 32.75 AA5 32.75 AA5 32.75 AA5 32.75 AA5 32.75 AA5 32.75 AA5 32.75 BB3 20.75 BB3 20.75 BB4 20.75 BB3 20.75 BB3 20.75 BB3 20.75 BB3 20.75 ELECTRICAL SITE PLAN - SOUTH PARKING LOT Scale: 1" = 30ft MAIN ENTRANCE EXISTING BUILDING MAIN GAME FIELD AND TRACK EXISTING TENNIS COURTS EXISTING BUILDING (STORAGE) POND POND STORMWATER RETENTION MARSH L A K E V A L E N T IN E R O A D P A R E N T L O O P J ANET COURTLOADING DOCK TICKETING CONCESSIONS EDGE OF PROPERTY GYMNASIUM ADDITION NEW TURN LANE CROSSWALK WITH BUMP-OUT LOT A (254) LOT B (224) LOT C (23) PARKING SETBACK WETLAND 2 6 50 50 31 17 PROPOSED STORMWATER RETENTION RELOCATED SOCCER FIELD RELOCATED LACROSSE FIELD / FOOTBALL FIELD EXISTING BASEBALL FIELD EASEMENT FAIRVIEW AVERELOCATED SOCCER FIELD NEW FIRE- LANE CLASSROOM ADDITION CLASSROOM ADDITION PROPOSED NEW TREE LINE EXISTING TRACK EVENTS FIRE TRUCK TURN-AROUND PARKING LOT (15) ACCESIBLE PARKING (13)ALTERNATE LOADING DOCK ACCESS EXISTING SIDEWALK NEW SIDEWALK FLASHING PEDESTRIAN LIGHTS PEDESTRIAN MEDIANS EXISTING SIDEWALK RAMP ATHLETIC/STUDENT WALK-WAYS ATHLETIC/STUDENT WALK-WAYS RE-ESTABLISH TURF-FALL 2020 RELOCATE FIELD SUMMER 2019 STUDENT PARKING DURING CONSTRUCTION RECONFIGURE PARKING LOTS SUMMER 2019 PRELIMINARY SUMMER 2020 CONSTRUCTION CONTRACTOR / STAFF PARKING DURING CONSTRUCTION CONSTRUCTION / DELIVERY ENTRANCE SITE WORK TO COMMENCE APRIL 2019 -S. LOT WILL BE CLOSED -HIGHLIGHTED ROADS WILL BE CLOSED TO PUBLIC / STUDENTS STARTING APRIL 2019 STAFF PARKING DURING CONSTRUCTION KA TRAILER STAGING ATHLETIC WALKWAYS NEW FENCE SOUTH ROAD / RETAINING WALL CONSTRUCTION: PHASE 3 TEMP FIELD DURING CONSTRUCTION WALK WAY BARRICADES ACCESS RAMPS TO STAGING TEMP HAUL ROAD FOR FIELD RELOCATION MAIN ROAD CONSRTUCTION: PHASE 2 CHANGE DOOR SWING SECONDARY GYM EXIT UPSTAIRS EXIT CHANGE DOOR SWING BLOCK OFF STAGE ENTRANCE - NO ACCESS TO PUBLIC / STUDENTS ENTRANCE AND BUS LOT: -FIRST LIFT SUMMER 2019 - SECOND LIFT SUMMER 2020 TEMP WALK WAY THROUGH CONSTRUCTION - BUILD AT END OF AUGUST FOR FALL START TECHNOLOGY WING EXIT EXITS OFF LINE EXIT ROUTE TEMP FENCE PARKING WALKWAY ATHLETIC WALKWAY KEY: Wenck Associates, I nc. | 1800 Pioneer Creek Center | P.O. Box 249 | Maple Plain, MN 55359-0249 Toll Free 800-472-2232 Main 763-479-4200 Email wenckmp@wenck.com Web wenck.com - To: Mounds View Public School City of Arden Hills From: Ed Terhaar, P.E. Date: March 19, 2019 Subject: Hazard Identification for Potential School Zone Speed Limit on Lake Valentine Road for Mounds View High School PURPOSE AND BACKGROUND The School Zone Speed Limit guidance produced by the Minnesota Department of Transportation (MnDOT) includes the identification of hazards near a school site to determine the need for a modified speed limit. The Hazard Identification for the Mounds view High School site is shown below. HAZARD I DENTI FI CATI ON FOR MOUNDS VI EW HI GH SCHOOL The nine items listed in the MnDOT School Zone Speed Limit guidance are described below. 1. Roadway geometry – Under existing conditions, Lake Valentine Road is approximately 44 feet wide. Under the proposed plan, the pedestrian crossing distance would be reduced through the construction of a raised median at the pedestrian crossing locations. 2. Traffic volume – Th e Average Annual Daily Traffic (AADT) volume in 2017 on Lake Valentine Road was 4,300 vehicles per day. Traffic volumes near the high school peak at the start and end of the school day. 3. Pedestrian volumes – Under existing conditions, there were 49 pedestrians crossing Lake Valentine Road from 6:30 to 7:30 a.m. and 42 crossing from 1:45 to 2:45 p.m. Pedestrian crossing volumes peak at the start and end of the school day. Under future conditions pedestrian volumes crossing Lake Valentine Road could increase significantly due to additional parking located on the north side of the street. 4. Parking – Under existing conditions the 44 foot roadway width allows for temporary parking to occur in the pedestrian crossing area. The proposed plan reduces the through lane width, making on-street parking at the crossing locations difficult. On- street parking will not be allowed at the pedestrian crossing locations. 5. Traffic control devices. All existing traffic control devices are operating correctly and are not hidden by vegetation. The proposed plan includes the addition of Rectangular Rapid Flashing Beacons (RRFB) at the pedestrian crossing locations on Lake Valentine Road. 6. Sidewalks – Sidewalks are provided on both sides of Lake Valentine Road. Mounds View Public Schools City of Arden Hills March 19, 2019 2 7. Fencing – Under existing conditions fencing is not provided at the pedestrian crossing locations. Under the proposed plan fencing will be provided on the north and south sides of Lake Valentine Road to direct pedestrians to the designated crossing locations. 8. Cr ash history - Crash data obtained from MnDOT using the Minnesota Crash Mapping Analysis Tool (MnCMAT) indicated two crashes from January 1, 2006 to December 31, 2015. Neither crash involved a pedestrian. The proposed plan is expected to improve pedestrian safety by reducing the crossing distance and improving crosswalk visibility. 9. Speed zones - Based on this information, it is recommended the speed limit on Lake Valentine Road be reduced from the posted 35 miles per hour to 25 miles per hour during peak school times when children are present. RECOMMENDATI ON Based on this information, it is recommended the speed limit on Lake Valentine Road be reduced from the posted 35 miles per hour to 25 miles per hour during peak school times when children are present. In order to be effective, additional police enforcement will be needed during the times when the speed limit is reduced. All signing and lighting requirements for school zone speed limits as shown in the Minnesota Manual on Uniform Traffic Control Devices must be implemented. WENCK File #1563-03 March 27, 2019 Prepared by: W ENCK Associates, I nc. 1800 Pioneer Creek Center Maple Plain, MN 55359 Phone: 7963-479 -4200 Fax: 763-479 -4242 Prepared for: Mounds View Public Schools Wold Architects and Engineers Traffic and Parking Study for Mounds View High School in Arden Hills, MN March 2 019 i Table of Contents TABLE OF CONTENTS ..................................................................................... I 1.0 EXECUTI VE SUMMARY ...................................................................... 1-1 2.0 PURPOSE AND BACKGROU ND ........................................................... 2-1 3.0 EXI STI NG CONDI TI ONS .................................................................... 3-1 4.0 TRAFFI C VOLUMES ............................................................................ 4-1 5.0 TRAFFI C ANALYSI S ........................................................................... 5-1 6.0 PARKI NG ANALYSI S ......................................................................... 6-1 7.0 PEDESTRI AN ACCOMMODATI ONS ..................................................... 7-1 8.0 CONCLUSI ONS AND RECOMMENDATI ONS ......................................... 8-1 9.0 APPENDI X ........................................................................................ 9-1 FI GURES FIGURE 1 SITE PLAN ................................................................................ 2-2 FIGURE 2 EXISTING CONDITIONS ............................................................. 3-2 FIGURE 3 TURN MOVEMENT VOLUMES ....................................................... 4-2 FIGURE 4 PARKING SUBAREAS ................................................................. 6-2 I hereby certify that this report was prepared by me or under my direct supervision and that I am a duly Licensed Professional Engineer under the laws of the State of Minnesota. __________________________________ DATE: March 27, 2019 Edward F. Terhaar License No. 24441 March 2 019 1-1 1.0 Executive Summary The purpose of this Traffic and Parking Study is to evaluate the impacts of proposed building and parking lot changes at Mounds View High School in Arden Hills, MN. This study examined weekday a.m. and p.m. peak hour traffic impacts of the proposed changes at the school access points on Lake Valentine Road to determine the impact to traffic volumes at those locations. The proposed school project includes the following items: • Addition of an activities center to the main building • Two small classroom additions • Removal of the First Student bus facility on the north side of Lake Valentine Road • Up to 200 additional students and 8 staff members • Changing the current bus loop to a parent drop-off/pick-up loop • Moving bus drop-off/pick-up activities to the west portion of the existing main parking lot • Expansion of the parking area on the north side of Lake Valentine Road with an overall increase of 6 on -site parking spaces • Removal of one north side access (Access 4) on Lake Valentine Road • Construction of a center median on Lake Valentine Road between Access 3 and Access 6 In addition to the proposed site changes, the school day start and end times chang ed starting in the fall of 2018. The start time changed from 7:25 a.m. to 8:35 a.m. and the end time changed from 2:05 p.m. to 3:15 p.m. The conclusions drawn from the information and analyses presented in this report are as follows: • Under existing conditions, the school has four access points on the south side of Lake Valentine Road. The eastern two access points serve the main parking lot. The third access point from the east serves the short-term parking area, parent drop-off/pick- up activities, and the parking area behind the school. The western access serves the bus loop, parent drop-off/pick-up activities, and a small parking area on the west side of the building. All access points accommodate two-way traffic. All buses load and unload in the bus loop. • The proposed school project includes the following items: o Addition of an activities center to the main building o Two small classroom additions o Removal of the First Student bus facility on the north side of Lake Valentine Road o Up to 200 additional students and 8 staff members o Changing the current bus loop to a parent drop-off/pick-up loop o Moving bus drop-off/pick-up activities to the west portion of the existing main parking lot o Expansion of the parking area on the north side of Lake Valentine Road with an overall increase of 6 parking on-site parking spaces o Removal of one north side access (Access 4) on Lake Valentine Road March 2 019 1-2 o Construction of a center median on Lake Valentine Road between Access 3 and Access 6 • The three-lane configuration on Lake Valentine Road is advantageous at the high school location because it adequately accommodates multiple access points and left turning traffic. The project includes the construction of a center median on Lake Valentine Road between Access 3 and Access 6, which allows for left turn lanes at th ose locations. The median also converts Access 5 to right in/right out operation . This layout adequately accommodates left turns from Lake Valentine Road while limiting impacts at Access 5. As a result, all access intersections operate at acceptable levels of service under all scenarios. No additional improvements are needed at any of the intersections to accommodate the proposed project. • From a traffic operations perspective, the number of access points provided on Lake Valentine Road is adequate to accommodate the parking areas and the drop-off/pick- up areas. • The future parking supply will adequately accommodate the expected parking demand. • Based on the location of the main entrance to the building, the number and locations of pedestrian crossings shown are expected to be adequate. • We recommend installing Rectangular Rapid Flashing Beacons (RRFB) at both of the pedestrian crossing locations on Lake Valentine Road. • Operate the beacons with proximity sensors and push buttons at a ll times of the day. • If the City chooses to establish a school zone on Lake Valentine Road, we recommend reducing the speed limit to 25 miles per hour during peak school times when children are present. We also recommend supplementing the school speed zone signing with a flashing beacon to make the speed limit change clear to motorists. March 2 019 2-1 2.0 Purpose and Background The purpose of this Traffic and Parking Study is to evaluate the impacts of proposed building and parking lot changes at Mounds View High School in Arden Hills, MN. This study examined weekday a.m. and p.m. peak hour traffic impacts of the proposed changes at the school access point s on Lake Valentine Road to determine the impact to traffic volumes at those locations. Proposed Site Changes The proposed school project includes the following items: • Addition of an activities center to the main building • Two small classroom additions • Removal of the First Student bus facility on the north side of Lake Valentine Road • Up to 2 00 additional students and 8 staff members • Changing the current bus loop to a parent drop-off/pick-up loop • Moving bus drop-off/pick-up activities to the west portion of the existing main parking lot • Expansion of the parking area on the north side of Lake Valentine Road with a n overall increase of 6 on -site parking spaces. • Removal of one north side access (Access 4) on Lake Valentine Road. • Construction of a center median on Lake Valentine Road between Access 3 and Access 6. In addition to the proposed site changes, the school day start and end times changed starting in the fall of 2018. The start time changed from 7:25 a.m. to 8:35 a.m. and the end time changed from 2:05 p.m. to 3:15 p.m. The proposed site plan is i n Figure 1. March 2 019 2-2 March 2 019 3-1 3.0 Existing Conditions Lake Valentine Road in this area is a three-lane roa dway with one through lane in each direction and a center two-way left turn lane. All access points are controlled with stop signs on the minor approaches. School Access Points Under existing conditions, the school has four access points on the south side of Lake Valentine Road. The eastern two access points serve the main parking l ot . The third access point from the east serves the short-term parking area, parent drop-off/pick-up activities, and the parking area behind the school. The western access serves the bus loop, parent drop-off/pick-up activities, and a small parking area on the west side of the building . All access points accommodate two-way traffic. All buses load and unload in the bus loop. First Student Bu s Facility Access Points The First Student bus facility and surrounding parking lot have three access points on the north side of Lake Valentine Road. The eastern two are primarily used for parking and bus activities. The western access is used primarily for access to the parking are a. The access points are numbered 1 through 6 for identification purposes. Existing conditions, including the access identification numbers, are shown in Figure 2 . Existing School Traffic Operations D uring the morning observation period, the first bus arrived at 6:49 a.m. and the last bus left the site at 7:20 a.m. The majority of parent drop-off activity occurred between 6:15 a.m. and 7:30 a.m. All access points operated with minimal congestion during the a.m. period. Activity at all access points significantly diminished after 7:30 a.m. During the afternoon observation period, the buses left the site at 2:10 p.m. A bus company employee stopped traffic on Lake Valentine Road to allow the busses free flow access to the roadway. The majority of parent pick-up activities occurred between 2:05 p.m. and 2:30 p.m. Some vehicles were parked on the south curb of Lake Valentine Road for pick-up activities. At 2:05 p.m., students crossed Lake Valentine Road to access the parking area on the north side of the road. Minor congestion occurred on Lake Valentine Road at the time of school dismissal due to the pick-up and student crossing activities. The majority of traffic activity was complete by 2:20 p.m. Traffic Volume Data D ata at all access points on La ke Valentine Lake Road was recorded on May 9 and 10 , 201 8. Traffic data was collected before, during, and after normal school day hours. March 2 019 3-2 March 2 019 4-1 4.0 Traffic Volumes The existing traffic volumes recorded at each access point on Lake Valentine Road were adjusted to account for impacts of the proposed project. The following assumptions were used to adjust the volumes: • Removal of the First Student bus facility on the north side of Lake Valentine Road. • Changed the current bus loop to a parent drop-off/pick-up lo op . • Moved the bus drop-off/pick-up activities to the west portion of the existing main parking lot. • Expansion of the parking area on the north side of Lake Valentine Road with an overall increase of 6 parking on-site parking spaces. • Removal of one north side access (Access 4) on Lake Valentine Road. • Construction of a center median on Lake Valentine Road between Access 3 and Access 6. • Trips generated by the additional 2 00 students and 8 staff members were estimated using the existing traffic count data. • The a.m. and p.m. peak hours were modified to account for the new school day start and end time. Under existing conditions, the a.m. peak hour is 6:30-7:30 a.m. and the p.m. peak hour is 1:45-2:45 p.m. Under future conditions with the new school day start and end times, the a.m. peak hour changes to 7:45-8:45 a.m. and the p.m. peak hour changes to 2:45-3:45 p.m. The resultant a.m. and p.m. peak hour traffic volumes are shown in Figure 3 . March 2 019 4-2 March 2 019 5-1 5.0 Traffic Analysis Intersection Level of Service Analysis Traffic analyses were completed for the access intersections for all scenarios described earlier during the weekday a.m. and p.m. peak hours using Synchro software. Initial analysis was completed using existing geometrics and intersection control. Capacity analysis results are presented in terms of level of service (LOS), which is defined in terms of traffic delay at the intersection. LOS ranges from A to F. LOS A represents the best intersection operation, with little delay for each vehicle using the intersection. LOS F represents the worst intersection operation with excessive delay. The following is a detailed description of the conditions described by each LOS designation: • Level of service A corresponds to a free flow condition with motorists virtuall y unaffected by the intersection control mechanism. For a signalized or an unsignalized intersection, the average delay per vehicle would be approximately 10 seconds or less. • Level of service B represents stable flow with a high degree of freedom, but with some influence from the intersection control device and the traffic volumes. For a signalized intersection, the average delay ranges from 10 to 20 seconds. An unsignalized intersection would have delays ranging from 10 to 15 seconds for this level. • Level of service C depicts a restricted flow which remains stable, but with significant influence from the intersection control device and the traffic volumes. The general level of comfort and convenience changes noticeably at this level. The delay ranges from 20 to 35 seconds for a signalized intersection and from 15 to 25 seconds for an unsignalized intersection at this level. • Level of service D corresponds to high-density flow in which speed and freedom are significantly restricted. Though traffic flow remains stable, reductions in comfort and convenience are experienced. The control delay for this level is 35 to 55 seconds for a signalized intersection and 25 to 35 seconds for an unsignalized intersection. • Level of service E represents unstable flow of traffic at or near the capacity of the intersection with poor levels of comfort and convenience. The delay ranges from 55 to 80 seconds for a signalized intersection and from 35 to 50 seconds for an unsignalized intersection at this level. • Level of service F represents forced flow in which the volume of traffic approaching the intersection exceeds the volume that can be served. Characteristics often experienced include long queues, stop-and-go waves, poor travel times, low comfort and convenience, and increased accident exposure. Delays over 80 seconds for a signalized intersection and over 50 seconds for an unsignalized intersection correspond to this level of service. March 2 019 5-2 The LOS results for the study intersections are desc ribed below. Lake Valentine Road/Access 1 D uring the 2018 existing 6:30-7:30 a.m. peak hour, all movements operate at LOS C or better. The overall intersection operates at LOS A. For post-construction conditions, the a.m. peak hour changes to 7:45-8:45 a.m. Under 2020 post-construction conditions during the 7:45-8:45 a.m. peak hour, all movements operate at LOS D or better. The overall intersection operates at LOS A. During the 2018 existing 1:45-2:45 p.m. peak hour, all movements operate at LOS B or better. The overall intersection operates at LOS A. For post-construction conditions, the p.m. peak hour changes to 2:45-3:45 p.m. Under 2020 post-construction conditions during the 2:45-3:45 p.m. peak hour, all movements operate at LOS B or better. The overall intersection operates at LOS A. All movements and the overall intersection operate at acceptable levels of service under all scenarios. No improvements are needed at this intersection to accommodate the proposed project. Lake Valentine Road/Access 2 D uring the 2018 existing 6:30-7:30 a.m. peak hour, all movements operate at LOS D or better. The overall intersection operates at LOS A. For post-construction conditions, the a.m. peak hour changes to 7:45-8:45 a.m. Under 2020 post-construction conditions during the 7:45-8:45 a.m. peak hour, all movements operate at LOS E or better. The overall intersection operates at LOS A. During the 2018 existing 1:45-2:45 p.m. peak hour, all movements operate at LOS B or better. The overall intersection operates at LOS A. For post-construction conditions, the p.m. peak hour changes to 2:45-3:45 p.m. Under 2020 post-construction conditions during the 2:45-3:45 p.m. peak hour, all movements operate at LOS C or better. The overall intersection operates at LOS A. All movements and the overall intersection operate at acceptable levels of service under all scenarios. No improvements are needed at this intersection to accommodate the proposed project. Lake Valentine Road/Access 3 D uring the 2018 existing 6:30-7:30 a.m. peak hour, all movements operate at LOS E or better. The overall intersection operates at LOS A. For post-construction conditions, the a.m. peak hour changes to 7:45-8:45 a.m. Under 2020 post-construction conditions during the 7:45-8:45 a.m. peak hour, all movements operate at LOS E or better. The overall intersection operates at LOS A. During the 2018 existing 1:45-2:45 p.m. peak hour, all movements operate at LOS B or better. The overall intersection operates at LOS A. For post-construction conditions, the p.m. peak hour changes to 2:45-3:45 p.m. Under 2020 post-construction conditions during the 2:45-3:45 p.m. peak hour, all movements operate at LOS C or better. The overall intersection operates at LOS A. March 2 019 5-3 All movements and the overall intersection operate a t acceptable levels of service under all scenarios. No improvements are needed at this intersection to accommodate the proposed project. Lake Valentine Road/Access 4 D uring the 2018 existing 6:30-7:30 a.m. peak hour, all movements operate at LOS B o r better. The overall intersection operates at LOS A. This access is removed under the post- construction conditions. During the 2018 existing 1:45-2:45 p.m. peak hour, all movements operate at LOS B or better. The overall intersection operates at LOS A. This access is removed under the post- construction conditions. All movements and the overall intersection operate at acceptable levels of service under all scenarios. No improvements are needed at this intersection to accommodate the proposed project. Lake Valentine Road/Access 5 D uring the 2018 existing 6:30-7:30 a.m. peak hour, all movements operate at LOS B or better. The overall intersection operates at LOS A. For post-construction conditions, this access is converted to a right in/right one access and the a.m. peak hour changes to 7:45- 8:45 a.m. Under 2020 post-construction conditions during the 7:45-8:45 a.m. peak hour, all movements operate at LOS B or better. The overall intersection operates at LOS A. During the 2018 existing 1:45-2:45 p.m. peak hour, all movements operate at LOS B or better. The overall intersection operates at LOS A. For post-construction conditions, this access is converted to a right in/right out access and the p.m. peak hour changes to 2:45- 3:45 p.m. Under 2020 po st -construction conditions during the 2:45-3:45 p.m. peak hour, all movements operate at LOS B or better. The overall intersection operates at LOS A. All movements and the overall intersection operate at acceptable levels of service under all scenarios. No improvements are needed at this intersection to accommodate the proposed project. Lake Valentine Road/Access 6 D uring the 2018 existing 6:30-7:30 a.m. peak hour, all movements operate at LOS D or better. The overall intersection operates at LOS A. For post-construction conditions, the a.m. peak hour changes to 7:45-8:45 a.m. Under 2020 post-construction conditions during the 7:45-8:45 a.m. peak hour, all movements operate at LOS E or better. The overall intersection operates at LOS B. During the 2018 existing 1:45-2:45 p.m. peak hour, all movements operate at LOS B or better. The overall intersection operates at LOS A. For post-construction conditions, the p.m. peak hour changes to 2:45-3:45 p.m. Under 2020 post-construction conditions during the 2:45-3:45 p.m. peak hour, all movements operate at LOS C or better. The overall intersection operates at LOS A. All movements and the overall intersection operate at acceptable levels of service under all scenarios. No improvements are needed at this intersection to accommodate the proposed project. March 2 019 5-4 Overall Traffic Impacts As described earlier, this portion of Lake Valentine Road is a three-lane roadway, with one through lane in each direction and a center two-way left turn lane. This configuration is advantageous at the high school location because it adequately accommodates multiple access points and left turning traffic. The project includes the construction of a center median on Lake Valentine Road between Access 3 and Access 6. The inclusion of the median allows for left turn lanes at Access 3 and Access 6 while converting Access 5 to right in/right out operation. This layout adequately accommodates left turns from Lake Valentine Road while limiting impacts a t Access 5. As a result, all access intersections operate at acceptable levels of service under all scenarios. No additional improvements are needed at any of the intersections to accommodate the proposed project. From a traffic operations perspective, the number of access points provided on Lake Valentine Road is adequate to accommodate the parking areas and the drop-off/pick-up areas. March 2 019 6-1 6.0 Parking Analysis Existing Conditions To determine the existing parking conditions at the high school, parking data was collected for the entire site, which was divided into the sub-areas shown in Figure 4 . Parking usage data was collected on multiple days in May to account for attendance variations. The number of parking spaces used by students and staff is shown in Table 6-1. Table 6-1 Existing W eekday Student and Staff Parking Usage Date and Time Area 1 ( 424 available) Area 2 ( 20 available) Area 3 ( 66 available) Area 4 ( 181 available) Area 5 ( 8 available) Total On-Site ( 699 available) 5/9 /18 – 10 :00 a.m. 366 9 66 43 7 491 5/10 /18 – 11:15 a.m. 336 8 66 43 6 459 5/1 5 /18 – 9:45 a.m. 330 8 66 43 6 453 5/1 6 /18 – 11:00 a.m. 368 8 64 43 6 489 5/17/18 – 10:20 a.m. 349 14 66 43 7 479 5/22/18 – 10:30 a.m. 411 15 66 43 6 541 5/23/18 – 9:50 a.m. 399 16 66 43 7 531 5/24/18 – 9:45 a.m. 387 20 66 43 7 5 2 3 As shown, the peak usage occurred on May 22 nd with 541 spaces used (77.4% of the total spaces) and 158 spaces unused. Future Conditions The project will increase the total number of on-site parking spaces from 699 to 7 05 . The overall student and staff population of the campus is expected to increase by 11 percent, resulting in a 11 percent increase in the site trip generation and parking demand. A 11% increase in the peak parking demand would result in a peak demand 601 spaces, which is 104 spaces less than the future supply. Based on this analysis, the future parking supply will adequately accommodate the expected parking demand. The proposed expansion of the parking supply on the north side of Lake Valentine Road and the reduction in supply to the main parking lot will result in additional students parking on the north side. March 2 019 6-2 March 2 019 7-1 7.0 Pedestrian Accommodations Existing Conditions Under existing conditions, the majority of students and staff park in the east lot located on the south side of Lake Valentine Road. The location of this lot does not require students or staff to cross Lake Valentine Road. A smaller number of students and staff park in the lot located on the north side of Lake Valentine Road. These students and staff cross Lake Valentine Road at random locations between Access 4 and Access 5. The number of pedestrians crossing at this location under existing conditions is shown below. • 630 -730a.m. – 49 pedestrians • 145 -245 p.m. – 42 pedestrians Future Conditions The current site plan shows additional parking on the north side of Lake Valentine Road, with potential ly over 500 spaces available for students and staff. This additional parking will result in increased pedestrian volumes crossing Lake Valentine Road. Assuming a vehicle occupancy of 1.5 people per vehicle, the pedestrian volume crossing Lake Valentine Road is 750 pedestrians. The site plan shows two pedestrian crossing locations on Lake Valentine Road. Both crossing locations include a raised median for pedestrian refuge and flashing pedestrian lights. Each crossing is connected to the parking area on the north by sidewalks directing pedestrians to the crossing locations. Based on the location of the main entrance to the building, the number and locations of pedestrian crossings shown are expected to be adequate. The plan also shows a sidewalk on the north side of Lake Valentine Road extending east to Janet Court. This sidewalk will match the existing trail on the south side of the road. The following recommendations are made for the proposed pedestrian accommodations: • Install Rectangular Rapid Flashing Beacons (RRFB) at both of the pedestrian crossing locations on Lake Valentine Road. • Operate the beacons with proximity sensors and push buttons at a ll times of the day. In addition, each road authority may establish school zone speed limits on roads under their jurisdiction. If the City chooses to establish a school zone on Lake Valentine Road, we recommend reducing the speed limit from the posted 35 miles per hour to 25 miles per hour during peak school times when children are present. We also recommend supplementing th e school speed zone signing with a flashing beacon to make the speed limit change clear to motorists. In order to be effective, additional police enforcement will be needed during the times when the speed limit is reduced. Detailed information on the signing and lighting requirements for school zone speed limits is shown in the Minnesota Manual on Uniform Traffic Control Devices. Additional information on the Hazard Identification is provided in the Appendix. March 2 019 8-1 8.0 Conclusions and Recommendations The conclusions drawn from the information and analy ses presented in this report are as follows: • Under existing conditions, the school has four access points on the south side of Lake Valentine Road. The eastern two access points serve the main parking lot. The third access point from the east serves the short-term parking area, parent drop-off/pick- up activities, and the parking area behind the school. The western access serves the bus loop, parent drop-off/pick-up activities, and a small parking area on the west side of the building. All access points accommodate two-way traffic. All buses load and unload in the bus loop. • The propose d school project includes the following items: o Addition of an activities center to the main building o Two small classroom additions o Removal of the First Student bus facility on the north side of Lake Valentine Road o Up to 200 additional students and 8 staff members o Changing the current bus loop to a parent drop-off/pick-up loop o Moving bus drop-off/pick-up activities to the west portion of the existing main parking lot o Expansion of the parking area on the north side of Lake Valentine Road with an overall increase of 6 parking on-site parking spaces o Removal of one north side access (Access 4) on Lake Valentine Road o Construction of a center median on Lake Valentine Road between Access 3 and Access 6 • The three-lane configuration on Lake Valentine Road is advantageous at the high school location because it adequately accommodates multiple access points and left turning traffic. The project includes the construction of a center median on Lake Valentine Road between Access 3 and Access 6, which allows for left turn lanes at th ose locations. The median also converts Access 5 to right in/right out operation . This layout adequately accommodates left turns from Lake Valentine Road while limiting impacts at Access 5. As a result, all access intersections operate at acceptable levels of service under all scenarios. No additional improvements are needed at any of the intersections to accommodate the proposed project. • From a traffic operations perspective, the number of access points provided on Lake Valentine Road is adequate to accommodate the parking areas and the drop-off/pick- up areas. • The future parking supply will adequately accommodate the expected parking demand. • Based on the location of the main entrance to the building, the number and locations of pedestrian crossings shown are expected to be adequate. March 2 019 8-2 • We recommend installing Rectangular Rapid Flashing Beacons (RRFB) at both of the pedestrian crossing locations on Lake Valentine Road. • Operate the beacons with proximity sensors and push buttons at a ll ti mes of the day. • If the City chooses to establish a school zone on Lake Valentine Road, we recommend reducing the speed limit to 25 miles per hour during peak school times when children are present. We also recommend supplementing the school speed zone signing with a flashing beacon to make the speed limit change clear to motorists. March 2 019 9-1 9.0 Appendix Wenck Associates, I nc. | 1800 Pioneer Creek Center | P.O. Box 249 | Maple Plain, MN 55359-0249 Toll Free 800-472-2232 Main 763-479-4200 Email wenckmp@wenck.com Web wenck.com - To: Mounds View Public School City of Arden Hills From: Ed Terhaar, P.E. Date: March 19, 2019 Subject: Hazard Identification for Potential School Zone Speed Limit on Lake Valentine Road for Mounds View High School PURPOSE AND BACKGROUND The School Zone Speed Limit guidance produced by the Minnesota Department of Transportation (MnDOT) includes the identification of hazards near a school site to determine the need for a modified speed limit. The Hazard Identification for the Mounds view High School site is shown below. HAZARD I DENTI FI CATI ON FOR MOUNDS VI EW HI GH SCHOOL The nine items listed in the MnDOT School Zone Speed Limit guidance are described below. 1. Roadway geometry – Under existing conditions, Lake Valentine Road is approximately 44 feet wide. Under the proposed plan, the pedestrian crossing distance would be reduced through the construction of a raised median at the pedestrian crossing locations. 2. Traffic volume – Th e Average Annual Daily Traffic (AADT) volume in 2017 on Lake Valentine Road was 4,300 vehicles per day. Traffic volumes near the high school peak at the start and end of the school day. 3. Pedestrian volumes – Under existing conditions, there were 49 pedestrians crossing Lake Valentine Road from 6:30 to 7:30 a.m. and 42 crossing from 1:45 to 2:45 p.m. Pedestrian crossing volumes peak at the start and end of the school day. Under future conditions pedestrian volumes crossing Lake Valentine Road could increase significantly due to additional parking located on the north side of the street. 4. Parking – Under existing conditions the 44 foot roadway width allows for temporary parking to occur in the pedestrian crossing area. The proposed plan reduces the through lane width, making on-street parking at the crossing locations difficult. On- street parking will not be allowed at the pedestrian crossing locations. 5. Traffic control devices. All existing traffic control devices are operating correctly and are not hidden by vegetation. The proposed plan includes the addition of Rectangular Rapid Flashing Beacons (RRFB) at the pedestrian crossing locations on Lake Valentine Road. 6. Sidewalks – Sidewalks are provided on both sides of Lake Valentine Road. Mounds View Public Schools City of Arden Hills March 19, 2019 2 7. Fencing – Under existing conditions fencing is not provided at the pedestrian crossing locations. Under the proposed plan fencing will be provided on the north and south sides of Lake Valentine Road to direct pedestrians to the designated crossing locations. 8. Cr ash history - Crash data obtained from MnDOT using the Minnesota Crash Mapping Analysis Tool (MnCMAT) indicated two crashes from January 1, 2006 to December 31, 2015. Neither crash involved a pedestrian. The proposed plan is expected to improve pedestrian safety by reducing the crossing distance and improving crosswalk visibility. 9. Speed zones - Based on this information, it is recommended the speed limit on Lake Valentine Road be reduced from the posted 35 miles per hour to 25 miles per hour during peak school times when children are present. RECOMMENDATI ON Based on this information, it is recommended the speed limit on Lake Valentine Road be reduced from the posted 35 miles per hour to 25 miles per hour during peak school times when children are present. In order to be effective, additional police enforcement will be needed during the times when the speed limit is reduced. All signing and lighting requirements for school zone speed limits as shown in the Minnesota Manual on Uniform Traffic Control Devices must be implemented. _____________________________________________________________________________________________ City of Arden Hills Planning Commission Meeting for May 8, 2019 P:\Planning\Planning Cases\2018\PC 18-014 - Mounds View School District - 1900 & 1901 Lake Valentine Road\Memos Reports Page 1 of 14 Requested Action Mounds View Public Schools has submitted an application for a Master and Final Planned Unit Development (PUD). The Applicant is requesting to construct 27,300 square feet of additional classroom space and a 49,000 square feet gymnasium addition. The property, located at 1900 Lake Valentine Road, is zoned R-1, Single Family Residential and is guided as Public and Institutional on the Land Use Plan. In addition, the Applicant is requesting to amend the 2040 Comprehensive Plan. The Applicant is requesting to modify the future Land Use of 1901 Lake Valentine Road, the former First Student Bus Garage from Low Density Residential to Public and Institutional in the 2040 land use plan. This property will be used for high school student and staff parking. The PUD is required to allow the two non-contiguous parcels to be used as a single use. This item was originally scheduled for a public hearing on April 3, 2019. However, just prior to the hearing, the Applicant submitted revised plans that were significantly different than the previous plans reviewed by staff. As a result, the item was tabled to allow time for additional plan review and a second neighborhood meeting. MEMORANDUM DATE: May 8, 2019 PC Agenda Item 4.A TO: Planning Commission FROM: Mike Mrosla, City Planner Jane Kansier, AICP, Planning Consultant SUBECT: Planning Case # 18-014 – Public Hearing Required Applicant: ISD #621: Mounds View Public Schools Property Location: 1900 and 1901 Lake Valentine Road Request: Master and Final Planned Unit Development; Comprehensive Plan Amendment _____________________________________________________________________________________________ City of Arden Hills Planning Commission Meeting for May 8, 2019 P:\Planning\Planning Cases\2018\PC 18-014 - Mounds View School District - 1900 & 1901 Lake Valentine Road\Memos Reports Page 2 of 14 Background The last major addition to the high school occurred in 2000 when the track and field stadium was reconstructed and additions were made to the main entrance, auditorium, orchestra/choir area, storage, computer lab, staff dining area, woodshop, and classrooms. The Applicant is proposing an addition totaling 76,300 square feet, including 49,000 square feet for gymnasiums and 27,300 square feet for a total of seven classrooms. Interior remodels of the existing building include 65,000 square feet. The subject property is located at 1900 Lake Valentine Road. The Applicant recently acquired the former First Student school bus garage located directly north of the high school at 1901 Lake Valentine Road. The Applicant is proposing to repave and restripe the parking lot for more efficient car parking. The existing building on the site will be used for cold storage. A more intensive use of the building may be proposed at a later date. Existing Conditions 1. Site Data: 2030 Land Use Plan: PI: Public & Institutional and LRR: Low Density Residential Existing Land Use: Institutional: High School, and former site of First Transit bus garage Zoning: R-1: Single Family Residential District Lot Size: 65.65 Acres Topography: The grades on the south side of Lake Valentine Road (existing school site) vary about 20’ from the road (low point) to the south side of the lot (high point). This site has been graded over the years to accommodate the buildings, athletic fields and parking lots. The lot on the north side of Lake Valentine Road slopes towards the north, and has a 6’ variation from the high point of the lot to the low point. _____________________________________________________________________________________________ City of Arden Hills Planning Commission Meeting for May 8, 2019 P:\Planning\Planning Cases\2018\PC 18-014 - Mounds View School District - 1900 & 1901 Lake Valentine Road\Memos Reports Page 3 of 14 2. Surrounding Area: Direction 2030 Land Use Zoning 2040 Land Use North I-694 is located directly north of the site. North of I-694 is MB: Mixed Business G-B: Gateway Business District IND: Light Industrial & Office South LDR: Low Density Residential and P/OS: Parks & Open Space R-1: Single Family Residential District and POS: Parks and Open Space District LDR: Low Density Residential and POS: Parks & Open Space East LDR: Low Density Residential R-1: Single Family Residential District LDR: Low Density Residential West P/OS: Parks & Open Space District and PI: Public & Institutional R-1: Single Family Residential District and POS: Parks & Open Space District POS: Parks & Open Space District and PI: Public & Institutional Process 1. Comprehensive Plan Amendment: An amendment to the Comprehensive Plan requires a recommendation from the Planning Commission following a public hearing, adoption of a resolution by the City Council, and review and approval by the Metropolitan Council. The City has submitted its 2040 Comprehensive Plan update to the Metropolitan Council. The Metropolitan Council will not consider any amendments to the Comprehensive Plan until the 2040 Plan is approved. The City can proceed with the amendment, but must wait to submit it to the Metropolitan Council for final approval, likely later this summer. This delay does not affect the PUD process. 2. Planned Unit Development (PUD) Process: The Planned Unit Development process is a tool that provides additional flexibility for development that an underlying zoning district would not otherwise allow. For example, a PUD may make exceptions to setbacks, lot coverage, parking requirements, signage, building materials, or landscaping requirements. It is intended to overcome the limitations of zoning regulations and improve the overall design of a project. While the PUD process allows the City to negotiate certain aspects of the development, any conditions imposed on the PUD must have a rational basis related to the expected impact of the development. A PUD cannot be used to permit uses that would not otherwise be permitted in the underlying zoning district. If a PUD is comprised of multiple lots, it is often treated as one continuous development. The development as a whole would be expected to meet the landscaping, structure coverage, and other similar requirements. For example, one property in the PUD may have 60 percent building coverage, but the development as a whole may not exceed 50 percent building coverage to maintain conformance with the underlying zoning district. The PUD development process is comprised of multiple steps. The first step is the Master PUD, which is a detailed concept plan for the entire development outlining the individual phases over a period of time. The City also works with the developer during this stage to set a design framework for the development. These standards are written into a development agreement, which generally _____________________________________________________________________________________________ City of Arden Hills Planning Commission Meeting for May 8, 2019 P:\Planning\Planning Cases\2018\PC 18-014 - Mounds View School District - 1900 & 1901 Lake Valentine Road\Memos Reports Page 4 of 14 includes the design standards, a list of conditions, and what deviations from the underlying zoning district will be permitted. A Final PUD proposal is then submitted prior to the development of each successive phase of the project. This plan provides a greater level of detail than the Master PUD and must conform to the approved development agreement. At this time, the Applicant is simultaneously applying for both the Master and Final PUD. They hope to complete all the proposed development in a single phase. However, due to budget constraints, it may be necessary to delay the resurfacing and striping of the north parking lot to a later date. This phase primarily involves grading and reconstruction of the surface lot. If the Applicant must delay this work, staff believes this phase can be reviewed as a site plan. Plan Evaluation 1. Chapter 13, Zoning Code Review Section 1320 – District Provisions A. Lot Size, Building Coverage, and Landscape Coverage – Meets Requirements The minimum lot size in the R-1 District for non-residential uses is 14,000 square feet. The total lot area of the subject property is 65.65 acres. No more than 25 percent of the total lot area may be covered by structures. In this case, the high school and the proposed additions would have a total footprint of 402,830 square feet, approximately 14 percent of the total site area. The Zoning Code requires properties in the R-1 District to maintain a minimum landscaped lot area of 65 percent. Landscaping is defined as all plantings, including trees, grass, and shrubs. R-1 District Requirements Existing Sites (%) Proposed Master PUD Structure Coverage 714,928 sf 25% 326,530 sf 11.41% 402,830 sf 14.08% Landscape Coverage 1,850,886 sf 65% 2,123,550 sf 74.26% 2,116,580 sf 74.01% Total Area within Master PUD 65.65 acres B. Height – Flexibility Required The maximum height in the R-1 District is 35 feet. Most of the proposed additions are at or below this height. There is a proposed penthouse addition, located adjacent to the gymnasium addition, which is proposed to be 40’ in height. This requires flexibility of 5’ of the maximum height. C. Setbacks – Meets Requirements The minimum R-1 setbacks and proposed setbacks are as follows: Minimum Setback Proposed Setback Front 40’ 60’ Side (min/total) 10’/25’ 370’/1,330’ Rear 30’ 260’ _____________________________________________________________________________________________ City of Arden Hills Planning Commission Meeting for May 8, 2019 P:\Planning\Planning Cases\2018\PC 18-014 - Mounds View School District - 1900 & 1901 Lake Valentine Road\Memos Reports Page 5 of 14 Section 1325 – General Regulations A. Landscaping and Tree Preservation – Section 1325.05 Subd. 1 and 1325.055 Minimum Caliper Inches and Tree Ratio – Exceeds Requirements The Zoning Code requires a minimum number of caliper inches of trees be provided based on the gross square footage of the building on the property. The proposed additions have a 76,300 square foot footprint and are generally 2-stories, so the minimum caliper inches required for the landscaping plan is 477 inches. There are currently a total of 6,675 caliper inches of trees on the site. The planned removal is 2,842 caliper inches, and new landscaping includes 273.6 caliper inches to be planted throughout the site. This totals 1,523.6 caliper inches on the site. Tree Preservation – Flexibility Required The following table shows tree removal, required mitigation and proposed replacement: Caliper Inches Number of Trees Existing Significant Caliper Inches 6675 392 Proposed Significant Tree Removal 2842 167 Allowable Removal (10%) 668 -- Mitigation Requirement (1” for each 2”) 1087 -- Proposed Tree Plantings 525 175 Difference 562 -- Based on the ordinance requirements, an additional 562 caliper inches is required. The Applicant has the option of providing the additional trees on the site, or subject to City approval, plant additional trees off-site or provide cash in lieu of replacement. The landscaping plan has been updated to provide additional screening between the athletic fields and the single family houses to the south. There are also several trees planted along the stormwater pond on the north side of the site to provide screening to the homes along Janet Court. Trees along Street Frontage – Exceeds Requirements The Zoning Ordinance requires a minimum of one tree along the right of way for every fifty (50) feet of public street frontage. The proposed plan exceeds this requirement. Perennials and Shrubberies – Meets Requirements The Zoning Ordinance also requires at least ten (10) percent of the total landscaped area shall be covered with perennials and/or shrubbery and be planted within the perimeter of private parking, building, and driveway areas. The proposed landscaping plan exceeds this requirement. _____________________________________________________________________________________________ City of Arden Hills Planning Commission Meeting for May 8, 2019 P:\Planning\Planning Cases\2018\PC 18-014 - Mounds View School District - 1900 & 1901 Lake Valentine Road\Memos Reports Page 6 of 14 Planting Islands – Flexibility Requested The Zoning Ordinance requires planting islands in parking lots to visually break up expanses of hard-surface parking areas, to provide safe and efficient traffic movement, and to define rows of parking. Planting islands must occupy at least ten (10) percent of the parking area, and must be edged with concrete curbs. Parking lot planting islands are also required to be a minimum of 150 square feet in area, be of appropriate width and length, and include at least one tree meeting the requirements of this ordinance. The Applicant is not proposing any planting islands, and is requesting flexibility to this provision. Tree Selection – Meets Requirements The proposed landscape plan includes a variety of tree species, including maples, oaks, ash and evergreens, ranging in size from 2-3 caliper inches. This is consistent with ordinance requirements. B. Lighting – Section 1325.05 Subd. 3 – Meets Requirements The plan proposes new lighting in the parking lot on the north side of Lake Valentine Road and in the new bus parking area on the south side of Lake Valentine Road. The Applicant submitted a photometric plan that indicates the lighting does not exceed 0.1 foot candles at the property boundary. This is less than the permitted 0.4 foot candles. C. Screening – Section 1325.05 Subd. 4 - Meets Requirements Mechanical operating equipment located on the ground or roof is required to be screened from adjacent streets. The proposed plans indicate rooftop mechanical equipment is screened by prefinished metal panels, which are complimentary to the building façade. D. Drainage Wetlands and Flood Plain – Section 1325.05 Subd. 2 This proposal involves significant grading on the site to accommodate the stormwater ponding, building additions, the access road around the building, new parking lot configuration, and new athletic field configuration. The original proposal called for a series of underground stormwater structures; however, the cost of these structures proved to be prohibitive. The revised drainage plans directs stormwater runoff to a large stormwater pond located north of Lake Valentine Road, west of Janet Court, and east of the existing bus storage building. The grading and drainage plan is under review by the City Engineer and the Rice Creek Watershed District. Comments from those reviews will be provided as soon as possible. E. Requirements for Parking, Loading, and Circulation – Section 1325.06 - Meets Requirements The existing circle drive in front of the school’s main entrance is the current bus drop-off and pick-up, where buses are parked side-by-side and nose-to-tail; this creates an unsafe condition _____________________________________________________________________________________________ City of Arden Hills Planning Commission Meeting for May 8, 2019 P:\Planning\Planning Cases\2018\PC 18-014 - Mounds View School District - 1900 & 1901 Lake Valentine Road\Memos Reports Page 7 of 14 forcing students to navigate between multiple lanes of buses. The Applicant is proposing to use the existing circle drive as the parent drop-off and pick-up. A turn lane will also be created at the entrance to this driveway to limit the number of vehicles stacking on Lake Valentine Road. The western half of the existing staff and student parking lot is proposed to be modified to become a bus-dedicated lot with diagonal bus parking (no double-parking) and enough room for the buses to turn around without having to back-up to exit the lot. As a condition of approval, overnight school bus parking is prohibited. The eastern half of the existing parking lot will remain largely unchanged and will be utilized for student parking. Sidewalks will be added to direct student between the eastern parking lot and the main building.The figure below illustrates the changes. The proposed addition is not anticipated to generate additional parking demand on the campus. Rather, the addition will support existing academic programs and the already planned for student population on the campus. However, due to the creation of the bus staging area, the Applicant is proposing to utilize the parking area on the recently acquired 1901 Lake Valentine Road for additional staff and student parking. The existing school is currently under parked by 105 spaces. Under the current proposal the school would have a surplus of 88 parking stalls as shown in the table below. The proposed parking area will be utilized by staff, students and visitors. The timing of the improvements to the north lot is unknown at this time, due to funding limitations. As a condition of approval of the PUD, site plan approval will be required prior to any reconstruction of this site. _____________________________________________________________________________________________ City of Arden Hills Planning Commission Meeting for May 8, 2019 P:\Planning\Planning Cases\2018\PC 18-014 - Mounds View School District - 1900 & 1901 Lake Valentine Road\Memos Reports Page 8 of 14 Existing Parking Requirements Land Use Number of Students/Staff Required Stalls Number of Stalls Provided Parking Deficiency/Surplus Secondary Schools - 1 for each school employee plus one space per 4 students 1800/172* 622 517 -105 Proposed Parking Requirements Land Use Number of Students/Staff Required Stalls Number of Stalls Provided Parking Deficiency/Surplus Secondary Schools - 1 for each school employee plus one space per 4 students 1800/172* 622 710 +88 *Estimate 1800 students +/- 25 to 50 students depending on the time of year. The official use of the north lot for school parking requires safety improvements on Lake Valentine Road. Lake Valentine Road is currently a two-lane road with a center turn lane between Janet Court and the west driveway into the school. This street is designated as a Municipal State Aid System (MSAS) route. The City is eligible to receive funding for maintenance and construction based on the number of miles of streets classified as MSAS roads. In order to maintain this classification, the City must meet specific design standards, including lane width and speed, for these roads. The City has worked extensively with the Applicant to develop a plan to safely accommodate pedestrians and vehicles at this location. The current plan includes crosswalks at two locations across Lake Valentine Road, including two (2) push button attenuated flashing crosswalk signals. The crosswalk signals are similar to the signals located at Valentine Hills Elementary School. A new median, with pedestrian safety refuges, is also included in the plan. In order to minimize points of conflict between pedestrians and vehicles, the plan also restricts the west driveway into the north lot to right-in/right-out turns. The median will include mountable curb to allow emergency vehicle access. A new sidewalk is proposed from the western access of 1901 Lake Valentine Road to Janet Court. The intent of the sidewalk to reduce mid-block pedestrian crossings at Janet Court. A four (4’) foot tall decorative fence will be added to both sides of the street in front of the school to guide students, staff and visitors to the crosswalks. Additional signage and other modifications may occur as the Applicant and staff are working to finalize the pedestrian crossing design. Finally, the staff is working with the Applicant to obtain information needed to create a school speed zone at this location. MnDOT must approve this designation but has indicated their support. _____________________________________________________________________________________________ City of Arden Hills Planning Commission Meeting for May 8, 2019 P:\Planning\Planning Cases\2018\PC 18-014 - Mounds View School District - 1900 & 1901 Lake Valentine Road\Memos Reports Page 9 of 14 Early discussions about safety at this location included consideration of a traffic signal and a pedestrian overpass. The location does not meet the warrants for a traffic signal. A pedestrian overpass or underpass would be very costly and would likely not meet ADA requirements. 2. Design Standards – Section 1325.05 Subd. 6 Aesthetics – Meets requirements According to the zoning ordinance, the proposed design, scale, massing, materials, height and other aspects of the proposed construction shall be evaluated by the Planning Commission and the Council with respect to structures and properties in the surrounding area. The Planning Commission and the Council shall consider whether the appearance of the proposed building is at conflict with the structures and properties in the surrounding area as to cause a substantial depreciation in the property values in the surrounding area or to unreasonably detract from the appearance of the area or the City as a whole. _____________________________________________________________________________________________ City of Arden Hills Planning Commission Meeting for May 8, 2019 P:\Planning\Planning Cases\2018\PC 18-014 - Mounds View School District - 1900 & 1901 Lake Valentine Road\Memos Reports Page 10 of 14 The proposed additions are utilizing the same or similar materials as the existing high school, and the overall design of the proposed addition complements the existing architectural theme found onsite. In addition, the Applicant is proposing to use metal accent panels and large windows. The proposed additions are similar in scale to the existing building. 3. Sign Code – Chapter 12 A. Wall Signage – Flexibility Requested The site is located in Sign District 1. Each property is allowed wall signage measuring up to 8 square feet in area. The proposed plan is requesting flexibility with wall signage to allow a sign depicting the school mascot. The location of the mascot sign is identified above. However, the scale in the elevation is incorrect. The proposed sign is not illumined, and if the Applicant determines to illuminate the sign, it shall externally illumined and shall be approved by planning staff in writing. Wall Sign Sign District 1 Permitted Proposed Type Wall Wall Maximum Copy Area 8 sq. ft. 52.5 sq. ft. Maximum Height None 7 feet B. Freestanding Signage – Meets Requirements Proposed signs on the site are auxiliary, relating to traffic movement, circulation, and parking. The maximum sign copy area for auxiliary signs is 2 square feet. _____________________________________________________________________________________________ City of Arden Hills Planning Commission Meeting for May 8, 2019 P:\Planning\Planning Cases\2018\PC 18-014 - Mounds View School District - 1900 & 1901 Lake Valentine Road\Memos Reports Page 11 of 14 4. Traffic Study The use of the parking lot on the north side of Lake Valentine Road for student and staff parking creates the potential for conflicts between pedestrians crossing the road and automotive vehicles. Safety improvements are required to mitigate the potential impacts of these conflicts. The applicant has provided an initial traffic impact study and a draft plan to address these issues. However, the traffic report submitted to the city on March 19, 2019 by Wenck states that a school speed zone shall be implemented. The recommend speed limit on Lake Valentine Road shall be reduced to from the posted speed of 35 miles per hour to 25 miles per hour during peak school time. The report also states that in order for the school speed zone to be effective, additional law enforcement activity will be need during times when the speed limit is reduce. The enforcement shall include assisting pedestrians crossing the road and regulating speed. Suggested Findings of Fact Staff offers the following findings of fact for consideration: 1. The property located at 1900 Lake Valentine Road is designed for Public and Institutional uses on the 2040 Land Use Plan map. 2. The property located at 1901 Lake Valentine Road is designated for Low Density Residential uses on the 2040 Land Use Plan map. 3. The properties located at 1900 and 1901 Lake Valentine Road are located in the R-1 Single Family Residential District. 4. The R-1 district is consistent with the existing and proposed Public and Institutional designation. 5. The Applicant has proposed a Master Planned Unit Development in order to include noncontiguous parcels as a single use. Other components of the proposal are classroom and gymnasium additions, reconfiguration of the bus parking lot and the staff and student parking lots, and reconfiguration of athletic fields. 6. The Applicant has submitted a Master and Final Planned Unit Development. 7. The Master PUD is generally consistent with the requirements of the City Code. 8. Where the plan is not in conformance with the City Code, flexibility has been requested by the Applicant and/or conditions have been placed on an approval that would mitigate the nonconformity. 9. Flexibility through the PUD process has been requested in the following areas: planting island coverage, tree replacement, building height, and wall signage. 10. The proposed development plan exceeds the minimum requirements of the City Code in the following areas: lot size, building coverage, landscape coverage, setbacks, street trees, perennials and shrubs, tree selection, lighting, screening, location and number of parking stalls, aesthetics and freestanding signs. 11. The Master PUD is in conformance with the draft Arden Hills 2040 Comprehensive Plan, as proposed to be amended. The properties at 1900 and 1901 Lake Valentine Road are zoned R-1, Single Family Residential. Compatible uses such as educational campuses are also intended for this zoning district. 12. With the applied conditions, the application is not anticipated to create a negative impact on the immediate area or the community as a whole. _____________________________________________________________________________________________ City of Arden Hills Planning Commission Meeting for May 8, 2019 P:\Planning\Planning Cases\2018\PC 18-014 - Mounds View School District - 1900 & 1901 Lake Valentine Road\Memos Reports Page 12 of 14 Recommended Conditions of Approval – Comprehensive Plan Amendment Staff recommends approval of Planning Case 18-014 for an amendment to the 2040 Comprehensive Plan Land Use Map from the Low Density Residential designation to the Public and Institutional designation subject to the following condition: 1. Approval of the Comprehensive Plan Amendment is subject to approval by the Metropolitan Council. Recommended Conditions of Approval – Planned Unit Development Based on the submitted plans and findings of fact, staff recommends approval of Planning Case 18-014 for a Master and Final PUD at 1900 and 1901 Lake Valentine Road be subject to the following conditions: 1. The project shall be completed in accordance with the plans submitted as amended by the conditions of approval. Any significant changes to the plans, as determined by the City Planner, shall require review and approval by the Planning Commission and City Council. 2. Prior to the issuance of a Grading and Erosion Control permit, the Applicant shall enter into a PUD Development Agreement with the City. The Development Agreement shall outline conditions of approval, required securities and fees, and sequence of events. 3. A letter of credit equal to or 125% of the cost of the required landscaping must be submitted to the City prior to issuance of a Grading and Erosion Control permit. 4. Prior to the issuance of a Grading and Erosion Control permit, staff shall review and approve the final landscaping plan. 5. Prior to the issuance of a Grading and Erosion Control permit, the Applicant shall determine if they will be adding 562 caliper inches of additional trees on the site, off-site or provide cash in lieu of replacement. 6. A Site Plan Review application shall be required for the reconstruction of the parking lot on PID 21302334005. 7. Any use of the existing building on the on PID 21302334005 other than cold storage will require an amendment to the approved PUD. The existing structure shall comply with City Code Chapter 14 and any other use of the building shall meet all actuatable codes. 8. Overnight vehicle storage is prohibited. All overnight vehicle storage shall be stored in indoors. 9. No exterior storage shall be permitted onsite. 10. All light poles shall be a maximum of 25 feet in height, including base, and shall be shoebox style, downward directed, with high-pressure sodium or LED lamps and flush lens. Other than wash or architectural lighting, attached security lighting shall be shoebox style, downward directed with flush lens. In addition, any entry lighting under canopies shall be recessed and use a flush lens. Shields shall also be added as directed by the City. 11. All rooftop or ground mounted mechanical equipment shall be hidden from view with the same materials used on the building in accordance with City Code requirements. 12. Prior to the issuance of a Grading and Erosion Control permit, trees or tree areas that are to be preserved shall be visibly marked and City-approved tree protection fencing or other methods shall be installed and maintained at the critical root zones of the trees to be _____________________________________________________________________________________________ City of Arden Hills Planning Commission Meeting for May 8, 2019 P:\Planning\Planning Cases\2018\PC 18-014 - Mounds View School District - 1900 & 1901 Lake Valentine Road\Memos Reports Page 13 of 14 protected. The location of the fencing shall be in conformance with the approved tree preservation plan and approved by staff in writing. 13. The Applicant shall be responsible for obtaining any other permits necessary from other agencies, MPCA, Rice Creek Watershed District, etc. prior to the start of any site activities. 14. All disturbed boulevards shall be restored with sod. 15. The Applicant shall be responsible for protecting the proposed on-site storm sewer infrastructure and components and any existing storm sewer from exposure to any and all stormwater runoff, sediments and debris during all construction activities. Temporary stormwater facilities shall be installed to protect the quality aspect of the proposed and existing stormwater facilities prior to and during construction activities. Maintenance of any and all temporary stormwater facilities shall be the responsibility of the Applicant. 16. The Applicant shall be responsible for obtaining a land disturbance Grading and Erosion Control permit from the City’s Engineering Division prior to the commencement of any land disturbance activities. 17. Heavy duty silt fence and adequate erosion control around the entire construction site shall be required and maintained by the Developer during construction to ensure that sediment and storm water does not leave the project site. 18. Prior to the beginning of the 2019-2020 school year, the Applicant shall stripe a minimum of 334 parking stalls in parking lot located on PID 213023340005. Parking stalls dimensions shall be 9 feet by 18 feet. 19. Prior to the issuance of a Grading and Erosion Control permit, the School District shall provide the City in writing how they will staff the pedestrian crossing during student arrive and release. City staff and the Ramsey County Sheriff shall review and approve the pedestrian crossing plan prior to August 1, 2019. If the City or the Sheriff make any recommendation the School District shall implements said recommendations prior to 2019-2020 school year starting. 20. Prior to the issuance of a Grading and Erosion Control permit the Engineering Department shall approve the Final grading, utility, stormwater and right of way improvement plans. 21. The Applicant, Ramsey County Sheriff and City staff shall review traffic and pedestrian operations annually. The Applicant shall implement improvements recommended by the City Engineer. 22. Prior to the issuance of a land disturbance permit, all items identified in the March 5, 2019 Engineering Review Comments memo shall be addressed. All comments shall be adopted herein by reference. 23. The proposed mascot wall sign may be externally illumined and shall be approved by Planning staff in writing. Internal illumination is prohibited. The proposed mascot sign shall not exceed 53 square feet. Final location of the proposed mascot wall sign shall be approved in writing by Planning staff. 24. Findings and recommendations of the March 19, 2019 Traffic memo from Wenck shall be implemented. _____________________________________________________________________________________________ City of Arden Hills Planning Commission Meeting for May 8, 2019 P:\Planning\Planning Cases\2018\PC 18-014 - Mounds View School District - 1900 & 1901 Lake Valentine Road\Memos Reports Page 14 of 14 Proposed Motion Language 1. Recommend Approval with Conditions: Motion to recommend approval of Planning Case 18- 014 for a Comprehensive Plan Amendment and a Master and Final PUD at 1900 Lake Valentine Road, based on the findings of fact and submitted plans, as amended by the conditions in the May 8, 2019, Report to the Planning Commission. 2. Recommend Approval without Conditions: Motion to recommend approval of Planning Case 18-014 for a Comprehensive Plan Amendment and a Master and Final PUD at 1900 and 1901 Lake Valentine Road, based on the findings of fact and submitted plans in the May 8, 2019, Report to the Planning Commission. 3. Recommend Denial: Motion to recommend denial of Planning Case 18-014 for a Comprehensive Plan Amendment and a Master and Final PUD at 1900 and 1901 Lake Valentine Road based on the following findings of fact: findings to deny should specifically reference the reasons for denial and why those reasons cannot be mitigated. 4. Table: Motion to table Planning Case 18-014 for a Comprehensive Plan Amendment and a Master and Final PUD at 1900 and 1901 Lake Valentine Road for the following reasons: a specific reason and/or information request should be included with a motion to table. Notice and Public Comments Notice was published in the Arden Hills-Shoreview Bulletin on April 24, 2019. Notice was prepared by the City and mailed to property owners within 500 feet of the subject property. Two neighborhood meetings were conducted prior to the Public Hearing, the most recent on April 30, 2019. Six residents attended that neighborhood meeting. Since the last neighborhood meeting staff hasn’t received any other letters, e-mails, or telephone calls from property owners or residents in regard to this planning case. Attachments A. Application B. Location Map C. 11x17 Plan Sets D. Wenck Traffic Memo – March 19, 2019 City of Arden Hills City Council Meeting for May 23, 2019 P:\Planning\Planning Cases\2018\PC 18-014 - Mounds View School District - 1900 & 1901 Lake Valentine Road\Memos Reports\CC Memo_05- 13-2019_18-014.docx Page 1 of 7 NEW BUSINESS – 10A MEMORANDUM DATE: May 13, 2019 TO: Honorable Mayor and City Councilmembers Dave Perrault, City Administrator FROM: Mike Mrosla, City Planner Jane Kansier, AICP, Planning Consultant SUBECT: Planning Case #18-014 Applicant: Mounds View Public Schools Property Location: 1900 and 1901 Lake Valentine Road Request: Comprehensive Plan Amendment and Master and Final Planned Unit Development Budgeted Amount: Actual Amount: Funding Source: N/A N/A N/A Requested Action Mounds View Public Schools has submitted an application for a Master and Final Planned Unit Development (PUD). The Applicant is requesting to construct 27,300 square feet of additional classroom space and a 49,000 square feet gymnasium addition. The property, located at 1900 Lake Valentine Road, is zoned R-1, Single Family Residential and is guided as Public and Institutional on the Land Use Plan. In addition, the Applicant is requesting to amend the 2040 Comprehensive Plan. The Applicant is requesting to modify the future Land Use designation of 1901 Lake Valentine Road, the former First Student Bus Garage, from Low Density Residential to Public and Institutional in the 2040 land use plan. This property will be used for high school student and staff parking. City of Arden Hills City Council Meeting for May 23, 2019 P:\Planning\Planning Cases\2018\PC 18-014 - Mounds View School District - 1900 & 1901 Lake Valentine Road\Memos Reports\CC Memo_05- 13-2019_18-014.docx Page 2 of 7 Recommendation: The Planning Commission reviewed this application at their May 8, 2019 meeting. At that time they recommended approval of Mounds View Public Schools application for a Master and Final Planned Unit Development for Mounds View High School by a 5-0 vote. Council shall consider: 1. Comprehensive Plan Amendment a. Adopt a motion approving the 2040 Comprehensive Plan Amendment from Low Density Residential designation to the Public and Institutional designation via the resolution 2019- 018. The 2040 Comprehensive Plan Amendment is subject to approval by the Metropolitan Council 2. Master and Final Planned Unit Development a. Adopt a motion approving the Master and Final Planned Unit Development with all approvals subject to the following conditions: 1. The project shall be completed in accordance with the plans submitted as amended by the conditions of approval. Any significant changes to the plans, as determined by the City Planner, shall require review and approval by the Planning Commission and City Council. 2. Prior to the issuance of a Grading and Erosion Control permit, the Applicant shall enter into a PUD Development Agreement with the City. The Development Agreement shall outline conditions of approval, required securities and fees, and sequence of events. 3. A letter of credit equal to or 125% of the cost of the required landscaping must be submitted to the City prior to issuance of a Grading and Erosion Control permit. 4. Prior to the issuance of a Grading and Erosion Control permit, staff shall review and approve the final landscaping plan. 5. Prior to the issuance of a Grading and Erosion Control permit, the Applicant shall determine if they will be adding 562 caliper inches of additional trees on the site, off-site or provide cash in lieu of replacement. 6. A Site Plan Review application shall be required for the reconstruction of the parking lot on PID 21302334005. 7. Any use of the existing building on the on PID 21302334005 other than cold storage will require an amendment to the approved PUD. The existing structure shall comply with City Code Chapter 14 and any other use of the building shall meet all applicable codes. 8. Overnight vehicle storage is prohibited. All overnight vehicle storage shall be stored in indoors. 9. No exterior storage shall be permitted onsite. 10. All light poles shall be a maximum of 25 feet in height, including base, and shall be shoebox style, downward directed, with high-pressure sodium or LED lamps and flush lens. Other than wash or architectural lighting, attached security lighting shall be shoebox City of Arden Hills City Council Meeting for May 23, 2019 P:\Planning\Planning Cases\2018\PC 18-014 - Mounds View School District - 1900 & 1901 Lake Valentine Road\Memos Reports\CC Memo_05- 13-2019_18-014.docx Page 3 of 7 style, downward directed with flush lens. In addition, any entry lighting under canopies shall be recessed and use a flush lens. Shields shall also be added as directed by the City. 11. All rooftop or ground mounted mechanical equipment shall be hidden from view with the same materials used on the building in accordance with City Code requirements. 12. Prior to the issuance of a Grading and Erosion Control permit, trees or tree areas that are to be preserved shall be visibly marked and City-approved tree protection fencing or other methods shall be installed and maintained at the critical root zones of the trees to be protected. The location of the fencing shall be in conformance with the approved tree preservation plan and approved by staff in writing. 13. The Applicant shall be responsible for obtaining any other permits necessary from other agencies, MPCA, Rice Creek Watershed District, etc. prior to the start of any site activities. 14. All disturbed boulevards shall be restored with sod. 15. The Applicant shall be responsible for protecting the proposed on-site storm sewer infrastructure and components and any existing storm sewer from exposure to any and all stormwater runoff, sediments and debris during all construction activities. Temporary stormwater facilities shall be installed to protect the quality aspect of the proposed and existing stormwater facilities prior to and during construction activities. Maintenance of any and all temporary stormwater facilities shall be the responsibility of the Applicant. 16. The Applicant shall be responsible for obtaining a land disturbance Grading and Erosion Control permit from the City’s Engineering Division prior to the commencement of any land disturbance activities. 17. Heavy duty silt fence and adequate erosion control around the entire construction site shall be required and maintained by the Developer during construction to ensure that sediment and storm water does not leave the project site. 18. Prior to the beginning of the 2019-2020 school year, the Applicant shall stripe a minimum of 334 parking stalls in parking lot located on PID 213023340005. Parking stalls dimensions shall be 9 feet by 18 feet. 19. Prior to the issuance of a Grading and Erosion Control permit, the School District shall provide the City in writing how they will staff the pedestrian crossing during student arrival and release. City staff and the Ramsey County Sheriff shall review and approve the pedestrian crossing plan prior to August 1, 2019. The School District shall implement any and all recommendations made by the City and/or the Sheriff prior to the start of the 2019- 2020 school year. 20. Prior to the issuance of a Grading and Erosion Control permit the Engineering Department shall approve the Final grading, utility, stormwater and right of way improvement plans. 21. The Applicant, Ramsey County Sheriff and City staff shall review traffic and pedestrian operations annually. The Applicant shall implement improvements recommended by the City Engineer. 22. Prior to the issuance of a Grading and Erosion Control Permit, all items identified in the March 5, 2019 Engineering Review Comments memo shall be addressed. All comments shall be adopted herein by reference. 23. The proposed mascot wall sign may be externally illumined and shall be approved by Planning staff in writing. Internal illumination is prohibited. The proposed mascot sign City of Arden Hills City Council Meeting for May 23, 2019 P:\Planning\Planning Cases\2018\PC 18-014 - Mounds View School District - 1900 & 1901 Lake Valentine Road\Memos Reports\CC Memo_05- 13-2019_18-014.docx Page 4 of 7 shall not exceed 53 square feet. Final location of the proposed mascot wall sign shall be approved in writing by Planning staff. 24. Findings and recommendations of the March 19, 2019 Traffic memo from Wenck shall be implemented. 25. A Planned Unit Development Agreement shall be fully executed prior to the prior to the issuance of a Grading and Erosion Control Permit. 26. The Applicant shall be financially responsible for 100 percent of all Lake Valentine Road street improvements. These improvements include but shall not be limited to: turn lanes and other access improvements, trail and sidewalk improvements, pedestrian signal, signage and striping modifications, and drainage and utility improvements. The City’s engineering consultant will design construction plans and specifications. These charges will be identified in the Planned Unit Development Agreement. 27. The Applicant shall preform an analysis of how many trees the parking lot and surrounding land on PID 21302334005 can accommodate and reserve the said number of trees from 562 caliper inches required to be replaced. 28. After site grading has been completed, the Applicant shall work with the adjacent property owners to ensure any screening concerns are addressed. Any trees planted shall count towards the 562 caliper inches required to be replaced. Motion Language Option Staff has provided the following motion language options for the City Council to consider. The recommended action by the Planning Commission is for approval with the 28 conditions in the May 13, 2019, Report to the City Council. 1. Approve with Conditions: Motion to approve Planning Case 18-014 for a Comprehensive Plan Amendment and a Master and Final PUD at 1900 Lake Valentine Road, based on the findings of fact and submitted plans, as amended by the conditions in the May 13, 2019, Report to the City Council, and authorize the Mayor and City Administrator to execute the Planned Unit Development Agreement subject to the listed conditions. Four affirmative votes are required to approve the PUD Master Plan. 2. Approve without Conditions: Motion to approve Planning Case 18-014 for a Comprehensive Plan Amendment and a Master and Final PUD at 1900 and 1901 Lake Valentine Road, based on the findings of fact and submitted plans in the May 13, 2019, Report to the Council. Four affirmative votes are required to approve the PUD Master Plan, and authorize the Mayor and City Administrator to execute the Planned Unit Development Agreement subject to the listed conditions. 3. Deny: Motion to deny Planning Case 18-014 for a Comprehensive Plan Amendment and a Master and Final PUD at 1900 and 1901 Lake Valentine Road based on the following findings of fact: findings to deny should specifically reference the reasons for denial and why those reasons cannot be mitigated. City of Arden Hills City Council Meeting for May 23, 2019 P:\Planning\Planning Cases\2018\PC 18-014 - Mounds View School District - 1900 & 1901 Lake Valentine Road\Memos Reports\CC Memo_05- 13-2019_18-014.docx Page 5 of 7 4. Table: Motion to table Planning Case 18-014 for a Comprehensive Plan Amendment and a Master and Final PUD at 1900 and 1901 Lake Valentine Road for the following reasons: a specific reason and/or information request should be included with a motion to table. Background The last major addition to the high school occurred in 2000 when the track and field stadium was reconstructed and additions were made to the main entrance, auditorium, orchestra/choir area, storage, computer lab, staff dining area, woodshop, and classrooms. The Applicant is proposing an addition totaling 76,300 square feet, including 49,000 square feet for gymnasiums and 27,300 square feet for a total of seven classrooms. Interior remodels of the existing building include 65,000 square feet. The subject property is located at 1900 Lake Valentine Road. The Applicant recently acquired the former First Student school bus garage located directly north of the high school at 1901 Lake Valentine Road. The Applicant is proposing to repave and restripe the parking lot for more efficient car parking. The existing building on the site will be used for cold storage. If they receive City approval, construction of the new additions will begin in May, 2019, with completion expected in fall of 2020. Renovations or changes to the north parking lot will occur at a later time, still to be determined. Findings of Fact The City Council must make a finding as to whether or not the proposed application would adversely affect the surrounding neighborhood or the community as a whole based on the aforementioned factors. The Planning Commission reviewed Planning Case 18-014 at their City of Arden Hills City Council Meeting for May 23, 2019 P:\Planning\Planning Cases\2018\PC 18-014 - Mounds View School District - 1900 & 1901 Lake Valentine Road\Memos Reports\CC Memo_05- 13-2019_18-014.docx Page 6 of 7 regular meeting on May 8, 2019. The Planning Commission offers the following findings of fact for consideration: 1. The property located at 1900 Lake Valentine Road is designed for Public and Institutional uses on the 2040 Land Use Plan map. 2. The property located at 1901 Lake Valentine Road is designated for Low Densit y Residential uses on the 2040 Land Use Plan map. 3. The properties located at 1900 and 1901 Lake Valentine Road are located in the R-1 Single Family Residential District. 4. The R-1 district is consistent with the existing and proposed Public and Institutional designation. 5. The Applicant has proposed a Master Planned Unit Development in order to include noncontiguous parcels as a single use. Other components of the proposal are classroom and gymnasium additions, reconfiguration of the bus parking lot and the staff and student parking lots, and reconfiguration of athletic fields. 6. The Applicant has submitted a Master and Final Planned Unit Development. 7. The Master PUD is generally consistent with the requirements of the City Code. 8. Where the plan is not in conformance with the City Code, flexibility has been requested by the Applicant and/or conditions have been placed on an approval that would mitigate the nonconformity. 9. Flexibility through the PUD process has been requested in the following areas: planting island coverage, tree replacement, building height, and wall signage. 10. The proposed development plan exceeds the minimum requirements of the City Code in the following areas: lot size, building coverage, landscape coverage, setbacks, street trees, perennials and shrubs, tree selection, lighting, screening, location and number of parking stalls, aesthetics and freestanding signs. 11. The Master PUD is in conformance with the draft Arden Hills 2040 Comprehensive Plan, as proposed to be amended. The properties at 1900 and 1901 Lake Valentine Road are zoned R-1, Single Family Residential. Compatible uses such as educational campuses are also intended for this zoning district. 12. With the applied conditions, the application is not anticipated to create a negative impact on the immediate area or the community as a whole. Public Process Neighborhood Meeting: 02-12-19 Public Hearing Notice Published: 3-20-19 Planning Commission Meeting Notification: 3-20-19 Planning Commission – 4-3-19 Public Hearing Notice Published: 4-24-19 Planning Commission Meeting Notification: 04-24-19 Neighborhood Meeting: 04-30-19 Public Hearing Notice Published (CC): 5-01-19 Planning Commission – 5-8-19 City of Arden Hills City Council Meeting for May 23, 2019 P:\Planning\Planning Cases\2018\PC 18-014 - Mounds View School District - 1900 & 1901 Lake Valentine Road\Memos Reports\CC Memo_05- 13-2019_18-014.docx Page 7 of 7 Deadline for Agency Actions The City of Arden Hills received the completed application for this request on April 24, 2019. Pursuant to Minnesota State Statute, the City must act on this request by June 22, 2019 (60 days), unless the City provides the petitioner with written reasons for an additional 60 day review period. The City may, with the consent of the applicant, extend the review period beyond the initial 120 days. Attachments A. Resolution 2019-018 – Comprehensive Plan Amendment See Agenda Item 9A for supporting attachment documents. CITY OF ARDEN HILLS COUNTY OF RAMSEY STATE OF MINNESOTA RESOLUTION NO. 2019-018 RESOLUTION AUTHORIZING THE SUBMITTAL OF THE COMPREHENSIVE PLAN AMENDMENT FOR MOUNDS VIEW SCHOOL DISTRICT AT 1901 LAKE VALENTINE ROAD TO THE METROPOLITAN COUNCIL FOR REVIEW WHEREAS, the Arden Hills 2040 Comprehensive Plan was adopted by the City Council on January 14, 2019; and WHEREAS, on May 13, 2019, the City Council considered an application from Mounds View School District for an amendment to the Arden Hills 2040 Comprehensive Plan to change the future land use designation of the property located at 1901 Lake Valentine Road from Very Low Density Residential to Public and Institutional; and WHEREAS, on May 13, 2019, the City Council approved the proposed Comprehensive Plan Amendment application for Mounds View School District at 1901 Lake Valentine Road, subject to review by the Metropolitan Council pursuant to Minnesota Statutes §473.864; and NOW THERE, BE IT RESOLVED BY THE CITY COUNCIL OF ARDEN HILLS, MINNESOTA, AS FOLLOWS: 1. City Staff is directed to submit the Comprehensive Plan Amendment Application for Mounds View School District at 1901 Lake Valentine Road the Metropolitan Council for review. ADOPTED this 13th day of May, 2019, by the City Council of the City of Arden Hills. CITY OF ARDEN HILLS By: ________________________________ David Grant, Mayor ATTEST: Julie Hanson, City Clerk