Loading...
The URL can be used to link to this page
Your browser does not support the video tag.
Home
My WebLink
About
09-28-2020-R
APPROVAL OF AGENDA PUBLIC INQUIRIES/INFORMATIONAL This is an opportunity for citizens to bring to the Council ’s attention any items not currently on the agenda which are relevant to the City. In addressing the Council, you must first state your name and address for the record. To allow adequate time for each person wishing to address the Council, speakers must limit their comments to three (3) minutes. Written documents may be distributed to the Council prior to the meeting to allow a more timely presentation. Speakers should not use obscene, profane, or threatening language, or make personal attacks. Matters of litigation involving the City shall not be discussed during Public Inquiry by citizens or Council. The Council may not respond to speaker comments, engage in a debate, or take any action on the issues raised by citizens, but may direct City staff to research or follow up on an issue, if desired by Council. If Council directs further review by staff, the results of that review will be presented at a following regular Council meeting. RESPONSE TO PUBLIC INQUIRIES PUBLIC PRESENTATIONS Legislative Update State Senator Jason Isaacson MEMO.PDF STAFF COMMENTS COVID -19 Update Dave Perrault, City Administrator MEMO.PDF Transportation Update Todd Blomstrom, Public Works Director/City Engineer MEMO.PDF APPROVAL OF MINUTES August 24, 2020 Special City Council Executive Session (Closed) 08 -24 -20 -SEC.PDF August 24, 2020 Regular City Council 08 -24 -20 -R.PDF CONSENT CALENDAR Those items listed under the Consent Calendar are considered to be routine by the City Council and will be enacted by one motion under a Consent Calendar format. There will be no separate discussion of these items, unless a Councilmember so requests, in which event, the item will be removed from the general order of business and considered separately in its normal sequence on the agenda. Motion To Approve Claims And Payroll Gayle Bauman, Finance Director Pang Silseth, Accounting Analyst MEMO.PDF Motion To Approve Transferring Fund Balance From General Fund To Capital Funds Gayle Bauman, Finance Director MEMO.PDF Motion To Approve North Suburban Access Corporation (NSAC) Professional And Technical Services Agreement Dave Perrault, City Administrator MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF Motion To Approve Payment No. 5 –Bituminous Roadways –Tennis Court Improvements At Cummings And Royal Hills Parks Todd Blomstrom, Public Works Director/City Engineer MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF Motion To Approve Resolution 2020 -043 Authorizing Application To MnDOT Metro Standalone Noise Barrier Program Todd Blomstrom, Public Works Director/City Engineer MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF Motion To Approve Revisions To The Snowplowing, Snow Removal And Ice Control Policy Todd Blomstrom, Public Works Director/City Engineer MEMO.PDF ATTACHMENT A.PDF Motion To Approve Professional Services Agreement With HR Green For Risk & Resilience Assessment Todd Blomstrom, Public Works Director/City Engineer MEMO.PDF ATTACHMENT A.PDF Motion To Approve Planning Case 20 -018 –Final Plat –3246 New Brighton Road Mike Mrosla, Community Development Manager/City Planner MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF ATTACHMENT C.PDF ATTACHMENT D.PDF ATTACHMENT E.PDF Motion To Approve Planning Cases 19 -001 And 19 -021 –Development Agreement -Brausen Family Automotive Repair –1310 W County Road E Mike Mrosla, Community Development Manager/City Planner MEMO.PDF ATTACHMENT A.PDF PULLED CONSENT ITEMS Those items that are pulled from the Consent Calendar will be removed from the general order of business and considered separately in its normal sequence on the agenda. PUBLIC HEARINGS Quarterly Special Assessments For Delinquent Utilities Gayle Bauman, Finance Director Mary Tomnitz, Accounting Clerk MEMO.PDF Planning Case 20 -010 –Master Planned Unit Development, Conditional Use Permit, Site Plan And Preliminary/Final Plat –Scannell Properties –4200 Round Lake Road Mike Mrosla, Community Development Manager/City Planner MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF ATTACHMENT C.PDF ATTACHMENT D.PDF ATTACHMENT E.PDF ATTACHMENT F.PDF ATTACHMENT G.PDF NEW BUSINESS Resolution 2020 -044 Adopting And Confirming Quarterly Special Assessments For Delinquent Utilities Gayle Bauman, Finance Director Mary Tomnitz, Accounting Clerk MEMO.PDF ATTACHMENT A.PDF Resolution 2020 -045 Planning Case 20 -010 –Master Planned Unit Development, Conditional Use Permit, Site Plan And Preliminary/Final Plat –Scannell Properties –4200 Round Lake Road Mike Mrosla, Community Develoment Manager/City Planner MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF Resolution 2020 -046 To Amend The Program Parameters And Reopen The Application Submittal Period For Small Business Emergency Assistance Grant Program Mike Mrosla, Community Development Manager/City Planner MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF UNFINISHED BUSINESS COUNCIL/STAFF COMMENTS ADJOURN Mayor: David Grant Councilmembers: Brenda Holden Fran Holmes Dave McClung Steve Scott Regular City Council Agenda September 28, 2020 7:00 p.m. City Hall Address: 1245 W Highway 96 Arden Hills MN 55112 Phone: 651 -792 -7800 Website : www.cityofardenhills.org City Vision Arden Hills is a strong community that values its unique environmental setting, strong residential neighborhoods, vital business community, well -maintained infrastructure, fiscal soundness, and our long -standing tradition as a desirable City in which to live, work, and play. This meeting can be accessed remotely by joining via Zoom T o join the Zoom Meeting via your computer, click this link (or copy and paste it into a new browser): https://us02web.zoom.us/j/82166709160 This meeting will be streamed live on local Cable Channel 16 and available for playback on our website. CALL TO ORDER 1. 2. 3. 4. 4.A. Documents: 5. 5.A. Documents: 5.B. Documents: 6. 6.A. Documents: 6.B. Documents: 7. 7.A. Documents: 7.B. Documents: 7.C. Documents: 7.D. Documents: 7.E. Documents: 7.F. Documents: 7.G. Documents: 7.H. Documents: 7.I. Documents: 8. 9. 9.A. Documents: 9.B. Documents: 10. 10.A. Documents: 10.B. Documents: 10.C. Documents: 11. 12. APPROVAL OF AGENDAPUBLIC INQUIRIES/INFORMATIONALThis is an opportunity for citizens to bring to the Council ’s attention any items not currently on the agenda which are relevant to the City. In addressing the Council, you must first state your name and address for the record. To allow adequate time for each person wishing to address the Council, speakers must limit their comments to three (3) minutes. Written documents may be distributed to the Council prior to the meeting to allow a more timely presentation. Speakers should not use obscene, profane, or threatening language, or make personal attacks. Matters of litigation involving the City shall not be discussed during Public Inquiry by citizens or Council. The Council may not respond to speaker comments, engage in a debate, or take any action on the issues raised by citizens, but may direct City staff to research or follow up on an issue, if desired by Council. If Council directs further review by staff, the results of that review will be presented at a following regular Council meeting.RESPONSE TO PUBLIC INQUIRIESPUBLIC PRESENTATIONSLegislative UpdateState Senator Jason Isaacson MEMO.PDF STAFF COMMENTS COVID -19 Update Dave Perrault, City Administrator MEMO.PDF Transportation Update Todd Blomstrom, Public Works Director/City Engineer MEMO.PDF APPROVAL OF MINUTES August 24, 2020 Special City Council Executive Session (Closed) 08 -24 -20 -SEC.PDF August 24, 2020 Regular City Council 08 -24 -20 -R.PDF CONSENT CALENDAR Those items listed under the Consent Calendar are considered to be routine by the City Council and will be enacted by one motion under a Consent Calendar format. There will be no separate discussion of these items, unless a Councilmember so requests, in which event, the item will be removed from the general order of business and considered separately in its normal sequence on the agenda. Motion To Approve Claims And Payroll Gayle Bauman, Finance Director Pang Silseth, Accounting Analyst MEMO.PDF Motion To Approve Transferring Fund Balance From General Fund To Capital Funds Gayle Bauman, Finance Director MEMO.PDF Motion To Approve North Suburban Access Corporation (NSAC) Professional And Technical Services Agreement Dave Perrault, City Administrator MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF Motion To Approve Payment No. 5 –Bituminous Roadways –Tennis Court Improvements At Cummings And Royal Hills Parks Todd Blomstrom, Public Works Director/City Engineer MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF Motion To Approve Resolution 2020 -043 Authorizing Application To MnDOT Metro Standalone Noise Barrier Program Todd Blomstrom, Public Works Director/City Engineer MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF Motion To Approve Revisions To The Snowplowing, Snow Removal And Ice Control Policy Todd Blomstrom, Public Works Director/City Engineer MEMO.PDF ATTACHMENT A.PDF Motion To Approve Professional Services Agreement With HR Green For Risk & Resilience Assessment Todd Blomstrom, Public Works Director/City Engineer MEMO.PDF ATTACHMENT A.PDF Motion To Approve Planning Case 20 -018 –Final Plat –3246 New Brighton Road Mike Mrosla, Community Development Manager/City Planner MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF ATTACHMENT C.PDF ATTACHMENT D.PDF ATTACHMENT E.PDF Motion To Approve Planning Cases 19 -001 And 19 -021 –Development Agreement -Brausen Family Automotive Repair –1310 W County Road E Mike Mrosla, Community Development Manager/City Planner MEMO.PDF ATTACHMENT A.PDF PULLED CONSENT ITEMS Those items that are pulled from the Consent Calendar will be removed from the general order of business and considered separately in its normal sequence on the agenda. PUBLIC HEARINGS Quarterly Special Assessments For Delinquent Utilities Gayle Bauman, Finance Director Mary Tomnitz, Accounting Clerk MEMO.PDF Planning Case 20 -010 –Master Planned Unit Development, Conditional Use Permit, Site Plan And Preliminary/Final Plat –Scannell Properties –4200 Round Lake Road Mike Mrosla, Community Development Manager/City Planner MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF ATTACHMENT C.PDF ATTACHMENT D.PDF ATTACHMENT E.PDF ATTACHMENT F.PDF ATTACHMENT G.PDF NEW BUSINESS Resolution 2020 -044 Adopting And Confirming Quarterly Special Assessments For Delinquent Utilities Gayle Bauman, Finance Director Mary Tomnitz, Accounting Clerk MEMO.PDF ATTACHMENT A.PDF Resolution 2020 -045 Planning Case 20 -010 –Master Planned Unit Development, Conditional Use Permit, Site Plan And Preliminary/Final Plat –Scannell Properties –4200 Round Lake Road Mike Mrosla, Community Develoment Manager/City Planner MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF Resolution 2020 -046 To Amend The Program Parameters And Reopen The Application Submittal Period For Small Business Emergency Assistance Grant Program Mike Mrosla, Community Development Manager/City Planner MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF UNFINISHED BUSINESS COUNCIL/STAFF COMMENTS ADJOURN Mayor:David Grant Councilmembers:Brenda Holden Fran HolmesDave McClungSteve Scott Regular City Council AgendaSeptember 28, 20207:00 p.m. City Hall Address:1245 W Highway 96 Arden Hills MN 55112 Phone:651 -792 -7800 Website : www.cityofardenhills.org City VisionArden Hills is a strong community that values its unique environmental setting, strong residential neighborhoods, vital business community, well -maintained infrastructure, fiscal soundness, and our long -standing tradition as a desirable City in which to live, work, and play.This meeting can be accessed remotely by joining via ZoomTo join the Zoom Meeting via your computer, click this link (or copy and paste it into a new browser): https://us02web.zoom.us/j/82166709160This meeting will be streamed live on local Cable Channel 16 and available for playback on our website.CALL TO ORDER1.2.3.4.4.A.Documents: 5. 5.A. Documents: 5.B. Documents: 6. 6.A. Documents: 6.B. Documents: 7. 7.A. Documents: 7.B. Documents: 7.C. Documents: 7.D. Documents: 7.E. Documents: 7.F. Documents: 7.G. Documents: 7.H. Documents: 7.I. Documents: 8. 9. 9.A. Documents: 9.B. Documents: 10. 10.A. Documents: 10.B. Documents: 10.C. Documents: 11. 12. APPROVAL OF AGENDAPUBLIC INQUIRIES/INFORMATIONALThis is an opportunity for citizens to bring to the Council ’s attention any items not currently on the agenda which are relevant to the City. In addressing the Council, you must first state your name and address for the record. To allow adequate time for each person wishing to address the Council, speakers must limit their comments to three (3) minutes. Written documents may be distributed to the Council prior to the meeting to allow a more timely presentation. Speakers should not use obscene, profane, or threatening language, or make personal attacks. Matters of litigation involving the City shall not be discussed during Public Inquiry by citizens or Council. The Council may not respond to speaker comments, engage in a debate, or take any action on the issues raised by citizens, but may direct City staff to research or follow up on an issue, if desired by Council. If Council directs further review by staff, the results of that review will be presented at a following regular Council meeting.RESPONSE TO PUBLIC INQUIRIESPUBLIC PRESENTATIONSLegislative UpdateState Senator Jason Isaacson MEMO.PDFSTAFF COMMENTSCOVID-19 UpdateDave Perrault, City Administrator MEMO.PDFTransportation UpdateTodd Blomstrom, Public Works Director/City Engineer MEMO.PDFAPPROVAL OF MINUTESAugust 24, 2020 Special City Council Executive Session (Closed)08 -24 -20 -SEC.PDFAugust 24, 2020 Regular City Council08-24 -20 -R.PDFCONSENT CALENDARThose items listed under the Consent Calendar are considered to be routine by the City Council and will be enacted by one motion under a Consent Calendar format. There will be no separate discussion of these items, unless a Councilmember so requests, in which event, the item will be removed from the general order of business and considered separately in its normal sequence on the agenda.Motion To Approve Claims And PayrollGayle Bauman, Finance DirectorPang Silseth, Accounting Analyst MEMO.PDFMotion To Approve Transferring Fund Balance From General Fund To Capital FundsGayle Bauman, Finance Director MEMO.PDF Motion To Approve North Suburban Access Corporation (NSAC) Professional And Technical Services Agreement Dave Perrault, City Administrator MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF Motion To Approve Payment No. 5 –Bituminous Roadways –Tennis Court Improvements At Cummings And Royal Hills Parks Todd Blomstrom, Public Works Director/City Engineer MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF Motion To Approve Resolution 2020 -043 Authorizing Application To MnDOT Metro Standalone Noise Barrier Program Todd Blomstrom, Public Works Director/City Engineer MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF Motion To Approve Revisions To The Snowplowing, Snow Removal And Ice Control Policy Todd Blomstrom, Public Works Director/City Engineer MEMO.PDF ATTACHMENT A.PDF Motion To Approve Professional Services Agreement With HR Green For Risk & Resilience Assessment Todd Blomstrom, Public Works Director/City Engineer MEMO.PDF ATTACHMENT A.PDF Motion To Approve Planning Case 20 -018 –Final Plat –3246 New Brighton Road Mike Mrosla, Community Development Manager/City Planner MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF ATTACHMENT C.PDF ATTACHMENT D.PDF ATTACHMENT E.PDF Motion To Approve Planning Cases 19 -001 And 19 -021 –Development Agreement -Brausen Family Automotive Repair –1310 W County Road E Mike Mrosla, Community Development Manager/City Planner MEMO.PDF ATTACHMENT A.PDF PULLED CONSENT ITEMS Those items that are pulled from the Consent Calendar will be removed from the general order of business and considered separately in its normal sequence on the agenda. PUBLIC HEARINGS Quarterly Special Assessments For Delinquent Utilities Gayle Bauman, Finance Director Mary Tomnitz, Accounting Clerk MEMO.PDF Planning Case 20 -010 –Master Planned Unit Development, Conditional Use Permit, Site Plan And Preliminary/Final Plat –Scannell Properties –4200 Round Lake Road Mike Mrosla, Community Development Manager/City Planner MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF ATTACHMENT C.PDF ATTACHMENT D.PDF ATTACHMENT E.PDF ATTACHMENT F.PDF ATTACHMENT G.PDF NEW BUSINESS Resolution 2020 -044 Adopting And Confirming Quarterly Special Assessments For Delinquent Utilities Gayle Bauman, Finance Director Mary Tomnitz, Accounting Clerk MEMO.PDF ATTACHMENT A.PDF Resolution 2020 -045 Planning Case 20 -010 –Master Planned Unit Development, Conditional Use Permit, Site Plan And Preliminary/Final Plat –Scannell Properties –4200 Round Lake Road Mike Mrosla, Community Develoment Manager/City Planner MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF Resolution 2020 -046 To Amend The Program Parameters And Reopen The Application Submittal Period For Small Business Emergency Assistance Grant Program Mike Mrosla, Community Development Manager/City Planner MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF UNFINISHED BUSINESS COUNCIL/STAFF COMMENTS ADJOURN Mayor:David Grant Councilmembers:Brenda Holden Fran HolmesDave McClungSteve Scott Regular City Council AgendaSeptember 28, 20207:00 p.m. City Hall Address:1245 W Highway 96 Arden Hills MN 55112 Phone:651 -792 -7800 Website : www.cityofardenhills.org City VisionArden Hills is a strong community that values its unique environmental setting, strong residential neighborhoods, vital business community, well -maintained infrastructure, fiscal soundness, and our long -standing tradition as a desirable City in which to live, work, and play.This meeting can be accessed remotely by joining via ZoomTo join the Zoom Meeting via your computer, click this link (or copy and paste it into a new browser): https://us02web.zoom.us/j/82166709160This meeting will be streamed live on local Cable Channel 16 and available for playback on our website.CALL TO ORDER1.2.3.4.4.A.Documents:5.5.A.Documents:5.B.Documents:6.6.A.Documents:6.B.Documents:7.7.A.Documents:7.B.Documents: 7.C. Documents: 7.D. Documents: 7.E. Documents: 7.F. Documents: 7.G. Documents: 7.H. Documents: 7.I. Documents: 8. 9. 9.A. Documents: 9.B. Documents: 10. 10.A. Documents: 10.B. Documents: 10.C. Documents: 11. 12. APPROVAL OF AGENDAPUBLIC INQUIRIES/INFORMATIONALThis is an opportunity for citizens to bring to the Council ’s attention any items not currently on the agenda which are relevant to the City. In addressing the Council, you must first state your name and address for the record. To allow adequate time for each person wishing to address the Council, speakers must limit their comments to three (3) minutes. Written documents may be distributed to the Council prior to the meeting to allow a more timely presentation. Speakers should not use obscene, profane, or threatening language, or make personal attacks. Matters of litigation involving the City shall not be discussed during Public Inquiry by citizens or Council. The Council may not respond to speaker comments, engage in a debate, or take any action on the issues raised by citizens, but may direct City staff to research or follow up on an issue, if desired by Council. If Council directs further review by staff, the results of that review will be presented at a following regular Council meeting.RESPONSE TO PUBLIC INQUIRIESPUBLIC PRESENTATIONSLegislative UpdateState Senator Jason Isaacson MEMO.PDFSTAFF COMMENTSCOVID-19 UpdateDave Perrault, City Administrator MEMO.PDFTransportation UpdateTodd Blomstrom, Public Works Director/City Engineer MEMO.PDFAPPROVAL OF MINUTESAugust 24, 2020 Special City Council Executive Session (Closed)08 -24 -20 -SEC.PDFAugust 24, 2020 Regular City Council08-24 -20 -R.PDFCONSENT CALENDARThose items listed under the Consent Calendar are considered to be routine by the City Council and will be enacted by one motion under a Consent Calendar format. There will be no separate discussion of these items, unless a Councilmember so requests, in which event, the item will be removed from the general order of business and considered separately in its normal sequence on the agenda.Motion To Approve Claims And PayrollGayle Bauman, Finance DirectorPang Silseth, Accounting Analyst MEMO.PDFMotion To Approve Transferring Fund Balance From General Fund To Capital FundsGayle Bauman, Finance Director MEMO.PDFMotion To Approve North Suburban Access Corporation (NSAC) Professional And Technical Services AgreementDave Perrault, City Administrator MEMO.PDFATTACHMENT A.PDFATTACHMENT B.PDFMotion To Approve Payment No. 5 –Bituminous Roadways –Tennis Court Improvements At Cummings And Royal Hills ParksTodd Blomstrom, Public Works Director/City Engineer MEMO.PDFATTACHMENT A.PDFATTACHMENT B.PDFMotion To Approve Resolution 2020 -043 Authorizing Application To MnDOT Metro Standalone Noise Barrier ProgramTodd Blomstrom, Public Works Director/City Engineer MEMO.PDFATTACHMENT A.PDFATTACHMENT B.PDFMotion To Approve Revisions To The Snowplowing, Snow Removal And Ice Control PolicyTodd Blomstrom, Public Works Director/City Engineer MEMO.PDFATTACHMENT A.PDFMotion To Approve Professional Services Agreement With HR Green For Risk & Resilience AssessmentTodd Blomstrom, Public Works Director/City Engineer MEMO.PDFATTACHMENT A.PDFMotion To Approve Planning Case 20 -018 –Final Plat –3246 New Brighton Road Mike Mrosla, Community Development Manager/City Planner MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF ATTACHMENT C.PDF ATTACHMENT D.PDF ATTACHMENT E.PDF Motion To Approve Planning Cases 19 -001 And 19 -021 –Development Agreement -Brausen Family Automotive Repair –1310 W County Road E Mike Mrosla, Community Development Manager/City Planner MEMO.PDF ATTACHMENT A.PDF PULLED CONSENT ITEMS Those items that are pulled from the Consent Calendar will be removed from the general order of business and considered separately in its normal sequence on the agenda. PUBLIC HEARINGS Quarterly Special Assessments For Delinquent Utilities Gayle Bauman, Finance Director Mary Tomnitz, Accounting Clerk MEMO.PDF Planning Case 20 -010 –Master Planned Unit Development, Conditional Use Permit, Site Plan And Preliminary/Final Plat –Scannell Properties –4200 Round Lake Road Mike Mrosla, Community Development Manager/City Planner MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF ATTACHMENT C.PDF ATTACHMENT D.PDF ATTACHMENT E.PDF ATTACHMENT F.PDF ATTACHMENT G.PDF NEW BUSINESS Resolution 2020 -044 Adopting And Confirming Quarterly Special Assessments For Delinquent Utilities Gayle Bauman, Finance Director Mary Tomnitz, Accounting Clerk MEMO.PDF ATTACHMENT A.PDF Resolution 2020 -045 Planning Case 20 -010 –Master Planned Unit Development, Conditional Use Permit, Site Plan And Preliminary/Final Plat –Scannell Properties –4200 Round Lake Road Mike Mrosla, Community Develoment Manager/City Planner MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF Resolution 2020 -046 To Amend The Program Parameters And Reopen The Application Submittal Period For Small Business Emergency Assistance Grant Program Mike Mrosla, Community Development Manager/City Planner MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF UNFINISHED BUSINESS COUNCIL/STAFF COMMENTS ADJOURN Mayor:David Grant Councilmembers:Brenda Holden Fran HolmesDave McClungSteve Scott Regular City Council AgendaSeptember 28, 20207:00 p.m. City Hall Address:1245 W Highway 96 Arden Hills MN 55112 Phone:651 -792 -7800 Website : www.cityofardenhills.org City VisionArden Hills is a strong community that values its unique environmental setting, strong residential neighborhoods, vital business community, well -maintained infrastructure, fiscal soundness, and our long -standing tradition as a desirable City in which to live, work, and play.This meeting can be accessed remotely by joining via ZoomTo join the Zoom Meeting via your computer, click this link (or copy and paste it into a new browser): https://us02web.zoom.us/j/82166709160This meeting will be streamed live on local Cable Channel 16 and available for playback on our website.CALL TO ORDER1.2.3.4.4.A.Documents:5.5.A.Documents:5.B.Documents:6.6.A.Documents:6.B.Documents:7.7.A.Documents:7.B.Documents:7.C.Documents:7.D.Documents:7.E.Documents:7.F.Documents:7.G.Documents:7.H. Documents: 7.I. Documents: 8. 9. 9.A. Documents: 9.B. Documents: 10. 10.A. Documents: 10.B. Documents: 10.C. Documents: 11. 12. APPROVAL OF AGENDAPUBLIC INQUIRIES/INFORMATIONALThis is an opportunity for citizens to bring to the Council ’s attention any items not currently on the agenda which are relevant to the City. In addressing the Council, you must first state your name and address for the record. To allow adequate time for each person wishing to address the Council, speakers must limit their comments to three (3) minutes. Written documents may be distributed to the Council prior to the meeting to allow a more timely presentation. Speakers should not use obscene, profane, or threatening language, or make personal attacks. Matters of litigation involving the City shall not be discussed during Public Inquiry by citizens or Council. The Council may not respond to speaker comments, engage in a debate, or take any action on the issues raised by citizens, but may direct City staff to research or follow up on an issue, if desired by Council. If Council directs further review by staff, the results of that review will be presented at a following regular Council meeting.RESPONSE TO PUBLIC INQUIRIESPUBLIC PRESENTATIONSLegislative UpdateState Senator Jason Isaacson MEMO.PDFSTAFF COMMENTSCOVID-19 UpdateDave Perrault, City Administrator MEMO.PDFTransportation UpdateTodd Blomstrom, Public Works Director/City Engineer MEMO.PDFAPPROVAL OF MINUTESAugust 24, 2020 Special City Council Executive Session (Closed)08 -24 -20 -SEC.PDFAugust 24, 2020 Regular City Council08-24 -20 -R.PDFCONSENT CALENDARThose items listed under the Consent Calendar are considered to be routine by the City Council and will be enacted by one motion under a Consent Calendar format. There will be no separate discussion of these items, unless a Councilmember so requests, in which event, the item will be removed from the general order of business and considered separately in its normal sequence on the agenda.Motion To Approve Claims And PayrollGayle Bauman, Finance DirectorPang Silseth, Accounting Analyst MEMO.PDFMotion To Approve Transferring Fund Balance From General Fund To Capital FundsGayle Bauman, Finance Director MEMO.PDFMotion To Approve North Suburban Access Corporation (NSAC) Professional And Technical Services AgreementDave Perrault, City Administrator MEMO.PDFATTACHMENT A.PDFATTACHMENT B.PDFMotion To Approve Payment No. 5 –Bituminous Roadways –Tennis Court Improvements At Cummings And Royal Hills ParksTodd Blomstrom, Public Works Director/City Engineer MEMO.PDFATTACHMENT A.PDFATTACHMENT B.PDFMotion To Approve Resolution 2020 -043 Authorizing Application To MnDOT Metro Standalone Noise Barrier ProgramTodd Blomstrom, Public Works Director/City Engineer MEMO.PDFATTACHMENT A.PDFATTACHMENT B.PDFMotion To Approve Revisions To The Snowplowing, Snow Removal And Ice Control PolicyTodd Blomstrom, Public Works Director/City Engineer MEMO.PDFATTACHMENT A.PDFMotion To Approve Professional Services Agreement With HR Green For Risk & Resilience AssessmentTodd Blomstrom, Public Works Director/City Engineer MEMO.PDFATTACHMENT A.PDFMotion To Approve Planning Case 20 -018 –Final Plat –3246 New Brighton Road Mike Mrosla, Community Development Manager/City Planner MEMO.PDFATTACHMENT A.PDFATTACHMENT B.PDFATTACHMENT C.PDFATTACHMENT D.PDFATTACHMENT E.PDFMotion To Approve Planning Cases 19 -001 And 19 -021 –Development Agreement -Brausen Family Automotive Repair –1310 W County Road EMike Mrosla, Community Development Manager/City Planner MEMO.PDFATTACHMENT A.PDFPULLED CONSENT ITEMSThose items that are pulled from the Consent Calendar will be removed from the general order of business and considered separately in its normal sequence on the agenda.PUBLIC HEARINGSQuarterly Special Assessments For Delinquent UtilitiesGayle Bauman, Finance DirectorMary Tomnitz, Accounting Clerk MEMO.PDFPlanning Case 20 -010 –Master Planned Unit Development, Conditional Use Permit, Site Plan And Preliminary/Final Plat –Scannell Properties –4200 Round Lake RoadMike Mrosla, Community Development Manager/City Planner MEMO.PDFATTACHMENT A.PDFATTACHMENT B.PDFATTACHMENT C.PDFATTACHMENT D.PDFATTACHMENT E.PDFATTACHMENT F.PDFATTACHMENT G.PDFNEW BUSINESS Resolution 2020 -044 Adopting And Confirming Quarterly Special Assessments For Delinquent Utilities Gayle Bauman, Finance Director Mary Tomnitz, Accounting Clerk MEMO.PDF ATTACHMENT A.PDF Resolution 2020 -045 Planning Case 20 -010 –Master Planned Unit Development, Conditional Use Permit, Site Plan And Preliminary/Final Plat –Scannell Properties –4200 Round Lake Road Mike Mrosla, Community Develoment Manager/City Planner MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF Resolution 2020 -046 To Amend The Program Parameters And Reopen The Application Submittal Period For Small Business Emergency Assistance Grant Program Mike Mrosla, Community Development Manager/City Planner MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF UNFINISHED BUSINESS COUNCIL/STAFF COMMENTS ADJOURN Mayor:David Grant Councilmembers:Brenda Holden Fran HolmesDave McClungSteve Scott Regular City Council AgendaSeptember 28, 20207:00 p.m. City Hall Address:1245 W Highway 96 Arden Hills MN 55112 Phone:651 -792 -7800 Website : www.cityofardenhills.org City VisionArden Hills is a strong community that values its unique environmental setting, strong residential neighborhoods, vital business community, well -maintained infrastructure, fiscal soundness, and our long -standing tradition as a desirable City in which to live, work, and play.This meeting can be accessed remotely by joining via ZoomTo join the Zoom Meeting via your computer, click this link (or copy and paste it into a new browser): https://us02web.zoom.us/j/82166709160This meeting will be streamed live on local Cable Channel 16 and available for playback on our website.CALL TO ORDER1.2.3.4.4.A.Documents:5.5.A.Documents:5.B.Documents:6.6.A.Documents:6.B.Documents:7.7.A.Documents:7.B.Documents:7.C.Documents:7.D.Documents:7.E.Documents:7.F.Documents:7.G.Documents:7.H.Documents:7.I.Documents:8.9.9.A.Documents:9.B.Documents:10. 10.A. Documents: 10.B. Documents: 10.C. Documents: 11. 12. DATE: September 28, 2020 TO: Honorable Mayor and City Councilmembers FROM: Dave Perrault, City Administrator SUBJECT: Legislative Update – Senator Jason Isaacson Budgeted Amount: Estimated Amount: Funding Source: N/A N/A N/A Council Should Consider Senator Jason Isaacson will be present to provide a legislative update to the City Council. PUBLIC PRESENTATIONS – 4A MEMORANDUM Page 1 of 1 STAFF COMMENTS – 5A MEMORANDUM DATE: TO: FROM: September 28, 2020 Honorable Mayor and City Councilmembers Dave Perrault, City Administrator SUBJECT: COVID-19 Update Budgeted Amount: Actual Amount: Funding Source: $ $ $ A verbal update will be provided at the City Council meeting. Page 1 of 1 STAFF COMMENTS – 5B MEMORANDUM DATE: TO: FROM: September 28, 2020 Honorable Mayor and City Councilmembers Dave Perrault, City Administrator Todd Blomstrom, Public Works Director/City Engineer SUBJECT: Transportation Update Budgeted Amount: Actual Amount: Funding Source: $ $ $ A verbal update will be provided at the City Council meeting. Approved: September 28, 2020 CITY OF ARDEN HILLS, MINNESOTA SPECIAL CITY COUNCIL EXECTUVE SESSION (CLOSED) AUGUST 24, 2020 5:45 P.M. - ARDEN HILLS CITY HALL CALL TO ORDER/ROLL CALL Pursuant to due call and notice thereof, Mayor Grant called to order the Special City Council Executive Session (Closed) at 5:45 p.m. Note: On March 20th, the Mayor signed a determination allowing Councilmembers to participate in City Council meetings via telephone pursuant to State Statute 13D.021 Present via Telephone: Mayor David Grant, Councilmembers Brenda Holden, Fran Holmes, Dave McClung and Steve Scott Absent: None Also present: City Administrator Dave Perrault; Public Works Director/City Engineer Todd Blomstrom; Finance Director Gayle Bauman; Community Development Manager/City Planner Mike Mrosla via telephone: City Attorney Joel Jamnik; and Attorneys John Baker and Samuel Clark, Greene Espel 1.AGENDA ITEMS A.TCAAP Litigation Discussion The City Council received an update from Counsel Baker and Clark and discussed TCAAP litigation. ADJOURN Mayor Grant adjourned the Special City Council Executive Session (Closed) at 6:45 p.m. __________________________ __________________________ Dave Perrault David Grant City Administrator Mayor Approved: September 28, 2020 CITY OF ARDEN HILLS, MINNESOTA REGULAR CITY COUNCIL MEETING AUGUST 24, 2020 7:00 P.M. - ARDEN HILLS CITY COUNCIL CHAMBERS CALL TO ORDER/ROLL CALL Pursuant to due call and notice thereof, Mayor David Grant called to order the regular City Council meeting at 7:00 p.m. Note: On March 20th, the Mayor signed a determination allowing Councilmembers to participate in City Council meetings via telephone pursuant to State Statute 13D.021 Present: Mayor David Grant, Councilmembers Brenda Holden, Fran Holmes, Dave McClung and Steve Scott Absent: None Also present: City Administrator Dave Perrault; Public Works Director/City Engineer Todd Blomstrom; Finance Director Gayle Bauman; Community Development Manager/City Planner Mike Mrosla; Associate Planner Joe Hartmann; City Clerk Julie Hanson and present via telephone: City Attorney Joel Jamnik PLEDGE OF ALLEGIANCE 1. APPROVAL OF AGENDA Councilmember McClung requested the Council allow for the discussion of a Chicken Ordinance as Item 9B. Councilmember Holden requested Item 6H be pulled for the Consent Agenda and be discussed as Item 7A. MOTION: Councilmember Holden moved and Councilmember Holmes seconded a motion to approve the meeting agenda as amended. A roll call vote was taken. The motion carried unanimously (5-0). 2. PUBLIC INQUIRIES/INFORMATIONAL None. ARDEN HILLS CITY COUNCIL – AUGUST 24, 2020 2 3. RESPONSE TO PUBLIC INQUIRIES None. 4. STAFF COMMENTS A. Rice Creek Commons (TCAAP) and Joint Development Authority (JDA) Update City Administrator Perrault provided an update on TCAAP stating litigation with Ramsey County was ongoing. B. COVID-19 Update City Administrator Perrault provided the Council with an update on how the City was responding to COVID-19. He encouraged residents to visit the City’s website for the most current and up to date information regarding COVID-19. He reported the Minnesota Department of Health and CDC also had websites with current guidelines and recommendations. He explained the City of Arden Hills remains in a peacetime state of emergency and City Hall will remain closed until further notice. He indicated City staff remains operational and can be reached via phone or email. He discussed the services being provided by the Ramsey County Help Team and encouraged those in need to contact Ramsey County for assistance. He reported the City Council would be discussing the establishment of a small business emergency assistance grant program later in this meeting. This program would be funded through CARES Act funds. C. Transportation Update Public Works Director/City Engineer Blomstrom provided the Council with an update on the 2020 Street Overlay project. He noted paving was scheduled to begin on Monday, August 31st. Public Works Director/City Engineer Blomstrom provided the Council with an update on the I- 35W MNPASS project and noted the ramp for County Road D to southbound 35W would remain temporarily closed through September. Councilmember Holden asked if Ramsey County would be redoing Lexington Avenue in 2021. Public Works Director/City Engineer Blomstrom explained a final decision has not been made by the County, but he anticipated this project would be pushed off to 2022. 5. APPROVAL OF MINUTES A. July 13, 2020, Special City Council Work Session B. July 23, 2020, Special City Council Work Session C. July 27, 2020, Special City Council Work Session D. July 27, 2020, Regular City Council Councilmember Holmes explained she had a minor correction to the July 27th Regular City Council minutes and noted she discussed this matter with the City Clerk. ARDEN HILLS CITY COUNCIL – AUGUST 24, 2020 3 MOTION: Councilmember Holden moved and Councilmember Holmes seconded a motion to approve the July 13, 2020, Special City Council Work Session meeting minutes, July 23, 2020, Special City Council Work Session meeting minutes, July 27, 2020, Special City Council Work Session meeting minutes; and July 27, 2020, Regular City Council meeting minutes as amended. A roll call vote was taken. The motion carried unanimously (5-0). 6. CONSENT CALENDAR A. Motion to Approve Consent Agenda Item - Claims and Payroll B. Motion to Approve Amendment to North Suburban Communications Commission Joint and Cooperative Agreement C. Motion to Approve Resolution 2020-031 Staying the Date of Enforcement Relating to the Sale of Flavored Tobacco D. Motion to Authorize Appointment of Public Works Maintenance Worker E. Motion to Accept Resignation of Communications Coordinator F. Motion to Authorize Posting Communications Coordinator Position G. Motion to Approve Resolution 2020-032 Accepting Donation from Arden Hills Foundation for Cummings Park Art Larsen Memorial Garden H. Motion to Approve Resolution 2020-033 – Planning Case 20-016 – Minor Subdivision – 3235 Lexington Avenue I. Motion to Approve Resolution 2020-036 Accepting a Joint Powers Agreement with Ramsey County GIS User Group J. Motion to Authorize Professional Services Agreement with TKDA for Trunk Watermain Evaluation Project K. Motion to Authorize Sewer Repairs by Valley Rich Company – Round Lake Road L. Motion to Approve Amended Developers Agreement with Mounds View Public Schools – Mounds View High School Traffic Improvements – Planning Case 18- 014 M. Motion to Approve Final Scope of HVAC Project and Authorize Advertisement for Bids N. Motion to Approve Resolution 2020-034 Authorizing the Lake Johanna Fire Department Three-Cities Agreement and Expenditure of Funds for the City’s Share of Land Acquisition MOTION: Councilmember Holden moved and Councilmember Holmes seconded a motion to approve the Consent Calendar as amended and to authorize execution of all necessary documents contained therein. A roll call vote was taken. The motion carried unanimously (5-0). 7. PULLED CONSENT ITEMS A. Motion to Approve Resolution 2020-033 – Planning Case 20-016 – Minor Subdivision – 3235 Lexington Avenue ARDEN HILLS CITY COUNCIL – AUGUST 24, 2020 4 Associate Planner Hartmann reported Todd Hinz of Summit Design – Build LLC (“Applicant”) has submitted a land use application for a Minor Subdivision to split an existing single-family lot located at 3235 Lexington Avenue into two (2) conforming single-family residential parcels. The Subject Property is zoned in the R-2, Single and Two Family Residential District and is guided as Low Density Residential in the Land Use Plan. The Minor Subdivision is requested to allow for the subdivision of a single parcel located at 3235 Lexington Avenue into two (2) conforming parcels (Parcel A and Parcel B). Parcel B is expected for the development of a new single-family home. Staff commented further on the request, reviewed the Findings of Fact and reported the Planning Commission recommended approval with conditions. Councilmember Holden stated she had concerns with the drainage for these properties. She questioned how the drainage would be addressed. Community Development Manager/City Planner Mrosla reported a grading plan would be reviewed by staff when a building permit application was requested to the City. Councilmember Holmes requested staff address the fact that Shoreline Lane would only go across half of the newly created lot and asked if this would be a concern for emergency vehicles. Community Development Manager/City Planner Mrosla explained the proposed plan has been reviewed by the Lake Johanna Fire Department and there were no concerns. It was noted there was a fire hydrant directly across the street from this lot. Public Works Director/City Engineer Blomstrom commented City right-of-way extends in front of this lot but noted the City does not have an intention of extending this roadway. Councilmember Holmes commented Shoreline Lane was a small concrete street. She questioned if any damage was done to this street if this damage would be assessed to the property owner. Community Development Manager/City Planner Mrosla indicated this was the City’s practice and would be included in an escrow provided via the building permit. Councilmember Holden inquired when the City would consider extending the street. Community Development Manager/City Planner Mrosla commented this could be considered during the minor subdivision phase, but explained a roadway extension was not required at this time. Councilmember Holden asked what would happen if the driveway had to be relocated on the new lot for some reason which required the street to be extended. She stated she wanted to be assured that the City was covered regarding this matter. Public Works Director/City Engineer Blomstrom explained Condition 12 could be added stating: Should the street need to be extended the cost would be 100% the responsibility of the applicant. Mayor Grant stated he supported the inclusion of Condition 12 as recommended by staff. ARDEN HILLS CITY COUNCIL – AUGUST 24, 2020 5 MOTION: Councilmember Holden moved and Councilmember McClung seconded a adopt Resolution 2020-033 approving Planning Case 20-016 for a Minor Subdivision at 3235 Lexington Avenue (“Subject Property”), based on the findings of fact, the submitted plans and the twelve (12) Conditions for Approval in the August 24, 2020 Report to the City Council and as amended here this evening. A roll call vote was taken. The motion carried (5-0). 8. PUBLIC HEARINGS None. 9. NEW BUSINESS A. Resolution 2020-035 Establishing Small Business Emergency Assistance Grant Program in Response to COVID-19 Community Development Manager/City Planner Mrosla stated on June 25 Governor Tim Walz announced a plan to distribute $853 million in federal funding to Minnesota communities impacted by the COVID-19 pandemic. The funding was authorized by the Federal Coronavirus Aid, Relief, and Economic Security (CARES) Act. City funding was calculated on a formula of $75.34 per capita and the amount allocated to the City of Arden Hills totals $745,040. The City submitted its certification form for Coronavirus Relief Fund (CRF) monies on July 6. The funds are now available and the City is required to expend all of its funds by November 15, 2020. Community Development Manager/City Planner Mrosla commented at its August 10, 2020 work session, the City Council and staff discussed establishing a Small Business Emergency Assistance Grant Program in response to the significant challenges currently facing local businesses related to the COVID-19 pandemic. The State of Minnesota and Ramsey County have previously provided funding opportunities to businesses that have been impacted by COVID-19. Due to demand, the programs were oversubscribed and many businesses did not meet eligibility requirements imposed by the various programs. According to City data, Arden Hills has approximately 150 businesses. Ramsey County has provided funding to seven (7) Arden Hills businesses and it is unknown at this time if any local businesses received assistance from the State. Community Development Manager/City Planner Mrosla reported at the direction of the City Council, the City of Arden Hills will make available $150,000.00 of CARES Act Funds to create a Small Business Emergency Assistance Grant Program. The intent of the grant program would be to provide financial assistance to local businesses to help them continue their operations, preserve employment, and prevent business closures in an effort to encourage long-term economic vitality in Arden Hills. The program would provide locally-owned and operated businesses with an emergency grant of up to $5,000. To be eligible to receive a grant, a business must demonstrate loss due to COVID-19 and meet the eligibility requirements and program parameters. Community Development Manager/City Planner Mrosla explained interested business would be asked to complete and submit an application. As part of the application, applicants would also be encouraged to provide proof of application submittal, acceptance, approval and/or denial of ARDEN HILLS CITY COUNCIL – AUGUST 24, 2020 6 state and federal emergency financing programs. Upon a successful grant application being awarded funds, the applicant would be required to sign an acknowledgment agreement under which the applicant agrees to spend the awarded funds on eligible uses. As a condition for receiving grant funding, all grant recipients would be required to submit a brief report documenting how the grant funds were utilized by November 30, 2020. Community Development Manager/City Planner Mrosla stated funds for grants will be distributed on a first-come, first-considered/awarded basis. Applications will be accepted until September 15, 2020 or when all general grant funds are fully committed. Each general grant application will be considered independently in the order received until funding is expended. Once all available funding has been expended, any remaining eligible applications not receiving funding will be held and considered if future funding rounds become available. Staff will report back to the City Council to discuss the feasibility of additional funding opportunities. If approved, staff will finalize the implementation of the new program such as begin promoting the program through emails, the website, and social media. Councilmember Holmes asked if the application form would be similar to the County’s form. Community Development Manager/City Planner Mrosla reported the application would be similar. Councilmember Holmes questioned how the City would get the word out regarding this grant program. Community Development Manager/City Planner Mrosla discussed how the City would advertise this program to the local business community. He reported the business registration list would be utilized noting emails would be sent. Councilmember Holden explained the North Chamber has done a great job advertising the grant opportunities that were available through Ramsey County. She suggested the North Chamber be contacted to promote the City’s program. Mayor Grant supported this recommendation. He suggested the City send a letter and email the local businesses regarding this grant program. Discussion ensued regarding the number of businesses that could be helped through the proposed small business grant program. Mayor Grant asked if funds from these grants could be used for revenue loss. City Administrator Perrault reported these funds could be used to cover expenditures but not revenue losses. Staff provided further comment on the types of expenditures that could be covered by the City’s grant funds. Councilmember McClung commented he supported staff sending letters to the local businesses regarding the grant program. He asked how quickly staff could have a letter drafted and in the mail. ARDEN HILLS CITY COUNCIL – AUGUST 24, 2020 7 Community Development Manager/City Planner Mrosla reported he could have a letter in the mail by Wednesday or Thursday of this week. Councilmember Holden questioned if there would be a way for staff to verify if businesses have already received other grants or Paycheck Protection Program. She stated she wanted the City’s grant funds to go to the businesses that were truly in need. Community Development Manager/City Planner Mrosla reported as part of the application process, the applicants are asked to submit information regarding other grants they have received, whether approved or denied. He explained the City understood that businesses may have applied for multiple grants at one time and may not have heard back on these grants. He noted the City would do its best to take this information into consideration. MOTION: Councilmember Holden moved and Councilmember McClung seconded a motion to adopt Resolution #2020-035 – Establishing a Small Business Emergency Assistance Grant Program in Response to COVID-19. A roll call vote was taken. Councilmember Scott commented this grant would not replace lost revenue but rather would assist with COVID-19 related expenses. Community Development Manager/City Planner Mrosla reported this was the case. The motion carried (5-0). B. Discussion of a Chicken Ordinance Councilmember McClung stated he has heard from a lot of residents that would like to provide public input on this topic. He recommended the Council consider a restrictive Ordinance such as Bloomington or Shoreview with respect to chickens. He suggested a public input meeting be held in order to gain additional feedback from Arden Hills residents. Councilmember Holmes agreed stating she had received a great deal of feedback from the public regarding chickens. She suggested a public hearing or forum type meeting be held in order to gather this input. Mayor Grant stated the Council was split on this matter. Councilmember Holden suggested the Council discuss a potential chicken Ordinance further at the next work session. Councilmember Scott commented he was willing to listen to additional discussion on this topic. Mayor Grant recommended this item be placed on the next work session agenda. 10. UNFINISHED BUSINESS ARDEN HILLS CITY COUNCIL – AUGUST 24, 2020 8 None. 11. COUNCIL COMMENTS Councilmember Scott stated he observed a lot of traffic from City and County vehicles in his neighborhood. He requested the City set a good example by observing the speed limit. Councilmember Holmes reported the Valentine Hills neighborhood has received a flyer from the Ramsey County Sheriff’s Department after the recent thefts that have occurred. Councilmember Holmes commented she appreciated the donations that were made to the Arden Hills Foundation for the Art Larsen Memorial Garden. Councilmember Holmes wished Communications Coordinator Dawn Skelly all the best and thanked her for her service to the City of Arden Hills. Councilmember Holden suggested the TCAAP/Rice Creek Commons item be removed from the agenda for the time being. The Council supported this recommendation. Councilmember Holden stated she was pleased to see the tennis courts being crack sealed and thanked staff for this work. Mayor Grant discussed the donations that were made to the Arden Hills Foundation. Councilmember Holden recommended a thank you note be sent to the Arden Hills Foundation for their generous donation to the City. ADJOURN MOTION: Councilmember Holden moved and Councilmember Holmes seconded a motion to adjourn. A roll call vote was taken. The motion carried unanimously (5-0). Mayor Grant adjourned the Regular City Council Meeting at 8:09 p.m. __________________________ __________________________ Julie Hanson David Grant City Clerk Mayor CONSENT ITEM 7A MEMORANDUM DATE: September 28, 2020 TO: Honorable Mayor and City Councilmembers Dave Perrault, City Administrator FROM: Gayle Bauman, Finance Director Pang Silseth, Accounting Analyst SUBJECT: Budgeted Amount: Actual Amount: Funding Source: N/A N/A N/A Council Should Consider A.Approve Claims and Payroll or B.Reject Claims and Payroll Background Payroll is processed biweekly and accounts payable is processed weekly. Budget Impact NA Attachments 2020 Payroll #19 …………………………………………………………….$89,476.13 Total Payroll $89,476.13 Paid Claims---8/31/2020 through 9/18/2020 (ACH Checks) ……………………………... $15,622.32 (Check Nos. 49546-49584 and ACH Checks) ……………………………... $379,027.42 Total Accounts Payable $394,649.74 Total Claims $484,125.87 CITY OF ARDEN HILLS PAYROLL # 19 CHECKS DATED: 09/18/20 Biweekly: 08/29/20 - 09/11/20 EMPLOYEE DEDUCTIONS AMT.Payment Method FIT 6,636.94 EFT SIT 3,062.33 EFT FICA Oasdi 4,553.82 EFT FICA Medicare 1,065.03 EFT TOTAL TAXES 15,318.12 Health Premium 1,802.09 A/P Check* Dental Premium 313.54 A/P Check* FSA Health Care Reimb. 0.00 A/P Check* FSA Dependent Care Reimb. 0.00 A/P Check* TOTAL FLEXIBLE SPENDING 2,115.63 HSA Health Saving 353.33 Health Care Savings Plan-Retirement 616.12 EFT Health Care Savings Plan-2% 464.08 EFT Health Care Savings Plan-4% 505.39 EFT TOTAL HEALTH SAVINGS 1,938.92 PERA 5,447.75 EFT ICMA 2,712.07 EFT Central Pension Fund-Union 567.84 A/P Check* MN State Retirement System 750.00 EFT TOTAL RETIREMENT 9,477.66 IUOE 49 Dues (Union) 122.50 A/P Check* LTD/STD Insurance 0.00 A/P Check* PERA Life Insurance 32.00 A/P Check* Life/Addl/Dep Life 132.94 A/P Check* Life/Addl non-tax 35.70 A/P Check* UNUM 19.51 A/P Check* AFLAC 22.76 EFT TOTAL VOLUNTARY 365.41 Total Employee Deductions 29,215.74 Net Payroll 0.00 Direct Deposit 48,834.40 EFT Gross Payroll Tie-Out 77,160.14 Plus City Paid Benefit 12,315.99 TOTAL PAYROLL COST 89,476.13 FICA TIE-OUT Gross Payroll 77,160.14 Less Total FSA 2,115.63 Less Total H.SA 1,938.92 Less Voluntary Ins 58.46 Plus ICMA Employer 401.46 Net P/R Subject to FICA 73,448.59 FICA Oasdi @ 6.20% 4,553.82 FICA Medicare @ 1.45% 1,065.03 Note: Federal and State Payroll Tax obligations are satisfied by means of utilizing the US Bank Easy Tax Deposit Service. Transfers are typically made up to two days after the payroll date. * A/P Checks can be found on the ACCOUNTS PAYABLE Check Approval report. Checks may be paid this week or the following week. 0.00 0.00 0.00 5,258.96 401.46 5,660.42 1,036.72 0.00 5,618.85 1,036.72 0.00 CITY BENEFIT 4,553.82 1,065.03 Accounts Payable User: Printed: Pang.Silseth 9/17/2020 8:20 PM Checks by Date - Detail by Check Date Check No Check DateVendor NameVendor No Check Amount Invoice No ReferenceDescription ACH001 US BANK 08/31/2020ACH BAUMG82020 GOVERNMENT FINANCE OFFIC 250.00 BLOMT82020 NATL SOC OF PROF ENGINEER 240.00 FRIDJ82020 AMZN MKTP US*MF5A25XI2 211.60 GEBAM82020 CHETS SHOES - CP CIRCLE P 90.00 GEBAM82020 MENARDS BLAINE MN 22.20 HANSJ82020 INTERNATIONAL INSTITUTE O 110.00 HANSJ82020 INTERNATIONAL INSTITUTE O 170.00 HANSJ82020 THE STAR TRIBUNE CIRCULAT 55.77 HANSJ82020 FESTIVAL FOODS #10 46.26 MIKAT82020 THE HOME DEPOT #2828 160.62 MIKAT82020 MENARDS BLAINE MN 71.72 MIKAT82020 APPLE.COM/BILL 0.99 MIKAT82020 NOR*NORTHERN TOOL 160.68 MIKAT82020 U OF M CONTLEARNING 100.00 MROSM82020 ECONOMIC DEVELOPMENT ASSO 10.00 MROSM82020 ECONOMIC DEVELOPMENT ASSO 500.00 WARDR82020 INT'L CODE COUNCIL INC 1,227.25 WARDR82020 MINNESOTA BOOKSTORE 228.71 3,655.80Total for this ACH Check for Vendor ACH001: ACH002 AFLAC 08/31/2020ACH 993081 Insurance Premiums- Aug 2020 45.52 45.52Total for this ACH Check for Vendor ACH002: ACH005 MINNESOTA REVENUE-SALES & USE TAX08/31/2020ACH 72020 July Sales/Use Tax -0.09 72020 July Sales/Use Tax -79.34 72020 July Sales/Use Tax 12,000.09 72020 July Sales/Use Tax 0.34 11,921.00Total for this ACH Check for Vendor ACH005: 15,622.32Total for 8/31/2020: Report Total (3 checks): 15,622.32 Page 1AP Checks by Date - Detail by Check Date (9/17/2020 8:20 PM) Accounts Payable User: Printed: Pang.Silseth 9/17/2020 8:21 PM Checks by Date - Detail by Check Date Check No Check DateVendor NameVendor No Check Amount Invoice No ReferenceDescription 0319 CITY OF ROSEVILLE 09/11/2020ACH 229332 IT Support-September 5,862.00 229399 Laserfiche License-MT 909.98 6,771.98Total for this ACH Check for Vendor 0319: 10363 MINUTE MAKER SECRETARIAL 09/11/2020ACH M1124 July CC Worksession and August Meetings 550.50 550.50Total for this ACH Check for Vendor 10363: 1125 BOLTON & MENK INC 09/11/2020ACH 0255488 Lift Station 10 Rehab 6,040.50 6,040.50Total for this ACH Check for Vendor 1125: 1223 ADAM'S PEST CONTROL - MAIN 09/11/2020ACH 3191867 September Pest Control 71.59 71.59Total for this ACH Check for Vendor 1223: TOII TOKLE INSPECTIONS INC 09/11/2020ACH 09012020 August Electrical Inspections 1,604.80 1,604.80Total for this ACH Check for Vendor TOII: 10420 ARTHUR'S CUP LLC 09/11/202049546 09092020 CARES Act-Small Business Grant 5,000.00 5,000.00Total for Check Number 49546: 10418 HORIZON CHEMICAL CO INC 09/11/202049547 09092020 CARES Act-Small Business Grant 5,000.00 5,000.00Total for Check Number 49547: 0447 I.U.O.E LOCAL 49 BENEFIT FUND-INSURANCE09/11/202049548 1020.BP3 October Insurance 10,120.00 1020.BP3 September Insurance-S.Barr 1,265.00 1020.NB4 October Insurance 1,527.00 12,912.00Total for Check Number 49548: 10421 INSTY-PRINTS OF ST. PAUL INC 09/11/202049549 09092020 CARES Act-Small Business Grant 5,000.00 5,000.00Total for Check Number 49549: 10286 MINNESOTA OCCUPATIONAL HEALTH 09/11/202049550 349137 August Drug Testing 124.00 Page 1AP Checks by Date - Detail by Check Date (9/17/2020 8:21 PM) Check No Check DateVendor NameVendor No Check Amount Invoice No ReferenceDescription 124.00Total for Check Number 49550: 10351 NORTHERN TECHNOLOGIES LLC 09/11/202049551 36165 Karth Lake Runoff 4,100.00 4,100.00Total for Check Number 49551: 10402 ORCHID BAR & GRILL INC.09/11/202049552 09092020 CARES Act-Small Business Grant 5,000.00 5,000.00Total for Check Number 49552: 10408 PAULSON & CLARK ENGINEERING 09/11/202049553 20982 HVAC Engineering 16,322.08 16,322.08Total for Check Number 49553: AR-Prem PREMISE INC 09/11/202049554 BP 2019-01266 EscrowRefund: BP 2019-01266, 1221 Cummings Park Drive 2,000.00 2,000.00Total for Check Number 49554: 10279 QUADIENT LEASING USA IINC 09/11/202049555 N8460334 Q3 2020 LEASING 1,297.71 1,297.71Total for Check Number 49555: 10419 QUEEN LAMERE LLC 09/11/202049556 09092020 CARES Act-Small Business Grant 5,000.00 5,000.00Total for Check Number 49556: 76,795.16Total for 9/11/2020: 0189 GOPHER STATE ONE CALL 09/18/2020ACH 80185 August Locates 104.85 80185 August Locates 104.85 80185 August Locates 104.85 314.55Total for this ACH Check for Vendor 0189: 0192 GRAINGER INC 09/18/2020ACH 9637212920 Supplies 72.62 9640806023 Coverall Kit 1,081.14 9647145763 Paint 23.52 9649363687 Clamps 115.57 9649661478 Bandclamps 142.32 9651232069 Paint 13.44 1,448.61Total for this ACH Check for Vendor 0192: 0243 METROPOLITAN COUNCIL-WASTE WATER09/18/2020ACH 1113872 October Wastewater 67,355.40 67,355.40Total for this ACH Check for Vendor 0243: 0285 XCEL ENERGY 09/18/2020ACH 698596218 7/15/20-8/13/20 1,632.64 698596218 7/15/20-8/13/20 48.22 698596218 7/15/20-8/13/20 497.78 Page 2AP Checks by Date - Detail by Check Date (9/17/2020 8:21 PM) Check No Check DateVendor NameVendor No Check Amount Invoice No ReferenceDescription 698596218 7/15/20-8/13/20 1,786.79 698596218 7/15/20-8/13/20 228.72 698596218 7/15/20-8/13/20 1,084.89 698596218 7/15/20-8/13/20 1,424.86 6,703.90Total for this ACH Check for Vendor 0285: 0292 OXYGEN SERVICE COMPANY INC 09/18/2020ACH 3473583 August Rental 26.04 26.04Total for this ACH Check for Vendor 0292: 0320 HEALTH PARTNERS INC 09/18/2020ACH 99660466 October Insurance 1,263.40 1,263.40Total for this ACH Check for Vendor 0320: 0327 STAPLES INC 09/18/2020ACH 3454712618 Hand Sanitizer 99.94 3455157139 Supplies 21.99 3455687910 Supplies 61.77 3455897388 Supplies 72.64 3456027287 Chairmat 76.39 332.73Total for this ACH Check for Vendor 0327: 0382 ICMA RETIREMENT TRUST - 106944 09/18/2020ACH PR 20-19 PR Batch 00200.09.2020 ICMA Employee Percent 401PR Batch 00200.09.2020 ICMA Employee Percent 401 347.93 PR 20-19 PR Batch 00200.09.2020 ICMA Employer Percent 401PR Batch 00200.09.2020 ICMA Employer Percent 401 401.46 749.39Total for this ACH Check for Vendor 0382: 0387 ICMA RETIREMENT TRUST #302482 09/18/2020ACH PR 20-19 PR Batch 00200.09.2020 ICMA Employee DeductionPR Batch 00200.09.2020 ICMA Employee Deduction 2,128.54 PR 20-19 PR Batch 00200.09.2020 ICMA Employee PercentPR Batch 00200.09.2020 ICMA Employee Percent 235.60 2,364.14Total for this ACH Check for Vendor 0387: 0453 CONTINENTAL RESEARCH CORP 09/18/2020ACH 18682 Cleaning Supplies 601.98 601.98Total for this ACH Check for Vendor 0453: 0706 CERTIFIED LABORATORIES 09/18/2020ACH 7047180 Safety Supplies 612.28 7087478 Rain Wear 419.45 7093466 Gloves 329.86 1,361.59Total for this ACH Check for Vendor 0706: 0731 MIDWAY FORD 09/18/2020ACH 550320 Service-2015 Ford Truck 327.08 327.08Total for this ACH Check for Vendor 0731: 0761 ELECTRIC PUMP INC 09/18/2020ACH 0069144-IN Lift Station #12 Repair-Pump 2 4,021.04 0069145-IN Lift Station #12 Repair 479.25 4,500.29Total for this ACH Check for Vendor 0761: 10422 MATTHEW SEIFERT 09/18/2020ACH Page 3AP Checks by Date - Detail by Check Date (9/17/2020 8:21 PM) Check No Check DateVendor NameVendor No Check Amount Invoice No ReferenceDescription 90320 Expense Reimbursement-Clothing 84.98 84.98Total for this ACH Check for Vendor 10422: 1125 BOLTON & MENK INC 09/18/2020ACH 256397 Services through 8/7/20 240.00 240.00Total for this ACH Check for Vendor 1125: 12018 ACHEIVE SERVICES 09/18/2020ACH 24880 Document Shredding 8/5 36.75 36.75Total for this ACH Check for Vendor 12018: 3096 AUTO PLUS 09/18/2020ACH 391019849 Supplies 93.24 93.24Total for this ACH Check for Vendor 3096: 491177SM STEPP MANUFACTURING CO INC 09/18/2020ACH 58110 Equipment Rental thru 9/7/20 1,000.00 1,000.00Total for this ACH Check for Vendor 491177SM: 5548 FINANCE & COMMERCE INC 09/18/2020ACH 744815007 Ad for Bids-HVAC 162.40 162.40Total for this ACH Check for Vendor 5548: 5587 CES IMAGING INC 09/18/2020ACH INV118441 September Rental 60.00 60.00Total for this ACH Check for Vendor 5587: 5596 JAMAR COMPANY 09/18/2020ACH 569226 Paint 66.00 66.00Total for this ACH Check for Vendor 5596: 7025 ON SITE COMPANIES -OSSTC INC 09/18/2020ACH 995810 Trip Charge-Cummins Park 120.00 997669 Restrooms 9/5-10/2 681.00 801.00Total for this ACH Check for Vendor 7025: 7501 KELLY & LEMMONS PA 09/18/2020ACH 53782 August Prosecution 2,244.55 2,244.55Total for this ACH Check for Vendor 7501: 8029 MMKR & CORP PA 09/18/2020ACH 48893 Internal Control/Segregation Review 900.00 900.00Total for this ACH Check for Vendor 8029: MNLI MINNESOTA NATIVE LANDSCAPES INC09/18/2020ACH 24936 July Weed Control 220.00 220.00Total for this ACH Check for Vendor MNLI: 1033 COMCAST 09/18/202049557 98681.0920 Service 9/5-10/4 109.71 Page 4AP Checks by Date - Detail by Check Date (9/17/2020 8:21 PM) Check No Check DateVendor NameVendor No Check Amount Invoice No ReferenceDescription 109.71Total for Check Number 49557: 10244 COMCAST BUSINESS INC 09/18/202049558 107584182 September Service 495.89 495.89Total for Check Number 49558: 1032 COMMERCIAL ASPHALT CO INC 09/18/202049559 200831 Asphalt Purchases 8/26-8/31 16,185.12 16,185.12Total for Check Number 49559: 10424 DBAGANINC 09/18/202049560 91620 CARES Act-Small Business Grant 5,000.00 5,000.00Total for Check Number 49560: 0841 EHLERS & ASSOCIATES INC.09/18/202049561 84489 CRF Business Assistance Program 375.00 84490 TIF Reporting-2019 Reports 125.00 84490 TIF Reporting-2019 Reports 125.00 625.00Total for Check Number 49561: 6954 EMERGENCY APPARATUS MAINTENANCE INC09/18/202049562 113155 MIP/DOT Inspection #85431 218.62 113156 MIP/DOT Inspection #85120 218.62 113157 MIP/DOT Inspection #85124 218.62 113158 MIP/DOT Inspection #85115 218.62 113159 MIP/DOT Inspection #85321 218.62 113160 MIP/DOT Inspection #85123 218.62 1,311.72Total for Check Number 49562: 0176 FRATTALLONES HARDWARE INC 09/18/202049563 089800/A Spray Paint 10.48 10.48Total for Check Number 49563: 10218 HR GREEN INC 09/18/202049564 136584 City Hall Parking Lot-June 11,096.25 136584 Shorewood Drive-June 2,863.00 137771 City Hall Parking Lot-August 457.50 137772 Hamline Ave Ped Crosswalk-August 2,720.00 17,136.75Total for Check Number 49564: 10425 INNOVATIVE SPECIAL EDUCATION SERVICES09/18/202049565 91620 CARES Act-Small Business Grant 5,000.00 5,000.00Total for Check Number 49565: 0390 INT'L UNION OPERATING ENGINEERS-UNION DUES09/18/202049566 90420 September Dues 245.00 245.00Total for Check Number 49566: 10427 LCI FOODS LLC 09/18/202049567 91620 CARES Act-Small Business Grant 5,000.00 5,000.00Total for Check Number 49567: Page 5AP Checks by Date - Detail by Check Date (9/17/2020 8:21 PM) Check No Check DateVendor NameVendor No Check Amount Invoice No ReferenceDescription 10271 MN PEIP 09/18/202049568 1002614 October Insurance 9,897.20 9,897.20Total for Check Number 49568: 0155 OFFICE OF MN IT SERVICES 09/18/202049569 W20080595 August Phones 736.14 736.14Total for Check Number 49569: 10426 PET EVOLUTION LLC 09/18/202049570 91620 CARES Act-Small Business Grant 5,000.00 5,000.00Total for Check Number 49570: 10428 POP CULTURE FROZEN YOGURT LLC 09/18/202049571 91620 CARES Act-Small Business Grant 5,000.00 5,000.00Total for Check Number 49571: 1208 PREMIUM WATERS INC 09/18/202049572 610207-08-20 August Water 33.48 613317-08-20 August Water 24.99 58.47Total for Check Number 49572: 10373 QUADIENT FINANCE USA INC 09/18/202049573 6418-0820 Postage 1,000.00 1,000.00Total for Check Number 49573: 0811 RAMSEY COUNTY 09/18/202049574 EMCOM-008697 Fleet Support-August 24.96 EMCOM-008734 Dispatch Service-August 3,181.94 EMCOM-008751 CAD Service-August 616.26 SHRFL-001908 Law Enforcement Services-September 111,426.64 115,249.80Total for Check Number 49574: 6748 RELIANCE STANDARD 09/18/202049575 GL154938.1020 October Insurance 1,666.83 1,666.83Total for Check Number 49575: AR-Sand SARA SANDAHL 09/18/202049576 PC 20-014 Escrow Refund PC 20-014, 1434 County Road E 1,000.00 1,000.00Total for Check Number 49576: 1054 SHI INTERNATIONAL CORP 09/18/202049577 B12185051 Laptops 4,664.52 4,664.52Total for Check Number 49577: 10423 SIR LINES-A-LOT 09/18/202049578 H20-0226p-3-001 Street Marking 432.00 432.00Total for Check Number 49578: 10354 ST. PAUL PIONEER PRESS 09/18/202049579 820572589 Legal Notice-Annual Disclosure 75.25 820572589 Legal Notice-PC20-010 48.16 820572589 Legal Notice-Annual Disclosure 75.25 Page 6AP Checks by Date - Detail by Check Date (9/17/2020 8:21 PM) Check No Check DateVendor NameVendor No Check Amount Invoice No ReferenceDescription 820572589 Hearing Notice-2021 PMP 67.94 266.60Total for Check Number 49579: 0336 T.A. SCHIFSKY & SONS INC 09/18/202049580 66382 Asphalt Purchases 8/17-8/20 1,726.59 1,726.59Total for Check Number 49580: 0925 T-MOBILE 09/18/202049581 841463567.1020 Service 8/2-9/1 23.34 23.34Total for Check Number 49581: 3099 TRI STATE BOBCAT INC-LITTLE CANADA09/18/202049582 A76873 Toolcat 533.08 533.08Total for Check Number 49582: 1161 VALLEY-RICH CO INC 09/18/202049583 28610 Curb Stop-1358 Eide Cir 5,600.00 5,600.00Total for Check Number 49583: 4703 WELSCH'S BIG TEN TAVERN 09/18/202049584 91620 CARES Act-Small Business Grant 5,000.00 5,000.00Total for Check Number 49584: 302,232.26Total for 9/18/2020: Report Total (69 checks): 379,027.42 Page 7AP Checks by Date - Detail by Check Date (9/17/2020 8:21 PM) CONSENT ITEM – 7B MEMORANDUM DATE: September 28, 2020 TO: Honorable Mayor and City Councilmembers Dave Perrault, City Administrator FROM: Gayle Bauman, Finance Director SUBJECT: Transfer fund balance from General Fund to Capital Funds Budgeted Amount: Actual Amount: Funding Source: N/A N/A N/A Council Should Consider Motion to transfer $341,000 from the General Fund to the Public Safety Capital Fund and $137,000 from the General Fund to the Capital Improvement (PIR) Fund and authorizing the Finance Director to complete all corresponding budget adjustments. Background In 2014, the Council adopted a revised Fund Balance Policy which directs the Finance Director to bring a request to the City Council to transfer any excess funds over 50% of fund balance in the General Fund to the PIR Fund once the final audit is completed. The intent of the policy is to utilize the funds for one-time, non-operating items. The primary considerations of the policy are 1) to meet the cash flow requirements of the City; 2) to maintain adequate fund balances and net assets in each individual fund of the City; and 3) to provide for emergencies and contingency needs of the City. These goals are accomplished by transferring the funds to any capital fund in need. Discussion The amount available for transfer based on the 2019 audit is $478,000. Staff is proposing to transfer $341,000 to the Public Safety Capital Fund to cover the cost of the land purchase and access road for the future Lake Johanna Fire Station and to transfer the remaining balance of $137,000 to the PIR Fund. Budget Impact Increase in transfers out of the General Fund and transfers in to the Public Safety Capital Fund and PIR Fund. 1 DATE: September 28, 2020 TO: Honorable Mayor and City Councilmembers FROM: Dave Perrault, City Administrator SUBJECT: NSAC Professional and Technical Services Agreement Budgeted Amount: Actual Amount: Funding Source: N/A $9,376 Cable Fund Council Should Consider The Council should consider approving the North Suburban Access NSAC Professional and Technical Services Agreement. Background The City has historically used the North Suburban Access Corporation (NSAC) for technical services to include, but not limited to, municipal production services, cablecasting services, web streaming services, and technical support as needed. The agreement is attached (see Attachment A) along with a letter from CTV’s Executive Director, Dana Healy, explaining the increase (see Attachment B). The increase represents a 20 percent, or $1,608, increase over 2020 due to the restructuring of how cities are being charged for meetings. The restructured cost will allow NSAC to recover its cost for meetings and help offset revenue loss due to decreasing cable grants. Budget Impact This item is the technical services agreement and will be included in the 2021 budget. Attachment Attachment A: North Suburban Access NSAC Professional Services Agreement Attachment B: Letter from Dana Healy, CTV Executive Director CONSENT ITEM – 7C MEMORANDUM North Suburban Access Corporation Professional and Technical Services Agreement This contract is between the North Suburban Access Corporation, a Minnesota Municipal Corporation, (herein “the NSAC”) and the City of Arden Hills, Minnesota (herein “the City”). Recitals 1. Under Minnesota law, the NSAC is empowered to provide such professional and technical services as are desired by the City. 2. The City desires to engage the NSAC for video webcasting services and archiving services (herein “the Services”). 3. The City represents that it is empowered to engage the NSAC. Agreement 1. Term of Contract 1.1. Duration. This Agreement will become effective January 1, 2021 and will remain in effect for a period of one (1) year. At the expiration of the one (1) year period, the Agreement will automatically renew for another period of one (1) year, unless notice to terminate this Agreement is provided no less than ninety (90) days prior to the end of the current term. If this Agreement is terminated prior to the completion of a one (1) year period, the NSAC will be entitled to payment, determined on a pro rata basis, for Services satisfactorily performed. 1.2. Survival of Terms. The following clauses will remain in effect after the termination of the Agreement: Section 5. Liability, Section 6. Government Data Practices and Intellectual Property, Section 8. Governing Law, Jurisdiction, and Venue; and Section 9. Disclosure. 2. Services Provided 2.1. Services. The NSAC will provide the Services described in Schedule A (attached). 2.2. Additional Services. The City may also request additional services during the term of the Agreement (see Section 1.1. Duration). If accepted by the NSAC, Schedule A will be amended to include a description of the additional services and according compensation. Unless otherwise specified, all terms of this Agreement will apply to any amendments to Schedule A. 2.3. Standard of Care. To the extent any property, such as camera or computer equipment, is loaned by the NSAC to the City, the City will exhibit a standard of care consistent with Minnesota law. 2.4. City Assistance. Depending on the nature of the Services, the NSAC may from time to time require access to public and private lands or property. To the extent the City is legally and reasonably able, the City will provide access to and make provisions to enable the NSAC or its agents or employees to enter upon public and private land and property as required for the NSAC to perform the Services. The City will furnish the NSAC with a copy of any special standards or criteria promulgated by the City relating to the Services, including, but not limited to, design and construction standards, that is necessary for the NSAC to prepare for its performance of the Services. 3. Payment 3.1. Compensation. The City will pay for all Services to be performed by the Contractor as specified in Schedule A (attached). 3.2. Fee Adjustment. The NSAC reserves the right to annually adjust the fees associated with the Services specified in Schedule A. Such adjustments, if any, will be enacted on January 1 of a given year. Prior to enacting any fee adjustments, the NSAC must provide written notice of such to the City at least thirty (30) calendar days prior to the effective date of the fee adjustment. 3.3. Invoices. The City must promptly pay the NSAC after the NSAC presents an invoice for those Services that have been actually performed. The NSAC must timely submit invoices. 3.4. Event Cancellation. The City agrees to pay 70% of the expected event amount for any cancellation unless sufficient prior notice is provided. “Prior Notice” is defined as at least 10 business days (including the day of the event) before the scheduled event. 4. Assignment, Amendments, Waiver, and Completeness 4.1. Assignment. The City may not assign, license, or transfer any rights or obligation under this Agreement without prior written consent of the NSAC and a fully executed Assignment Agreement, executed and approved by the same parties who executed and approved this Agreement, or their successors in office. 4.2. Amendments. Any amendments to this contract must be made in writing and will not be effective until executed and approved by the same parties who executed and approved this Agreement, or their successors in office. 4.3. Waiver. If the NSAC fails to enforce in a timely manner any provision of this Agreement, that failure does not waive the provision or the NSAC’s right to enforce the provision. 4.4. Completeness. This Agreement contains all negotiations and agreements between the NSAC and the City. No other understanding regarding this Agreement, whether written or oral, may be used to bind either party. 5. Liability The City must indemnify and hold harmless the NSAC, its agents, and its employees from any claims or causes of action, including attorney’s fees incurred by the NSAC arising from performance of this Agreement by the City, its agents, or its employees. The clause must not be construed to preempt any legal remedies the NSAC may have for the City’s failure to fulfill its obligations under this Agreement. 6. Government Data Practices and Intellectual Property 6.1. Government Data Practices. To the extent applicable, the City and NSAC must comply with the Minnesota Government Data Practices Act, Minn. Stat. Ch. 13. The civil remedies of Minn. Stat. § 13.08 apply to the release of the data referred to in this Clause by either the City or the NSAC. Each Party shall notify the other of any Data Practices Act request for video recordings created pursuant to this Agreement. All requests for the release or sale of video recordings created pursuant to this Agreement shall be directed to and fulfilled by the NSAC. 7. Endorsement The City must not claim that the NSAC endorses its products or services. 8. Governing Law, Jurisdiction, and Venue Minnesota Law governs this Agreement. Venue for all legal proceedings arising from this Agreement shall be in the appropriate state or federal court with competent jurisdiction in Ramsey County, Minnesota. 9. Disclosure The City consents to disclosure of its social security number, federal employer tax identification number, and Minnesota tax identification number, to the Commission as is necessary for compliance with Minnesota and other applicable law. 10. Severability If any section or clause of this Agreement is held to be invalid or unenforceable, then the meaning of that section or clause shall be construed so as to render it enforceable to the extent feasible. If no feasible interpretation would save the section or clause, it shall be severed from this Agreement with respect to the matter in question, and the remainder of the Agreement shall remain in full force and effect. However, in the event that such a section or clause is essential or substantially alters the Agreement, the Parties shall negotiate a replacement section or clause that will achieve the intent of such unenforceable section or clause to the extent permitted by law. 11. Employment Employees of the NSAC performing work pursuant to this Agreement shall remain at all times employees only of the NSAC. The NSAC will be responsible for worker’s compensation, salary, and training. [REMAINDER OF THIS PAGE INTENTIONALLY LEFT BLANK] Dated: _________________ North Suburban Access Corporation By: ______________________________ Its: ________________________ Attest By: ______________________________ Its: ________________________ Arden Hills, City Administrator Dated: _________________ By: ______________________________ Its: ________________________ Schedule A. Services (Arden Hills). Service Quote Agreed Municipal Production Services: The NSAC agrees to provide the following: A total of 36 meetings for 2021 include 2 City Council Meetings per month and 1 Planning Commission meetings per month. Cost per meeting is $173. For each additional meeting a flat fee of $207 per meeting will be charged. CTV will provide a municipal producer to record and broadcast LIVE meetings; Equipment and meeting room preparation; Provide the timing of the discussion and agenda items for web links; Upload minutes for all 2021 meetings; Provide backend support for closing, annotating, and posting the meeting for progra m the following day. Provide Master Control services to ensure quality controls. The City agrees to provide the following: Provide a weekly schedule of live and/or recorded events of shows at least one week in advance of first event/show on the schedule. Provide the NSAC with the name and telephone number and email address of an emergency contact who can answer questions about the cablecast and/or encoding of live events. Provide PDF copies of minutes for upload. $6,228 per year $6,228 per year Cablecasting Services: The NSAC agrees to provide the following: Live broadcasting of City Council meetings and applicable Advisory Commission meetings on appropriate channels; Schedule the City channel with up to 4 premiers of programming, and 17 reruns of programming per week, totaling 21 playbacks per week; The City agrees to provide the following: Monthly schedule of cablecast playbacks. $633 per year $633 per year Schedule A. Services (Arden Hills). Social Media Coordination - Lite: The NSAC agrees to provide the following: 3 Custom-made posts per week. A content execution calendar with up to 12 planned posts per month, with creative content. Quarterly analytics The City agrees to provide the following: A monthly newsletter and items of upcoming interest. $5,720 per year (20% discount for new customer - $4,576) - Carousel Coordination: Coordination of two carousels per month, at $5 per Carousel per month, this does not include labor to manage the Carousel. $120 per year $120 per year Web streaming Services: The NSAC agrees to provide the following: Live web streaming of City Council meetings and Planning Commission meetings, no more than 4 regular programs per month, with 4 floating meetings per year to use at the City’s discretion; Encoded meetings and the accompanying agendas posted within 24 hours on the NSAC’s website; Post links between agenda items and their video discussion; Storage of recorded videos for up to 12 months; The City agrees to provide the following: Provide the NSAC with monthly schedule of all live meetings to be streamed and/or encoded for posting on the NSAC’s website; Notify the NSAC as soon as possible of the cancellation of a live event, including city meeting, which is scheduled for playback, of any change in the day or beginning time of any live event, including city meeting, or of any additions of special meeting to the schedule; Provide the NSAC with the name and telephone number for a main contact of the cablecast. Chapter marking information on the agenda will be provided by the City for meetings not utilizing the NSAC’s municipal producers. $2,394 per year $2,394 per year Consultation: The NSAC agrees to provide the following: Audio/Visual equipment maintenance related to municipal meeting coverage and delivery; $80 per hour. Proposal for projects will - Schedule A. Services (Arden Hills). and Audio/Video equipment planning, and/or installation. need a contract Neighborhood Network Services: The NSAC agrees to provide the following: Produce at least 2 productions a year for the City, at the discretion of the NSAC; Cablecast, web stream, and distribute via link to the City the final product; Storage of recorded videos for up to 6 months. The City agrees to provide the following: Submit to the NSAC monthly production requests, which will only come from either the City Administrator, the Mayor, or a City Council Member that has been designated for communications. Submit the production requests by October 31 st 2019. Introductory rate of $1 per year $1 Total $9,376 per year September 15, 2020 Dave Perrault, City Administrator City of Arden Hills 1245 W Highway 96 Arden Hills, MN 55112 Dear Dave, First, we’d like to thank you for Arden Hill’s partnership with the North Suburban Communications Commission and Access Corporation (dba CTV North Suburbs). We truly value the Arden Hills community and want to continue to support the city through enhancing your communications by making information available to all residents. The cable and communications landscape continues to change. We are adapting with it. Historically, we have charged per hour for meeting coverage. We will be offering meeting coverage service as a flat rate per meeting. This makes it easier for our cities to budget, but it represents a more accurate account of our costs. The cost per meeting, when purchased in a bulk buy, is $173 per meeting. For ala carte meetings, and for emergency situations, the cost is $207 per meeting. We will not be increasing costs of webcasting and cablecasting this year because of the price structure change of meeting coverage. Your Municipal Producer will continue to be Aaron Thomas. The benefit for using the CTV services is the peace of mind that the meetings will be executed properly, and there will always be a back-up operator available. We will continue to offer the Neighborhood Network program for $1 a year. If you chose to participate, CTV will produce at least 3 productions a year related to your city, which will also be webcasted, cable casted and archived for the city. We are also offering a 20% discount in 2021 for our cities to utilize our social media coordination services. For your city, it would be $4,576 for the year to have social media coordination support for your communications staff. If you would like that added, please let me know. Please let me know if you have any questions about the service agreement for 2020. We look forward to serving the city of Arden Hills. Thank you. Sincerely, Dana Healy Executive Director North Suburban Access Corporation, CTV North Suburbs Page 1 of 2 DATE: September 28, 2020 TO: Honorable Mayor and City Council Members David Perrault, City Administrator FROM: David Swearingen, Assistant City Engineer, EIT Todd Blomstrom, Public Works Director/City Engineer SUBJECT: Payment Voucher No. 5 – Final Payment, Tennis Court Improvements for Cummings and Royal Hills Parks Budgeted Amount: Actual Amount: Funding Sources: $349,102 $367,797 PIR, General Fund Council Should Consider The Council is requested to consider approval of Pay Voucher No. 5 in the amount of $16,113.80 for release of retainage of the Tennis Courts Improvements at Cummings and Royal Hills Park, City Project No. PW-19-0104. This will be the Final Payment and the project will be closed. Background On July 22, 2019, the City Council adopted Resolution #2019-025 awarding a contract for the Tennis Court Improvements at Cummings and Royal Hills Parks to Bituminous Roadways in the amount of $303,782.00. The contractor began the project on September 3, 2019 and has since completed all of the contract items. There were two change orders on this project, resulting in a revised contract amount of $323,001. Staff has completed a final walkthrough of the project and is satisfied with the restoration. Residents have already begun to enjoy the new hardcourts for recreational activities earlier this summer and we’ve received positive feedback. Staff has received the necessary documents for project closeout as stated in Attachment A. Pay Voucher No. 5 reflects all Final Payment of the contract work for the project and release of retainage. The project consultant and City staff recommend approval of Payment Voucher No. 5 as provided in Attachment B and closing of this project. CONSENT ITEM – 7D MEMORANDUM Page 2 of 2 Budget Impact The construction contract amount and overall budget for the Tennis Court Improvements for Cummings and Royal Hills Parks is summarized below. Project Expenses Construction Base Bid (Bituminous Roadways) $303,782.00 Engineering and Construction Admin. (WSB) $ 39,420.00 Geotechnical Investigation (WSB) $ 5,900.00 Change Order No. 1 $ 16,319.00 Change Order No. 2 $ 2,900.00 Construction contract unspent $ (725.00) Other costs $ 201.00 Total Expenses $367,797.00 Project Funding Capital Improvements PIR Fund $364,897.00 General Fund (vandalism repair)* $ 2,900.00 * City seeking restitution for vandalism repair in Change Order No. 2 Attachments Attachment A: WSB Letter of Recommendation Attachment B: Pay Voucher No. 5 "K:\014152-000\Admin\Construction Admin\Pay Applications\Final Pay Application\014152-000 LTR FINAL PAYMENT.docx" 178 E 9TH STREET | SUITE 200 | SAINT PAUL, MN | 55101 | 651.286.8450 | WSBENG.COM September 18, 2020 Todd Blomstrom City of Arden Hills 1245 West Highway 96 Arden Hills, MN 55112 Re: Tennis Court Improvements at Cummings, Hazelnut and Royal Hills Project City of Arden Hills Project No. 19-PARK-001 WSB Project No. R-014152-000 Dear Mr. Blomstrom: Please find enclosed Construction Pay Voucher No. 5 (final) for the above referenced project in the amount of $16,113.80 for release of retainage. In addition, the final required documents were accompanied with final payment which included the following: 1. IC134 form. 2. Evidence in the form of an affidavit that all claims against the contractor by reasons of the contract have been fully paid or satisfactorily secured (lien waivers). 3. Consent of Surety to Final Payment certification from the contractor’s surety. 4. Two-year performance bond (warranty start date to coincide with the date Council approves final payment). If you have any questions or comments regarding this voucher, please contact me at 763.231.4865. Sincerely, WSB Steven Foss, PLA Landscape Architect Attachments Page 1 of 2 CONSENT ITEM – 7E MEMORANDUM DATE: September 28, 2020 TO: Honorable Mayor and City Councilmembers Dave Perrault, City Administrator FROM: Todd Blomstrom, Public Works Director/City Engineer SUBJECT: Resolution 2020-043 Authorizing Application to MnDOT Standalone Noise Barrier Program Budgeted Amount: Actual Amount: Funding Source: $ 0 $162,400 PIR Fund (Estimated City Cost) Council Should Consider The City Council is requested to consider adoption of Resolution 2020-043 authorizing an application to the MnDOT Metro Standalone Noise Barrier Program. Background/Discussion The City Council work session on July 27, 2020 included a discussion of a potential application to the MnDOT Standalone Noise Wall program for the segment of Trunk Highway 10 from County Road 96 to Wedgewood Circle. Council consensus was to direct staff to prepare an application to MnDOT for this segment prior to the end of 2020. The MnDOT Metro Standalone Noise Wall program is a solicitation-based process where cities submit applications to be considered for noise wall funding. The program provides funding for construction of noise barriers along state highways in areas where no noise abatement measures currently exist and no major construction projects are currently programmed. MnDOT Metro has set aside approximately $2 million per year to fund this program, which typically would fund construction for one or two noise wall sites per year. MnDOT is currently seeking applications for potential noise wall projects in fiscal year 2025. MnDOT will conduct a noise analysis for applications received and rank applications based on existing noise levels, length of barrier, number of benefited homes, and cost effectiveness of a noise barrier. Selected projects will be announced in the spring of 2021. Page 2 of 2 The project application form is provided in Attachment A. A resolution authorizing an application to the Standalone Noise Wall program is provided in Attachment B. Budget Impact Selected standalone noise barrier projects require a 10% cost share from the city where the noise barrier is being proposed. The cost of the proposed noise barrier along Trunk Highway 10 is estimated to be $1,624,000 within the MnDOT Metro District 2016 Highway Noise Abatement Study, resulting in an estimated city cost participation of approximately $162,400 or more if the project is selected for the year 2025. Attachments Attachment A: Program Application Form Attachment B: Resolution 2020-043 2020 Application for MnDOT Metro Standalone Noise Barrier 1. Name of governmental authority submitting application and agreeing to local cost share: 2. Highway/Interstate adjacent to area for which the application is being made: 3. Current ranking on 2016 Metro District Highway Noise Abatement Study :___95________ 4. Limits of area of application: a map is required; aerial photo is preferred: Side of Highway: (N, S, E, W, Both) Beginning Point: (Cross roads, etc.) Ending Point: Estimated length of proposed noise barrier (in feet): 5. Are the residential units located in an incorporated area? Yes / No Note: Only incorporated areas are eligible. 6. Were the majority of the residential units constructed prior to 1997? Yes / No Note: Only residential areas constructed prior to 1997 are eligible. 7. Number of residential units (homes and/or apartments) adjacent to the roadway: 8. Existing noise level: Note: Contact Natalie Ries at MnDOT Metro or use MnDOT’s Flat Earth Noise Level Estimator Excel Spreadsheet available at MnDOT's Noise Analysis Homepage 9. What type of noise barrier is being requested? Concrete Wood TBD 10. Additional comments: ________________________________________________________________________________ ________________________________________________________________________________ City of Arden Hills Trunk Highway 10 West Ramsey County Road 96 29 71.2 3,800 X South of Wedgewood Circle 11. I certify that the application information provided is correct. City appoval/resolution is attached. David Grant, Mayor September 28, 2020 Print name and title of local official Date September 28, 2020 Signature and title of local official Date To view the final document, access adopted Resolutions via Arden Hills Public Laserfiche Weblink by visiting cityofardenhills.org and clicking on Archived Documents under Helpful Links on our main webpage. CITY OF ARDEN HILLS COUNTY OF RAMSEY STATE OF MINNESOTA RESOLUTION NO. 2020-043 RESOLUTION AUTHORIZING APPLICATION TO MnDOT METRO STANDALONE NOISE BARRIER PROGRAM WHEREAS, the Minnesota Department of Transportation (MnDOT) 2016 Metro District Highway Noise Abatement Study identifies a section of potential noise wall along the west side of Trunk Highway 10 between County Road 96 and south of Wedgewood Court; and WHEREAS, MnDOT Metro District has updated the Standalone Noise Barrier program to a solicitation-based process, where cities submit applications to be considered for noise wall funding; and WHEREAS, MnDOT is currently seeking applications for potential noise wall projects in fiscal year 2025; and WHEREAS, the City Council has determined that an application for the above references section of Trunk Highway 10 should be submitted to MnDOT. NOW, THEREFORE, BE IT RESOLVED by the City Council of the City of Arden Hills, Minnesota, that the City Council hereby authorizes the submittal of the 2020 Application for MnDOT Metro Standalone Noise Barrier program for said segment of Trunk Highway 10 as provided in Attachment A. ADOPTED BY THE CITY COUNCIL OF THE CITY OF ARDEN HILLS THIS 28th DAY OF SEPTEMBER, 2020. ________________________________ David Grant, Mayor ATTEST: ______________________________ Julie Hanson, City Clerk Page 1 of 1 CONSENT ITEM – 7F MEMORANDUM DATE: September 28, 2020 TO: Honorable Mayor and City Councilmembers Dave Perrault, City Administrator FROM: Todd Blomstrom, Public Works Director/City Engineer SUBJECT: Revisions to the Snowplowing, Snow Removal and Ice Control Policy Budgeted Amount: Actual Amount: Funding Source: N/A N/A Street Maintenance Budget Council Should Consider The City Council is requested to consider approval of recommended revisions to the City’s Snowplowing, Snow Removal and Ice Control Policy. Background/Discussion Public Works Department staff recently reviewed the City’s Snowplowing, Snow Removal and Ice Control Policy in preparation for the upcoming winter season and identified recommended minor revisions to the policy as provided in Attachment A. The primary changes to the policy document are related to repair of mailbox damage. The proposed revisions within Section 9 are added to provide consistency with state guidelines regarding mailbox installations within public right of way. A reimbursement provision is included to address current city practice regarding compensation to property owners who wish to repair mailbox damage caused by direct contact from a City plow. Budget Impact The proposed revisions to the policy would not result in changes to current winter snow and ice control operations or practices, and should not result in changes to anticipated expenses. Attachments Attachment A: Proposed Revisions to Snowplowing, Snow Removal and Ice Control Policy Adopted 2006 Revised July 2016September 2020 CITY OF ARDEN HILLS SNOWPLOWING, SNOW REMOVAL AND ICE CONTROL POLICY 1. DETERMINATION OF NEED AND INTRODUCTIONS The City of Arden Hills has determined that it is in the best interest of the residents, for the City to assume basic responsibility for control of snow and ice on the streets under the jurisdiction of the City. Appropriate snow and ice control is necessary for emergency services as well as routine travel. Providing this service in a cost-effective manner is a discretionary decision of the City Council. The City will use City employees, equipment and/or contract services as deemed appropriate to provide this service. Therefore, this policy is needed to provide direction for these operations and guidelines for employees and residents based upon available resources. The City of Arden Hills has approximately thirty (30) miles of street under its jurisdiction. These consist of State Aid roads and residential streets. This policy is intended to provide guidelines for snow and ice control operations for streets under the City’s jurisdiction. Some sidewalks are also covered under this policy. 2. COMMENCEMENT OF OPERATIONS Snowplowing and/or ice control operations shall commence under the direction of the Public Works Director. In his absence, the Public Works Superintendent will determine when and what operations will begin. If there is sufficient notice of an upcoming storm, crews will apply salt brine at intersections, hills, and curves on dry pavement in advance of the storm. Salt brine has been found to be more effective, longer lasting, and more environmentally friendly than conventional road salt. It is policy to begin snowplowing operations after the snowstorm has subsided. The call out of equipment is dependent upon time and severity of the snowfall. The most critical times are morning and evening rush hour periods. This policy is designated, if at all feasible, to have the snow removed prior to the beginning of these rush hour periods. If a storm is forecast to be unusually long, or heavy accumulations appear imminent, full snowplowing operations will begin on all of the snowplow routes when accumulations become hazardous for driving. Based on different storm situations and severity levels, the starting time frames are flexible. The following guidelines may also warrant the beginning of the operations. A. Snow accumulation of two inches, with continued snowfall. B. Drifting of snow may warrant commencement of partial or full operations depending upon conditions. C. Icing of pavements may also warrant partial or full plowing operation depending upon extent and conditions, and in support of reducing the annual volume of chlorides being introduced into the environment. D. The Public Works Director or his designated representative shall determine the time to start operations and the extent of the operations. Storms forecast for late afternoon or evening hours may be the basis for the Public Works Director splitting a shift and sending crews home for call-out later in the evening. 3. SUSPENSION OF OPERATIONS Operations shall continue until all roads are passable. Widening and clean-up operations may continue immediately or on the following working day, depending upon conditions and circumstances. Safety of the plow operators and the public is important. Therefore, snowplowing/removal operations may be terminated after ten to twelve hours to allow personnel adequate time to rest. There may be instances when this is not possible, depending on storm conditions and other circumstances. Operations may also be suspended during periods of limited or zero visibility. Any decision to suspend operations shall be made by the Public Works Director, or his designee, and shall be based on the conditions of the storm. In the event that the driver gets stuck in snow or breaks down, another unit will be summoned to replace or rescue the disabled unit. The safety of the drivers will be of prime importance. If the City should experience equipment breakdown, attempts will be made to engage contract units, or other municipalities to supplement our work force or equipment fleet. 4. PLOW ROUTES AND SEQUENCING City streets, public sidewalks, trails, public parking lots, and ice rinks under the City’s jurisdiction are affected by this policy. All private sidewalks shall be maintained by the property owner. City parking lots and ice rinks shall be cleared by the City crews, but as a secondary priority. At the City’s discretion, they shall either be cleared in conjunction with street routes or after street routes have been completed. The Public Works Director shall have the responsibility of determining plow routes and sequencing operations. The Public Works Director shall retain the latitude to adjust sequencing or route assignments based on storm conditions, equipment availability and/or other conditions warranting changes. Currently, the City has been divided into three different plow routes, with one snowplow assigned to each. 5. LEVELS OF SERVICE The intent of this policy is to provide safe winter driving conditions appropriate for the type of travel typical to City streets. The level of service described herein shall be considered a guideline with the understanding that immediately after a storm, the level of service provided may be less than described herein and may vary across the City, depending on storm conditions and other circumstances. Streets shall be plowed and/or salted, with additional emphasis given to intersection approaches and curves, in order to provide the safest conditions practical under the circumstances. Snow shall be plowed in a manner that will not obstruct traffic flow on a normal basis. The center of the roadway will be plowed first. The snow will be pushed from the center-line. The discharge shall go onto the boulevard area of the street. There is no known practical method for the City to preventway to keep snow from filling the end of driveways as the plow passes by. Salting may occur while plowing depending on the conditions. Generally intersections, hills, high traffic areas, and curves are salted during plowing. If severe ice conditions exist, salt applications may be more widespread. Salt is purchased from Ramsey County. It is loaded by Ramsey County operators that measure tonnage via scales on the loader or by an average bucket volume basis. Excess salt returned to storage is estimated and recorded by the plow operator. The City of Arden Hills does not have a dry pavement policy so those using City maintained rights- of-way are expected to exercise careful judgment and caution during winter months. During light to normal snowfalls, streets shall be plowed to full width as soon after the initial pass as possiblepractical. During heavier snowfalls, the streets shall be plowed as wide as possible initially and widened as the storm intensity lessens. After the storm subsides, clean-up operations shall begin in order to clear intersections and snow storage areas along corners and boulevards. It is the City’s intent to complete the initial plowing and salting operations within twenty-four (24) hours of light snowfalls and within seventy-two (72) hours of heavy snowfalls. Major blizzards winter weather events may require more time. 6. PARKING RESTRICTIONS On-street parking is not compatible with efficient snowplowing operations. Vehicles left parked on the street for extended periods of time created significant operational problems for snowplow operators as well as safety problems due to packed snow and ice remaining on the roadway around the vehicle. The City’s Ordinance prohibit parking of vehicles on City streets after the accumulation of two inches or more of snow, with the prohibition continuing until snow removal or plowing thereof has been completed. Any vehicle parked in violation of this Ordinance is subject to a parking citation and is also declared to be a safety hazard and nuisance. This nuisance may be summarily abated by removing and towing away such vehicle under the direction of the Ramsey County Sheriff’s Department. Enforcement of this Ordinance shall be directed by the City Council. 7. SNOW REMOVAL Certain locations within our community may require additional service after snowplowing operations cease. This shall be referred to as “snow removal”. Snow removal hereinafter will be defined as the loading and trucking of snow to an approved site under the direction of the Public Works Director or his designated representative. This service may be proved provided when there is no area for snow storage. Snow removal operations normally begin within twenty-four (24) hours after snowplowing operations have been completed. There are approximately sixty (60) cul-de-sacs in Arden Hills. It may take some time for the specialized equipment to complete the actual cul-de-sac areas; therefore, a snowplow may complete the normal part of the street and complete only a portion of the cul-de-sac. The major portion of the cul-de-sac will be plowed by the special equipment during the usual time guidelines for snowplowing operations. Snow removal may be required in cul-de-sac areas if previous snow accumulations prevent normal movement of snow to boulevard areas. 8. SNOW REMOVAL FOR CITY SIDEWALKS AND TRAILS The city of Arden Hills does maintain most sidewalks and trails within City property and right-of- way. Arden Hills sidewalk snow plowing begins as soon as possible after a significant snowfall. The City will maintain sidewalks and trails only after all City streets have been plowed. Sidewalks and trails that are maintained by the City during the winter months will be cleared of accumulated snow, but will not be maintained to a “clean pavement” condition. The following sidewalk and trail areas will not be maintained by the City’s Operations and MaintenancePublic Works Department in the winter months due to steep grades or dangerous sidewalk conditions. Arden View Drive to Colleen Avenue Trail Cummings Park – Lexington Avenue to Cummings Ball Field Cummings Park – North Water Tower to Hamline Avenue The City of Arden Hills will post the aforementioned train trail locations as “Minimal Maintenance Trails” during the winter months. The City does not maintain unpaved trail segments during the winter months. Special priority is given to school routes along a few sidewalks and trails. All efforts will be made to clear the following sidewalks/trails by 7:00 AM. Trail along County Road E2 Trail from Venus Avenue to County Road E2 Trail along Lake Valentine Road 9. PROPERTY DAMAGE Snowplowing and ice control operations may cause property damage even under the best of circumstances and care on the part of the operator. The major types of damage are to improvements within the City right-of-way, which extends approximately ten to fifteen feet beyond the curb locations. The intent of the right-of-way is to provide room for snow storage, utilities, boulevard trees, sidewalks and other City uses. The City will repair sod that was damaged by a City snowplow. Operations and MaintenancePublic Works Department staff members will repair the sod damage with black dirt and grass seed. All other damage within the public right-of-way is the responsibility of the property owner including, but not limited to, trees, shrubs, landscaping materials, decorative rock, brick walls, and lawn/landscaping irrigation (sprinkler heads) systems. The City will not repair/replace sod damage due to the application of sand, salt, or other deicing chemicals. Certain private improvements such as mailboxes are required within this areaCity right-of-way.: thereforeTherefore, the City will cooperate with property owners in the event of damaged private property. The City shall specify when this damage is the responsibility of the City and when it shall be the responsibility of the resident. Mailboxes and supports are the property of the mail route patron and must be installed and maintained by their owner, who must bear the liability for them. Since mailboxes must be located in the road right-of-way in order to be accessed by postal service, certain regulations apply for the safety of the driving public as well as for the protection of the mailboxes themselves. Federal postal regulations require the mailbox patron to remove any obstructions, including snow, which make delivery difficult. Using one of the approved mailbox supports is highly recommended, as it will allow clearing under or near the mailbox without damage during a normal plowing operation. When there is a heavy accumulation of snow, the location of mailboxes close to the roadway makes the push back operations of the City’s Public Works staff difficult and renders the boxes quite susceptible to damage as a result of plowing operations. It shall be the City’s policy to use special care and consideration when plowing snow in the vicinity of mailboxes. State law now requires all mailbox supports be of a breakaway design. Mailboxes can be especially vulnerable to damage from show removal operations. The City assumes liability for mailboxes damaged during plowing, if it is determined that the plow make made direct contact with a mailbox that was properly placed and of an approved installation. To be properly placed, a mailbox should be installed so its bottom edge is 45” to 48” above street level, with the post 48” back from the curb or front of the box. That amount of clearance is necessary to keep the plow’s wing from hitting the box. If there are any plastic newspaper tubes attached to the mailbox, they must also be above the minimum 45” height requirement. The box’s post should be securely in the ground. The responsibility for repairing mailbox damage lies with the homeowner, not the City, If if mailboxes are not installed with the clearance mentioned above or damage is the result of snow impact and not direct contact by a City plow, the responsibility for repairing any damage lies with the homeowner, not the City. The City will replace mailboxes damaged from direct contact by a City plow with a standard metal mailboxes installed properly on an approved swing-away posts (roadways with posted speed limit of 40 mph or greater) or a 4 x 4 wooden post (roadways with posted speed limits under 40 mph). Alternatively, the City will provide a maximum reimbursement of up to eighty dollars ($80.00) in compensation if the owner prefers to repair their mailbox. The City WILL NOT pay for the replacement cost of for a decorative or custom mailboxes. 10. RESPONSIBILITY OF RESIDENTS Snowstorms create numerous problems and inconveniences. This policy has identified streets, sidewalks, parking lots and ice rinks that the City will clear. The residents will also have certain responsibilities. These include clearing their own driveways and private sidewalks, clearing areas for refuse containers, clearing around mailboxes and/or newspaper tubes and fire hydrants adjacent to or located upon their property. These areas must be cleared without depositing any snow into the street. The practice of moving snow from driveways into the street causes a very serious traffic problem. When the snow freezes and a vehicle hits a rough spot, it could be thrown out of control and an accident might occur. It is prohibited to blow, shovel or plow any snow back onto, or across any City street. Snow must not be accumulated into any large piles that obstruct vision or driveways or walks. Refuse containers must not be placed on the street surfaces. The City will not clear private drives or walks. Snowplowing can cause additional snow to be deposited in driveway approaches and around roadside obstacles. Operators are instructed to attempt to minimize these instances; however, it is not practical to eliminate this situation. Residents must be aware they will be responsible for the subsequent clearing of their driveways after their street has been plowed. 11. COMPLAINTS Complaints regarding snow and ice control or damage shall be taken during normal working hours and handled in accordance with the City’s normal complaint procedure. High priority complaints (those involving access to property or problems requiring immediate attention) shall be handled on a priority basis. The Public Works Department will attempt to limit rResponse time should notto exceed twenty-four (24) hours for any complaint. It should be understood that complaint responses are to ensure that the provisions of this policy have been fulfilled and that all residents of the City have been treated uniformly. It is the City’s intention to log all complaints and upgrade this policy as necessary in consideration of the constraints of our resources. 12. PARKING REGULATIONS Arden Hills Code of Ordinances Section 800.03 Parking Regulations contains the following provisions relevant to snow and ice control operations. Subd. 1. Winter Parking Regulations – Except in compliance with the directions of a law enforcement officer or in compliance with regulatory parking signs placed by law enforcement officers or employees of the City, no vehicle shall be parked on the improved portion of any street or highway in the City during the period of time commencing immediately after the accumulation thereon of two or more inches of snow and continuing thereafter until snow removal or plowing has been completed. Subd. 2. Overnight Parking – No vehicles shall be parked on any street for more than 30 minutes between the hours of 2:00 a.m. and 6:00 a.m. Parking in Residential Districts. – Parking in residential districts shall be limited to the use of the occupants of those residences and their guests. Subd. 5. Parking on Public Streets – Parking on public streets shall not exceed six hours. Subd. 6. Vehicles over 12,000 Pounds – No motor vehicle or trailer with a rated gross weight exceeding 12,000 pounds shall be parked or stored in a residential zone except when loading, unloading or rendering a service. Subd. 7. Parking on Boulevard Prohibited – No motor vehicle shall park upon the boulevard of any public street. Subd. 8. Setbacks from Intersection –Parking shall be set back from street intersections as follows: 1. Twenty (20) feet from crosswalk of any uncontrolled intersection; 2. Thirty (30) feet from crosswalk of any controlled intersection; and 3. Twenty (20) feet from any intersection without marked crosswalk. Subd. 9. Administrative Procedures – The city administrator shall adopt, from time to time, procedures to provide for the safe and consistent application of the parking regulations. The City Administrator may grant variances from the application of parking regulations provided that the variances can be allowed without creating a safety hazard. Administrative variances shall be in writing and shall state the specific time limits during which the variation will be allowed to occur. Page 1 of 2 CONSENT ITEM – 7G MEMORANDUM DATE: September 28, 2020 TO: Honorable Mayor and City Councilmembers Dave Perrault, City Administrator FROM: Todd Blomstrom, Public Works Director/City Engineer SUBJECT: Professional Services Agreement with HR Green for Risk & Resilience Assessment Budgeted Amount: Actual Amount: Funding Source: $0 $14,800 Water Utility Fund Council Should Consider The City Council is requested to consider approval of a professional services agreement with HR Green in the amount of $14,800 to prepare a risk and resilience assessment in response to regulatory mandates. Background/Discussion In October 2018, America's Water Infrastructure Act (AWIA) was signed into law. The law requires community drinking water systems serving more than 3,300 people to conduct risk and resilience assessments and update emergency response plans. This regulatory mandate must be addressed by June 30, 2021 for communities serving less than 50,000 people. In general, the AWIA risk and resilience assessments process includes: Risks to the water system from malevolent acts and natural hazards Resilience of system components Monitoring practices for such things as operations, water quality, energy, and security Financial Infrastructure of the Utility Use, storage, and handling of various chemicals Operations and maintenance Staff has negotiated a proposal with HR Green to prepare the required risk and resilience assessment for submittal to the US EPA as provided in Attachment A. HR Green has key personnel with background and experience to efficiently complete the assessment for Arden Hills. Page 2 of 2 Budget Impact The total fee for the scope of work outlined in the proposal is $14,800. The 2020 operating budget for the water utility did not specifically include funding to address this regulatory mandate. However, the water utility fund has sufficient fund balance to cover the expense for preparing the risk and resilience assessment. Attachments Attachment A: HR Green Proposal 2550 University Avenue West | Suite 400N | St. Paul, MN 55114 Main 651.644.4389 + Fax 651.644.9446 HRGREEN.COM August 14, 2020 Mr. Todd Blomstrom, PE Public Works Director City of Arden Hills 1245 West Highway 96 Arden Hills, MN 55112 Re: Proposal to Complete a Risk and Resilience Assessment for the City of Arden Hills Dear Mr. Blomstrom: HR Green, Inc. (HR Green) is pleased to provide you with our proposal to complete a Risk and Resilience Assessment for the City of Arden Hills. Since its founding in 1913, HR Green’s 500+ staff have enjoyed a reputation for innovation, community leadership, and accountability to the engineering and business concerns of its clients. Our local staff includes one of the largest and most experienced water engineering teams in the state. Our team has assisted similar Minnesota communities with completing the previously required Vulnerability Assessments (VAs) including at Stillwater, Minnetonka, Forest Lake, Columbus, Kenyon, Cottage Grove, Inver Grove Heights, Mankato, and White Bear Township. HR Green is very interested and are uniquely qualified to help the City of Arden Hills complete your Risk and Resilience Assessment (RRA) in compliance with the requirements of the American Water Infrastructure Act of 2018 (AWIA). Locally, Verne Jacobsen, PE has completed numerous VAs and RRAs in the past will be a resource for us in completing the RRA for the City of Arden Hills. In addition, Ravi Jayaraman has completed the AWWA Utility Risk and Resilience Certificate Program and completed multiple RRAs since then. Ravi will serve as QA/QC on this project. We believe the combination of our technical experience and understanding of this work makes HR Green best suited to complete this project for the City of Arden Hills. We offer the following for your consideration: 1. Familiarity with City & Water System– HR Green has successfully completed several Capital Improvement Projects for the City of Arden Hills, including work on the same infrastructure that is going to be evaluated with this project. 2 2. Technical Experience – We have completed numerous VAs and RRAs for other similar sized communities around the region. With the experience of these projects, we are up to speed with the requirements of the AWIA and ready to assist the City of Arden Hills with the RRA. We have developed detailed spreadsheets to assist with completing the RRA using the USEPA VSAT 2.0 Tool and the AWWA Cybersecurity Tool and can hit the ground running. The City will benefit from the efficiency and effectiveness of the experience of HR Green. 3. Responsiveness and Project Delivery – HR Green is careful not to oversell our engineering services. When we submit a proposal for your project, you can be certain we have the resources and technical knowledge to excel. HR Green will rely on Arden Hill’s staff to be an integral part of the team; we listen when you make suggestions. Our goal is to respond to your water needs as if they were our own. We understand the importance of having a unified approach among all levels of staff when it comes to planning for the future of your infrastructure. Our approach is be proactive and offer numerous opportunities for all City staff to interact and provide input throughout the RRA process. This allows us to obtain valuable feedback from your staff. We thank you for the opportunity to present our proposal and once again work with the City of Arden Hills. Within our submittal, we have included detailed information on our RRA staff and the experience that they will bring to the project. Thank you for your thoughtful consideration. If you require additional information or have any questions, please contact myself at 651-500-2750 or charrington@hrgreen.com. Sincerely, HR GREEN, INC Chris Harrington, PE Associate & Project Manager Version 2.1 02212019 PROFESSIONAL SERVICES AGREEMENT For Potable Water System Risk and Resilience Assessment Todd Blomstrom, PE City of Arden Hills 1245 West Highway 96 Arden Hills, MN 651-792-7846 Chris Harrington, PE Associate & Project Manager HR Green, Inc. 2550 University Ave W., Suite 400N St. Paul, MN 55114-2015 HR Green Project Number – 201067 August 14, 2020 Version2.1 02212019 TABLE OF CONTENTS 1.0 PROJECT UNDERSTANDING 2.0 SCOPE OF SERVICES 3.0 DELIVERABLES AND SCHEDULES INCLUDED IN THIS AGREEMENT 4.0 ITEMS NOT INCLUDED IN AGREEMENT/SUPPLEMENTAL SERVICES 5.0 SERVICES BY OTHERS 6.0 CLIENT RESPONSIBILITIES 7.0 PROFESSIONAL SERVICES FEE 8.0 TERMS AND CONDITIONS Professional Services Agreement Risk and Resilience Assessment Page 1 of 12 Version2.1 02212019 THIS AGREEMENT is between CITY OF ARDEN HILLS (hereafter “CLIENT”) and HR GREEN, INC. (hereafter "COMPANY"). 1.0 Project Understanding 1.1 General Understanding The America’s Water Infrastructure Act of 2018 (AWIA) requires community water systems serving more than 3,300 people to conduct a Risk and Resilience Assessment (RRA). The communities have to submit a certification to the U.S. Environmental Protection Agency (U.S. EPA) for each RRA. In general, the AWIA considerations for RRA include: RRA • Risks to the water system from malevolent acts and natural hazards • Resilience of system components • Monitoring practices for such things as operations, water quality, energy, and security • Financial Infrastructure of the Utility • Use, storage, and handling of various chemicals • Operations and maintenance In response to the requirements of AWIA, CLIENT seeks assistance with conducting an RRA. Based on the population served by the CLIENT, the RRA needs to be completed and certification submitted to U.S. EPA by June 30, 2021. Subsequent to the RRA an Emergency Response Plan (ERP) needs to be completed within 6 months of the RRA, but no later than December 30, 2021. Following completion of the RRA we will work with you create a new agreement to complete that work given that the scope and schedule will be determined by what is learned during the course of completing the RRA. The RRA will be accomplished in a collaborative manner in which COMPANY and appropriate representatives of the CLIENT would participate. The CLIENT has retained COMPANY to complete an RRA for the water facilities listed below: 1. Two (2) Elevated Storage Tanks 2. One (1) Booster Pump Station (Located on Same Site as One Elevated Storage Tank) 1.2 Design Criteria/Assumptions • The project will follow the Risk Assessment Methodology detailed in AWWA J-100- 10: Risk and Resilience Management of Water and Wastewater Systems to complete the Risk and Resilience Assessment (RRA). • According to the AWWA J-100 methodology, the steps to be completed are as follows: 1. Asset Characterization – identify critical assets 2. Threat Characterization – select appropriate threats and hazards 3. Consequence Analysis – calculate consequences for each threat-asset pair 4. Vulnerability Analysis – estimate effectiveness of existing mitigation measures 5. Threat Likelihood Analysis – calculate threat likelihood Professional Services Agreement Risk and Resilience Assessment Page 2 of 12 Version2.1 02212019 6. Risk and Resilience Analysis – calculate baseline risk and resilience • Each major task will include specific work products and deliverables. • Review workshops will be conducted with the CLIENT’s personnel, key individuals from the COMPANY’s project team, and others as needed at critical milestones as identified in the following section. • Complete RRA using USEPA VSAT Web 2.0 Tool. 2.0 Scope of Services The CLIENT agrees to employ COMPANY to perform the following services: 2.1 Project Coordination and Management • COMPANY shall provide project management services for duration of the project (Anticipated to be 6 months). • Project Kick-off Meeting: Schedule a project kick-off meeting with the CLIENT staff to discuss in detail the tasks associated with the RRA. • To recognize the current uncertainty with COVID-19, we will minimize our face-to- face meetings and site visits as much as appropriate to complete this work while practicing social distancing recommendations by the Centers for Disease Control and Prevention. Although site visits are still recommended to complete a holistic risk and resilience assessment, these visits will be completed during a time when COVID-19 risks are low. Further, the Kick-off Meeting, Workshop, and various other meetings to discuss draft reports can be completed using video conferencing. At the time of the notice to proceed, COMPANY will coordinate with the CLIENT to understand CLIENT preferences for face-to-face or video conference meetings and to schedule the most appropriate time for a site visit. 2.2 Risk and Resilience Assessment (RRA) 2.2.1 Asset Characterization The first step in the RRA, is asset characterization. As part of the AWIA requirements, each utility must identify critical assets within the following ten asset categories: 1. Physical Barriers 2. Source water 3. Pipes and constructed conveyances, water collection, and intake 4. Pretreatment and treatment 5. Storage and distribution facilities 6. Electronic, computer, or other automated systems (including the security of such systems) 7. Monitoring practices 8. Financial infrastructure 9. The use, storage, or handling of chemicals 10. The operation and maintenance of the system Professional Services Agreement Risk and Resilience Assessment Page 3 of 12 Version2.1 02212019 COMPANY has the following approach for asset characterization: i. COMPANY will conduct a system evaluation for the water system assets identified at the above facilities. The evaluation will result in documentation of the function, communication, control, power, and existing security measures at each facility. COMPANY will provide a photo log within the RRA. Site visits will include one COMPANY team member, two days (2) days are planned for this effort. ii. COMPANY staff will identify and document the following items for each facility: SCADA systems, entry control procedures, hazardous chemicals, and interdependences of treatment systems, power systems, and communication systems. iii. COMPANY will develop a preliminary critical asset characterization based on the site visits. COMPANY and CLIENT will have a workshop to discuss whether the CLIENT agrees with the preliminary asset characterization and whether any assets should be added or removed. The workshop attendees will include no more than two COMPANY team members, and four (4) hours planned for this workshop. 2.2.2 Threat Characterization The second step is to perform threat characterization. As a guideline, EPA has identified threat categories for malevolent acts, natural hazards, and dependency/proximity threats. Each critical asset will be assigned the most relevant and probable threats that may adversely affect CLIENT facilities. i. COMPANY will first assign 2-3 of the most likely threat scenarios to pair with each critical asset based on the initial site visit and CLIENT staff discussions. ii. COMPANY and CLIENT will have a workshop (see 2.2.1.iii) to discuss whether the CLIENT agrees with the preliminary threat assignments for each critical asset and whether other threat scenarios should be added. Based on CLIENT input, COMPANY will make adjustments and finalize the threat characterization analysis. 2.2.3 Vulnerability Analysis The Vulnerability Analysis estimates the likelihood that each specific threat or hazard, given it occurs, will damage the asset while considering the utility’s existing countermeasures. Vulnerability analysis involves an examination of existing security capabilities and structural components, as well as counter measures/mitigation measures and their effectiveness in reducing damages from threats and hazards. i. COMPANY and CLIENT will have a workshop (see 2.2.1.iii) to assess the utility’s ability to detect, delay, and respond to the threats assigned to each critical asset. 2.2.4 Threat Analysis Threat analysis estimates the likelihood of malevolent attack, dependency/proximity hazard, or natural hazard based on several factors for threat likelihood. Professional Services Agreement Risk and Resilience Assessment Page 4 of 12 Version2.1 02212019 i. The threat analysis will be developed in-house after obtaining some additional information on threat likelihood factors from the CLIENT during the workshop discussed in 2.2.1.iii. 2.2.5 Consequence Analysis Consequence analysis is the identification and estimation of reasonable consequences generated by each specific threat-asset combination. Consequences that are quantified include utility financial consequences (asset replacement costs, remediation costs and revenue lost), regional economic consequences (regional economy impacts due to service outages), and public health impacts (injuries and fatalities). The consequence analysis will be completed in-house. i. If data is available, CLIENT will provide COMPANY with original construction costs associated with all critical assets. COMPANY will calculate the present worth of the provided construction cost data to estimate an asset replacement cost. ii. If CLIENT, does not have original construction cost data, COMPANY will provide approximate cost estimates for critical asset replacement. COMPANY will develop the cost estimates as an additional service. iii. COMPANY will develop a consequence matrix, which will include the assumptions made to quantify consequences. 2.2.6 Risk and Resilience Analysis Once the above steps are completed, the risk and resilience analysis is conducted. The risk and resilience analysis will calculate a baseline risk for each asset/threat pair, quantified as a monetary value. Risk and Resilience analysis creates the foundation for selecting strategies and tactics to counter or mitigate disabling events by establishing priorities based on the levels of risk and resilience and the extent they can be improved. The risk and resilience analysis will be completed in-house. 2.2.7 Submit Draft RRA to CLIENT Upon completion of an internal quality control review, COMPANY will submit two hard copies of the draft RRA to CLIENT for review. A meeting will be held to discuss the results of the RRA and obtain CLIENT comments. 2.2.8 Finalize RRA and Submittal of Certification to U.S. EPA The CLIENT review comments on the draft RRA will be incorporated and final RRA will be submitted to CLIENT. Two hard copies will be submitted to the CLIENT. CLIENT to submit certification to U.S. EPA per Agency guidelines that the RRA has been completed. Professional Services Agreement Risk and Resilience Assessment Page 5 of 12 Version2.1 02212019 3.0 Deliverables and Schedules Included in this Agreement Notice to Proceed: TBD by OWNER Workshop #1 for Risk and Resilience Assessment (RRA) ................ 8 Weeks after NTP Submit draft RRA to the OWNER ...................................................... 16 Weeks after NTP Meeting to discuss draft RRA ............................................................ 18 Weeks after NTP Submit final RRA to the OWNER ....................................................... 22 Weeks after NTP This schedule was prepared to include reasonable allowances for review and approval times required by the CLIENT and public authorities having jurisdiction over the project. This schedule shall be equitably adjusted as the project progresses, allowing for changes in the scope of the project requested by the CLIENT or for delays or other causes beyond the control of COMPANY. 4.0 Items not included in Agreement/Supplemental Services The following items are not included as part of this agreement: 1. Develop cost estimates for critical asset replacement. 2. Countermeasure Analysis Assessment, which is considered optional by the EPA VSAT Web 2.0 tool. Supplemental services not included in the agreement can be provided by COMPANY under separate agreement, if desired. 5.0 Services by Others N/A 6.0 Client Responsibilities 1. Access to CLIENT’s facilities for data collection 2. Provide copies of previous Vulnerability Assessment. 3. Provide timely review of draft submittals 4. Provide personnel knowledgeable about operations and maintenance of facilities to be available for discussions, accompany COMPANY on site visits, and to answer questions. 5. Provide data on past construction costs for existing critical assets. 6. Submit RRA and certification to US EPA that the RRA has been completed. 7.0 Professional Services Fee 7.1 Fees The fee for services will be based on COMPANY standard hourly rates current at the time the Agreement is signed. These standard hourly rates are subject to change upon 30 days’ written notice. Non-salary expenses directly attributable to the project such as: (i) living and traveling expenses of employees when away from the home office on business connected Professional Services Agreement Risk and Resilience Assessment Page 6 of 12 Version2.1 02212019 with the project; (ii) identifiable communication expenses; (iii) identifiable reproduction costs applicable to the work; and (iv) outside services will be charged in accordance with the rates current at the time the service is done. 7.2 Invoices Invoices for COMPANY’s services shall be submitted, on a monthly basis. Invoices shall be due and payable upon receipt. If any invoice is not paid within 15 days, COMPANY may, without waiving any claim or right against the CLIENT, and without liability whatsoever to the CLIENT, suspend or terminate the performance of services. The retainer shall be credited on the final invoice. Accounts unpaid 30 days after the invoice date may be subject to a monthly service charge of 1.5% (or the maximum legal rate) on the unpaid balance. In the event that any portion of an account remains unpaid 60 days after the billing, COMPANY may institute collection action and the CLIENT shall pay all costs of collection, including reasonable attorney’s fees. 7.3 Extra Services Any service required but not included as part of this Agreement shall be considered extra services. Extra services will be billed on a Time and Material basis with prior approval of the CLIENT. 7.4 Exclusion This fee does not include attendance at any meetings or public hearings other than those specifically listed in the Scope of Services. These service items are considered extra and are billed separately on an hourly basis. 7.5 Payment The CLIENT AGREES to pay COMPANY on the following basis: Per current Rate Schedule with a not-to-exceed fee of $14,800. Professional Services Agreement Risk and Resilience Assessment Page 7 of 12 Version2.1 02212019 8.0 Terms and Conditions The following Terms and Conditions are incorporated into this Agreement and made a part of it. 8.1 Standard of Care Services provided by COMPANY under this Agreement will be performed in a manner consistent with that degree of care and skill ordinarily exercised by members of the same profession currently practicing at the same time and in the same or similar locality. 8.2 Entire Agreement This Agreement and its attachments constitute the entire understanding between CLIENT and COMPANY relating to COMPANY’s services. Any prior or contemporaneous agreements, promises, negotiations, or representations not expressly set forth herein are of no effect. Subsequent modifications or amendments to this Agreement shall be in writing and signed by the parties to this Agreement. If the CLIENT, its officers, agents, or employees request COMPANY to perform extra services pursuant to this Agreement, CLIENT will pay for the additional services even though an additional written agreement is not issued or signed. 8.3 Time Limit and Commencement of Services This Agreement must be executed within ninety (90) days to be accepted under the terms set forth herein. The services will be commenced immediately upon receipt of this signed Agreement. 8.4 Suspension of Services If the Project or the COMPANY’S services are suspended by the CLIENT for more than thirty (30) calendar days, consecutive or in the aggregate, over the term of this Agreement, the COMPANY shall be compensated for all services performed and reimbursable expenses incurred prior to the receipt of notice of suspension. In addition, upon resumption of services, the CLIENT shall compensate the COMPANY for ex penses incurred as a result of the suspension and resumption of its services, and the COMPANY’S schedule and fees for the remainder of the Project shall be equitably adjusted. If the COMPANY’S services are suspended for more than ninety (90) days, consecutive or in the aggregate, the COMPANY may terminate this Agreement upon giving not less than five (5) calendar days' written notice to the CLIENT. If the CLIENT is in breach of this Agreement, the COMPANY may suspend performance of services upon five (5) calendar days' notice to the CLIENT. The COMPANY shall have no liability to the CLIENT and the CLIENT agrees to make no claim for any delay or damage as a result of such suspension caused by any breach of this Agreement by the CLIENT. Upon receipt of payment in full of all outstanding sums due from the CLIENT, or curing of such other breach which caused the COMPANY to suspend services, the COMPANY shall resume services and there shall be an equitable adjustment to the remaining project schedule and fees as a result of the suspension. 8.5 Books and Accounts COMPANY will maintain books and accounts of payroll costs, travel, subsistence, field, and incidental expenses for a period of five (5) years. Said books and accounts will be available at all reasonable times for examination by CLIENT at the corporate office of COMPANY during that time. 8.6 Insurance COMPANY will maintain insurance for claims under the Worker's Compensation Laws, and from General Liability and Automobile claims for bodily injury, death, or property damage, and Professional Liability insurance caused by the negligent performance by COMPANY's employees of the functions and services required under this Agreement. 8.7 Termination or Abandonment Either party has the option to terminate this Agreement. In the event of failure by the other party to perform in accordance with the terms hereof through no fault of the terminating party, then the obligation to provide further services under this Agreement may be terminated upon seven (7) days’ written notice. If any portion of the services is terminated or abandoned by CLIENT, the provisions of this Schedule of Fees and Conditions in regard to compensation and payment shall apply insofar as possible to that portion of the services not terminated or abandoned. If said termination occurs prior to completion of any phase of the project, the fee for services Professional Services Agreement Risk and Resilience Assessment Page 8 of 12 Version2.1 02212019 performed during such phase shall be based on COMPANY's reasonable estimate of the portion of such phase completed prior to said termination, plus a reasonable amount to reimburse COMPANY for termination costs. 8.8 Waiver COMPANY's waiver of any term, condition, or covenant or breach of any term, condition, or covenant, shall not constitute a waiver of any other term, condition, or covenant, or the breach thereof. 8.9 Severability If any provision of this Agreement is declared invalid, illegal, or incapable of being enforced by any Court of competent jurisdiction, all of the remaining provisions of this Agreement shall nevertheless continue in full force and effect, and no provision shall be deemed dependent upon any other provision unless so expressed herein. 8.10 Successors and Assigns All of the terms, conditions, and provisions hereof shall inure to the benefit of and are binding upon the parties hereto, and their respective successors and assigns, provided, however, that no assignment of this Agreement shall be made without written consent of the parties to this Agreement. 8.11 Third-Party Beneficiaries Nothing contained in this Agreement shall create a contractual relationship with or a cause of action in favor of a third party against either the CLIENT or the COMPANY. The COMPANY’s services under this Agreement are being performed solely for the CLIENT’s benefit, and no other party or entity shall have any claim against the COMPANY because of this Agreement or the performance or nonperformance of services hereunder. The CLIENT and COMPANY agree to require a similar provision in all contracts with contractors, subcontractors, sub-consultants, vendors and other entities involved in this project to carry out the intent of this provision. 8.12 Governing Law and Jurisdiction The CLIENT and the COMPANY agree that this Agreement and any legal actions concerning its validity, interpretation and performance shall be governed by the laws of the S tate of Minnesota without regard to any conflict of law provisions, which may apply the laws of other jurisdictions. It is further agreed that any legal action between the CLIENT and the COMPANY arising out of this Agreement or the performance of the services shall be brought in a court of competent jurisdiction in the State of Minnesota. 8.13 Dispute Resolution Mediation. In an effort to resolve any conflicts that arise during the design or construction of the project or following the completion of the project, the CLIENT and COMPANY agree that all disputes between them arising out of or relating to this Agreement shall be su bmitted to non-binding mediation unless the parties mutually agree otherwise. The CLIENT and COMPANY further agree to include a similar mediation provision in all agreements with independent contractors and consultants retained for the project and to requi re all independent contractors and consultants also to include a similar mediation provision in all agreements with subcontractors, sub-consultants, suppliers or fabricators so retained, thereby providing for mediation as the primary method for dispute resolution between the parties to those agreements. 8.14 Attorney’s Fees If litigation arises for purposes of collecting fees or expenses due under this Agreement, the Court in such litigation shall award reasonable costs and expenses, including attorney fees, to the party justly entitled thereto. In awarding attorney fees, the Court shall not be bound by any Court fee schedule, but shall, in the interest of justice, award the full amount of costs, expenses, and attorney fees paid or incurred in good faith. 8.15 Ownership of Instruments of Service All reports, plans, specifications, field data, field notes, laboratory test data, calculations, estimates and other documents including all documents on electronic media prepared by COMPANY as instruments of service shall remain the property of COMPANY. COMPANY shall retain these records for a period of five (5) years following completion/submission of the records, during which period they will be made available to the CLIENT at all reasonable times. 8.16 Reuse of Documents All project documents including, but not limited to, plans and specifications furnished by COMPANY under this project are intended for use on this project only. Any reuse, without specific written verification or adoption by Professional Services Agreement Risk and Resilience Assessment Page 9 of 12 Version2.1 02212019 COMPANY, shall be at the CLIENT's sole risk, and CLIENT shall defend, indemnify and hold harmless COMPANY from all claims, damages and expenses including attorney's fees arising out of or resulting therefrom. Under no circumstances shall delivery of electronic files for use by the CLIENT be deemed a sale by the COMPANY, and the COMPANY makes no warranties, either express or implied, of merchantability and fitness for any particular purpose. In no event shall the COMPANY be liable for indirect or consequential damages as a result of the CLIENT’s use or reuse of the electronic files. 8.17 Failure to Abide by Design Documents or To Obtain Guidance The CLIENT agrees that it would be unfair to hold COMPANY liable for problems that might occur should COMPANY’S plans, specifications or design intents not be followed, or for problems resulting from others' failure to obtain and/or follow COMPANY’S guidance with respect to any errors, omissions, inconsistencies, ambiguities or conflicts which are detected or alleged to exist in or as a consequence o f implementing COMPANY’S plans, specifications or other Instruments of Service. Accordingly, the CLIENT waives any claim against COMPANY, and agrees to defend, indemnify and hold COMPANY harmless from any claim for injury or losses that results from failure to follow COMPANY’S plans, specifications or design intent, or for failure to obtain and/or follow COMPANY’S guidance with respect to any alleged errors, omissions, inconsistencies, ambiguities or conflicts contained within or arising as a result of implementing COMPANY’S plans, specifications or other Instruments of Service. The CLIENT also agrees to compensate COMPANY for any time spent and expenses incurred remedying CLIENT’s failures according to COMPANY’S prevailing fee schedule and expense reimbursement policy. 8.18 Opinion of Probable Construction Cost As part of the Deliverables, COMPANY may submit to the CLIENT an opinion of probable cost required to construct work recommended, designed, or specified by COMPANY, if required by CLIENT. COMPANY is not a construction cost estimator or construction contractor, nor should COMPANY’S rendering an opinion of probable construction costs be considered equivalent to the nature and extent of service a construction cost estimator or construction contractor would provide. This requires COMPANY to make a number of assumptions as to actual conditions that will be encountered on site; the specific decisions of other design professionals engaged; the means and methods of construction the contractor will employ; the co st and extent of labor, equipment and materials the contractor will employ; contractor's techniques in determining prices and market conditions at the time, and other factors over which COMPANY has no control. Given the assumptions which must be made, COMPANY cannot guarantee the accuracy of its opinions of cost, and in recognition of that fact, the CLIENT waives any claim against COMPANY relative to the accuracy of COMPANY’S opinion of probable construction cost. 8.19 Design Information in Electronic Form Because electronic file information can be easily altered, corrupted, or modified by other parties, either intentionally or inadvertently, without notice or indication, COMPANY reserves the right to remove itself from its ownership and/or involvement in the material from each electronic medium not held in its possession. CLIENT shall retain copies of the work performed by COMPANY in electronic form only for information and use by CLIENT for the specific purpose for which COMPANY was engaged. Said material shall not be used by CLIENT or transferred to any other party, for use in other projects, additions to this project, or any other purpose for which the material was not strictly intended by COMPANY without COMPANY’s express written permission. Any unauthorized use or reuse or modifications of this material shall be at CLIENT’S sole risk. Furthermore, the CLIENT agrees to defend, indemnify, and hold COMPANY harmless from all claims, injuries, damages, losses, expenses, and attorney's fees arising out of the modification or reuse of these materials. The CLIENT recognizes that designs, plans, and data stored on electronic media including, but not limited to computer disk, magnetic tape, or files transferred via email, may be subject to undetectable alteration and/o r uncontrollable deterioration. The CLIENT, therefore, agrees that COMPANY shall not be liable for the completeness or accuracy of any materials provided on electronic media after a 30 day inspection period, during which time COMPANY shall correct any errors detected by the CLIENT to complete the design in accordance with the intent of the contract and specifications. After 40 days, at the request of the CLIENT, COMPANY shall submit a final set of sealed drawings, and any additional services to be perform ed by COMPANY relative to the submitted electronic materials shall be subject to separate Agreement. The CLIENT is aware that differences may exist between the electronic files delivered and the printed hard-copy construction documents. In the event of a conflict between the signed construction documents prepared by the COMPANY and electronic files, the signed or sealed hard-copy construction documents shall govern. Professional Services Agreement Risk and Resilience Assessment Page 10 of 12 Version2.1 02212019 8.20 Information Provided by Others The CLIENT shall furnish, at the CLIENT’s expense, all information, requirements, reports, data, surveys and instructions required by this Agreement. The COMPANY may use such information, requirements, reports, data, surveys and instructions in performing its services and is entitled to rely upon the accuracy and completeness thereof. The COMPANY shall not be held responsible for any errors or omissions that may arise as a result of erroneous or incomplete information provided by the CLIENT and/or the CLIENT’s consultants and contractors. COMPANY is not responsible for accuracy of any plans, surveys or information of any type including electronic media prepared by any other consultants, etc. provided to COMPANY for use in preparation of plans. The CLIENT agrees, to the fullest extent permitted by law, to indemnify and hold harmless the COMPANY from any damages, liabilities, or costs, including reasonable attorneys’ fees and defense costs, arising out of or connected in any way with the services performed by other consultants engaged by the CLIENT. COMPANY is not responsible for accuracy of topographic surveys provided by others. A field check of a topographic survey provided by others will not be done under this Agreement unless indicated in the Scope of Services. 8.21 Force Majeure The CLIENT agrees that the COMPANY is not responsible for damages arising directly or indirectly from any delays for causes beyond the COMPANY's control. CLIENT agrees to defend, indemnify, and hold COMPANY, its consultants, agents, and employees harmless from any and all liability, other th an that caused by the negligent acts, errors, or omissions of COMPANY, arising out of or resulting from the same. For purposes of this Agreement, such causes include, but are not limited to, strikes or other labor disputes; severe weather disruptions or other natural disasters or acts of God; disease, epidemic or pandemic, fires, riots, war or other emergencies; failure of any government agency to act in timely manner; failure of performance by the CLIENT or the CLIENT’S contractors or consultants; or discovery of any hazardous substances or differing site conditions. Severe weather disruptions include but are not limited to extensive rain, high winds, snow greater than two (2) inches and ice. In addition, if the delays resulting from any such causes incr ease the cost or time required by the COMPANY to perform its services in an orderly and efficient manner, the COMPANY shall be entitled to a reasonable adjustment in schedule and compensation. 8.22 Job Site Visits and Safety Neither the professional activities of COMPANY, nor the presence of COMPANY’S employees and sub- consultants at a construction site, shall relieve the General Contractor and any other entity of their obligations, duties and responsibilities including, but not limited to, construction means, m ethods, sequence, techniques or procedures necessary for performing, superintending or coordinating all portions of the work of construction in accordance with the contract documents and any health or safety precautions required by any regulatory agencies. COMPANY and its personnel have no authority to exercise any control over any construction contractor or other entity or their employees in connection with their work or any health or safety precautions. The CLIENT agrees that the General Contractor is solely responsible for job site safety, and warrants that this intent shall be made evident in the CLIENT's AGREEMENT with the General Contractor. The CLIENT also agrees that the CLIENT, COMPANY and COMPANY’S consultants shall be indemnified and shall be m ade additional insureds on the General Contractor’s and all subcontractor’s general liability policies on a primary and non-contributory basis. 8.23 Hazardous Materials CLIENT hereby understands and agrees that COMPANY has not created nor contributed to the cre ation or existence of any or all types of hazardous or toxic wastes, materials, chemical compounds, or substances, or any other type of environmental hazard or pollution, whether latent or patent, at CLIENT's premises, or in connection with or related to this project with respect to which COMPANY has been retained to provide professional engineering services. The compensation to be paid COMPANY for said professional engineering services is in no way commensurate with, and has not been calculated with refer ence to, the potential risk of injury or loss which may be caused by the exposure of persons or property to such substances or conditions. Therefore, to the fullest extent permitted by law, CLIENT agrees to defend, indemnify, and hold COMPANY, its officers, directors, employees, and consultants, harmless from and against any and all claims, damages, and expenses, whether direct, indirect, or consequential, including, but not limited to, attorney fees and Court costs, arising out of, or resulting from the discharge, escape, release, or saturation of smoke, vapors, soot, fumes, acid, alkalis, toxic chemicals, liquids gases, or any other materi als, irritants, contaminants, or pollutants in or Professional Services Agreement Risk and Resilience Assessment Page 11 of 12 Version2.1 02212019 into the atmosphere, or on, onto, upon, in, or into the surface or subsurface of soil, water, or watercourses, objects, or any tangible or intangible matter, whether sudden or not. It is acknowledged by both parties that COMPANY’S scope of services does not include any services related to asbestos or hazardous or toxic materials. In the event COMPANY or any other party encounters asbestos or hazardous or toxic materials at the job site, or should it become known in any way that such materials may be present at the job site or any adjacent areas that may affect the perform ance of COMPANY’S services, COMPANY may, at its option and without liability for consequential or any other damages, suspend performance of services on the project until the CLIENT retains appropriate specialist consultant(s) or contractor(s) to identify, abate and/or remove the asbestos or hazardous or toxic materials, and warrants that the job site is in full compliance with applicable laws and regulations. Nothing contained within this Agreement shall be construed or interpreted as requiring COMPANY to a ssume the status of a generator, storer, transporter, treater, or disposal facility as those terms appear within the Resource Conservation and Recovery Act, 42 U.S.C.A., §6901 et seq., as amended, or within any State statute governing the generation, treatment, storage, and disposal of waste. 8.24 Certificate of Merit The CLIENT shall make no claim for professional negligence, either directly or in a third party claim, against COMPANY unless the CLIENT has first provided COMPANY with a written certification executed by an independent design professional currently practi cing in the same discipline as COMPANY and licensed in the State in which the claim arises. This certification shall: a) contain the name and license number of the certifier; b) specify each and every act or omission that the certifier contends is a viol ation of the standard of care expected of a design professional performing professional services under similar circumstances; and c) state in complete detail the basis for the certifier's opinion that each such act or omission constitutes such a violation. This certificate shall be provided to COMPANY not less than thirty (30) calendar days prior to the presentation of any claim or the institution of any judicial proceeding. 8.25 Limitation of Liability In recognition of the relative risks and benefits of the Project to both the CLIENT and the COMPANY, the risks have been allocated such that the CLIENT agrees, to the fullest extent permitted by law, to limit the liability of the COMPANY and COMPANY’S officers, directors, partners, employees, shareholders, owners and sub- consultants for any and all claims, losses, costs, damages of any nature whatsoever or claims expenses from any cause or causes, including attorney’s fees and costs and expert-witness fees and costs, so that the total aggregate liability of the COMPANY and COMPANY’S officers, directors, partners, employees, shareholders, owners and sub-consultants shall not exceed $50,000.00, or the COMPANY’S total fee for services rendered on this Project, whichever is greater. It is intended that this limitation apply to any and all liability or cause of action however alleged or arising, unless otherwise prohibited by law. 8.26 Municipal Advisor The COMPANY is not a Municipal Advisor registered with the Security and Exchange Commission (SEC) as defined in the Dodd-Frank Wall Street Reform and Consumer Protection Act. When the CLIENT is a municipal entity as defined by said Act, and the CLIENT requires project financing information for the services performed under this Agreement, the CLIENT will provide the COMPANY with a letter detailing who their independent registered municipal advisor is and that the CLIENT will rely on the advice of such advisor. A sample letter can be provided to the CLIENT upon request. Professional Services Agreement Risk and Resilience Assessment Page 12 of 12 Version2.1 02212019 This Agreement is approved and accepted by the CLIENT and COMPANY upon both parties signing and dating the Agreement. Services will not begin until COMPANY receives a signed agreement. COMPANY’s services shall be limited to those expressly set forth in this Agreement and COMPANY shall have no other obligations or responsibilities for the Project except as agreed to in writing. The effective date of the Agreement shall be the last date entered below. HR GREEN, INC. Approved by: Printed/Typed Name: Chris Harrington, PE Title: Associate & Project Manager Date: 08/14/2020 CITY OF ARDEN HILLS Accepted by: Printed/Typed Name: Title: Date: Development of the Risk and Resilience Assessment Arden Hills, MN 1 KEY PERSONNEL AND BACKGROUND Christopher Harrington, PE I Project Manager & Associate EXPERENCE 16 Years EDUCATION MS, Civil Engineering, University of Minnesota, Twin Cities – 2009 BCE, Civil Engineering, University of Minnesota, Twin Cities - 1998 REGISTRATION/LICENSE Professional Engineer, MN, 49831 Chris’ 16 years of experience in civil & environmental engineering consist of working in municipal drinking water services, international development of drinking water systems, wastewater treatment research, civil engineering consulting, and education regarding civil engineering design, water system operation and maintenance, and public health. Chris has served as a technical lead and project manager during planning, design, construction, and troubleshooting of more than a dozen potable water, wastewater and stormwater pump station projects for pressure boosting, wastewater conveyance, flood protection, stream augmentation, irrigation & combined sewer separation. Chris has also presented his projects at CSWEA, MWOA, and AWWA events and has previously served as state section chair for CSWEA. SELECTED PROJECT EXPERIENCE Potable Water & Wastewater SCADA Improvements Design & Construction - City of Arden Hills, MN Pursuit Leader, Project Manager For this project we designed improvements to the City’s utility monitoring and control (SCADA) system. The goals for the project were: (1) to provide Arden Hills with a single monitoring system, for both water and wastewater, possessing technology for both current replacement and future expansion , and (2) to improve the reliability and speed of communication between the water tower and the booster station. We evaluated cellular and radio technologies for communicating between the tower and booster station and settled on dedicated spread spectrum radio telemetry to monitor and report water level, power failure, and intrusion at their water tower. We recommended radio telemetry due to its higher reliability and speed compared to cellular systems. To complete the design we wrote a request for proposals which the City used to use to hire the services of a systems integrator to complete the installation. Booster Pump Transient Analysis Risk Analysis - St. Paul Regional Water Services - St. Paul, MN Pursuit Leader, Project Manager For this project we evaluated the efficacy of a detail that SPRWS requires developers to follow wh en they install booster stations for their development projects. We performed a hydraulic transient analysis that identified the primary causes of added risk of hydraulic transients which included surge tank size, surge tank location, system flow rate, total dynamic head of the system, and the size of the City main feeding the development. Based on our assessment we recommended that SPRWS update the detail to include a surge tank on both sides of booster stations since that arrangement provided the lowest risk to the City piping as well as the piping in the development. We also identified that the current rule of thumb for sizing the surge tanks provides a significant factor of safety to protect against low pressures on both sides of the station. Water Hammer & Corrosion Risk Assessment - Western Lake Superior Sanitary District, MN Pursuit Leader, Project Manager For this project we assessed the interrelated risks of corrosion and hydraulic transients in three of the larger ductile iron force mains in the state of Minnesota. We performed high-speed transient pressure monitoring, hydraulic transient modeling, as well a corrosion risk assessment based on the identifiable causes of corrosion in force mains. We performed our analysis and assessment on the Scanlon Force Main (4.6 miles of 30” and 42” DIP and FRP), Knowlton Creek Force Main (4.9 miles of 48” and 54” DIP), and the Carlton Force Main (2.2 miles of 14” DIP). We provided recommended improvements for all three pipelines to minimize the risk to their infrastructure. Development of the Risk and Resilience Assessment Arden Hills, MN 2 James Sadler I Water Plant Operator EXPERENCE 42 Years REGISTRATION/LICENSE MPCA SB Collection System License (#4519) Class A Water License (#7879) Jim Sadler has recently joined the HR Green team as a Consultant following 42 years of dedicated service to the City of Maple Grove, 25 of which he served as Utilities Supervisor. In addition to his time with the City of Maple Grove Jim spent 15 years as a Captain with the Maple Grove Fire Department, he is the current chair of the Water, Wastewater Advisory Board for the State of MN, past chair of the MN AWWA and a Leonard Thompson Award recipient. He also sat on an MPCA Committee that wrote exam questions for the SB, SC and SD licenses. Jim has written and implemented countless procedures and specs, planned, and executed significant infrastructure improvement projects, and planned and scheduled ongoing system and infrastructure maintenance of all things sanitary sewer and water. He’s played a hands-on role in an array of design and improvements for both systems and infrastructure projects. He has been in the trenches, he knows what to anticipate, and now he brings his expertise to HR Green to assure HR Green is able to provide clients with the systems they need. SELECTED PROJECT EXPERIENCE City of Maple Grove, Maple Grove, MN - November 1976 – March 2018 - Superintendent of Sewer and Water As superintendent of sewer and water for the City of Maple Grove Jim was responsible for the day to day operations of the water and wastewater systems. He oversaw a department of 19, including 12 direct reports, seven indirect reports and nine seasonal indirect reports. Jim was responsible for managing an annual budget of approximately $18M; included in that budget were salaries, system maintenance, operations, equipment purchases and maintenance. During his time as superintendent he played a key role in the strategic planning, design, and construction project management for both a new water treatment pl ant and new maintenance facility as well as numerous ground reservoirs and water towers. The population of Maple Grove grew from 6,500 to 68,000 during his time there, giving Jim a substantial amount of experience with the design, construction and maintena nce of water and wastewater systems. Development of the Risk and Resilience Assessment Arden Hills, MN 3 Verne Jacobsen, PE – Technical Advisor EXPERENCE 60 Years EDUCATION BS, Civil Engineer, Indiana Institute of Technology – 1957 REGISTRATION/LICENSE Professional Engineer, MN, 6988, 1962 Vern has a wealth of water infrastructure experience. He spent 25 years helping water utility clients plan, improve, develop, construct and operate municipal water systems, Prior to this, he spent 34 years with Saint Paul Water Utilities, engineering distribution water system operation, and administering all utility operating divisions. Having witnessed and contributed to ongoing evolution in water system design over the last half century, Verne brings unparalleled expertise in water system design and operations, effective energy utilization, water metering systems, water rates, and financing improvements. His work included major water system improvements for Mankato, Maple Grove, Eden Prairie, Loretto, Luverne, South Saint Paul, Saint Paul Regional Water, Roche ster Public Utilities, and the Stillwater Board of Water Commissioners. SELECTED PROJECT EXPERIENCE Vulnerability Assessments Verne has been completing VAs and RRAs for Minnesota communities for many years and is truly one of the leaders in the State. A partial list of the VAs he has completed in Minnesota include the cities of Stillwater, Minnetonka, Forest Lake, Columbus, Cottage Grove, Kenyon, Inver Grove Heights and White Bear Lake Township. Water Treatment Facilities Sibley Park Water Treatment Plant, Mankato, Minnesota. Project Manager: Provided preliminary design and design and construction services for their water system improvement project. The $25.0M project included the expansion of the Sibley Park Water Treatment Plant from 6 mgd to 1 2 mgd, two additional supply wells, a 3-million- gallon reservoir with booster station, and the rerouting of the Sibley Park access road to improve security at the treatment plant site. The treatment process modifications included the addition of two lime softening solids contact basins, membrane filtration to replace the existing filters, and reconstruction. The project improvements included stand-by generators, a chlorine scrubber, a new high service pump station, raw water collector and distribution mains, and site improvements that include additional parking space. West Water Treatment Plant Expansion, Coon Rapids, Minnesota. Project Engineers: The West Water Treatment Plant was expanded to provide treatment c apacity for two new wells. The plant capacity was increased to 14.4 mgd. A total of eight wells, each with differing chemical requirements are tributary to the plant. Filtronics equipment is used to remove Iron and Manganese from the well water supply. Thi s project also included backwash reclaim, SCADA system, chemical addition, and instrumentation and controls improvements. The high service pumping capacity was also increased. The construction sequence was planned so that the existing treatment facilities could remain in service during the construction of the new facilities. New Pumps of Fridley and McCarrons Pump Stations, Saint Paul. Project Manager : Provided design and construction services for the purchase and installation of a 1,250hp pump at the Fridley River Station and a 1,000hp pump at the McCarrons Pump Station. The project also included replacement of the existing electrical switch gear at the Fridley Station. The purchase of the pumping units was unique, as we developed specifications and worked with the central purchasing agent to allow the purchase and payment for the pumps based on the efficiency. Development of the Risk and Resilience Assessment Arden Hills, MN 4 Ravi Jayaraman, PE - QA/QC EXPERIENCE 30 Years EDUCATION MS, Civil Engineer, University of Oklahoma - 1990 MS, Biological Sciences, Birla Institute of Tech and Science - 1986 BS, Civil Engineering, Birla Institute of Tech and Services - 1986 REGISTRATION / LICENSE Professional Engineer, IL, 062052984 Professional Engineer, IA, 16102 Professional Engineer, IN, PE11200102 Professional Engineer, WI, 35943 Professional Engineer, MI, 6201043013 Ravi Jayaraman, PE will serve as Project Manager for this Vulnerability Assessment. In addition to his experience managing water system Risk and Resilience Assessment (RRA) and Emergency Response Plan (ERP) development projects, Ravi has completed the onli ne course requirements for AWWA Utility Risk and Resilience Certificate Program. Ravi brings over 29 years of project management experience from a variety of public and private sector utility infrastructure projects. He has extensive experience working with contractors to successfully complete projects and elected officials and other community stakeholders affected by infrastructure construction projects. Ravi has the skills to develop and maintain client relationships while directing project budgets and maintaining costs. He led the branch office of a consulting engineering firm and mentored junior staff, developed workload projections and identified opportunities for staff to collaborate with other regional offices. SELECTED PROJECT EXPERIENCE Risk and Resilience Assessment and Emergency Response Plan - Central Lake County Joint Action Water Agency (CLCJAWA) / Project Manager In response to the requirements of AWIA, CLCJAWA retained HR Green to conduct the Risk and Resilience Assessment (RRA) and update to their existing Emergency Response Plan (ERP). Ravi served as the Project Manager for the project. Ravi serves as the Project Manager for this project. Water Treatment Plant Risk and Resilience Assessment - City of Waukegan, IL / Project Manager HR Green is currently working on completing the Risk and Resilience Assessment (RRA) for the Waukegan WTP’s facilities. The project includes a site assessment of all WTP facilities for existing security and countermeasures against malevolent acts and natural hazards. The RRA includes assessment of critical system assets for the most likely threat categories, determination of vulnerability likelihood, and quantification of economic consequences and public health impacts resulting from asset damage. The final report will identify the Waukegan WTP’s highest risk areas and will provide recommendations to improve resiliency. Ravi is serving as the Project Manager for the assessment of the Waukegan Water Treatment Plant (WTP). Development of the Risk and Resilience Assessment Arden Hills, MN 5 Sylwia Kokoszka, EI, CFM - Engineer EXPERIENCE 4 Years EDUCATION BS, Civil Engineering, University of Illinois - 2016 REGISTRATION / LICENSE Engineer Intern, IL, 061- 039050 Certified Floodplain Manager, IL, 17-00782 Sylwia’s experience includes analysis and design of stormwater systems, wastewater collection and treatment systems, and potable water treatment systems. Sylwia has been involved in planning, permitting, design, and construction. Agencies Sylwia has worked with for permitting include, IDNR, Kane/DuPage, McHenry/Lake, and Will County SWCD, IEPA, and USACOE (Chicago District). Examples of stormwater experience include hydrologic and hydraulic modeling, drainage studies, stream restoration projects, engineer’s estimates of probable costs, storm sewer design, ditch design, existing drainage plans (EDP), proposed drainage plans (PDP) and construction observation. Examples of wastewater experience include plan reviews, specification write -ups, hydraulic profile calculation, and vendor coordination. Examples of potable water experience include permitting, specification write-ups,treatment plant operational evaluation and design for repair of existing treatment systems. Sylwia is proficient with ArcMap, HEC-HMS, XP SWMM, HEC -RAS, GeoHECRAS, HY-8, and Microstation SELECTED PROJECT EXPERIENCE Risk & Resilience Assessment and Emergency Response Plans Updates - Central Lake County Joint Action Water Agency / Staff Engineer HR Green is assisting Central Lake County Joint Action Water Agency (CLCJAWA) to conduct a Risk and Resilience Assessment (RRA) and prepare an Emergency Response Plan (ERP). A large portion of this project is associated with the facilitation of meetings in which all stakeholders discuss and agree upon such matters as the mission of the CLCJAWA’s water system, the critical assets of the system, the threats against which it must be protected, the consequences that would result from the loss of certain critical assets and the effectiveness of existing security measures where they exist. Sylwia completed a Risk & Resilience Assessment for CLCJAWA to meet the new EPA requirements. She completed field visits at the site to determine the potential plant vulnerabilities for malevolent acts and natural disasters. Water Treatment Plant Risk and Resilience Assessment - City of Waukegan, IL / Project Manager HR Green is currently working on completing the Risk and Resilience Assessment (RRA) for the Waukegan WTP’s facilities. The project includes a site assessment of all WTP facilities for existing security and countermeasures against malevolent acts and natural hazards. The RRA includes assessment of critical system assets for the most likely threat categories, determination of vulnerability likelihood, and quantification of economic consequences and public health impacts resulting from asset damage. The final report will identify the Waukegan WTP’s highest risk areas and will provide recommendations to improve resiliency. Sylwia is currently assisting with the assessment of the Waukegan Water Treatment Plant PHASENUMBER PHASETOTAL($)DESCRIPTION OF PHASE / TASK TASKSUB-TOTAL($)1 1,215.00 Project managementKickoff Meeting (Virtual)400.00Provide Project Management Throughout Project815.002 13,585.00 Risk and Resiliency Assessment (RRA)Site Visits (2 Storage Tanks and 1 Booster Station), 1 Day, Including Travel550.00Site Notes to Transfer to RRA Analysis Team550.00Threat & Asset Characterization preparation/reporting1,200.00Asset / Threat / Vulnerability / Characterization Workshop (Virtual) 1,150.00Consequence Analysis1,200.00Vulnerability Analysis800.00Threat Analysis800.00Risk and Resilience Analysis800.00QA / QC550.00Draft Report4,300.00Meeting with Client (Virtual)700.00Final Report985.00Total14,800.00City of Arden Hills, MN Risk and Resilience AssessmentHR Green, Inc.Project Manager - Chris Harrington, PE09/23/2020 CONSENT ITEM – 7H City of Arden Hills City Council Meeting for September 28th, 2020 P:\Admin\Council\Agendas & Packet Information\2020\09-28-20-R\Mike\PC 20-018 Final Plat Page 1 of 3 MEMORANDUM DATE: September 28, 2020 TO: Honorable Mayor and City Council Members Dave Perrault, City Administrator FROM: Mike Mrosla, Community Development Manager/City Planner SUBJECT: Planning Case # 20-018 Applicant: Barry O’Meara Property Location: 3246 New Brighton Road Request: Final Plat Budgeted Amount: Actual Amount: Funding Source: N/A N/A N/A Council Should Consider the Following: Motion to approve a Final Plat for Planning Case 20-018 at 3246 New Brighton Road (“Subject Property”) based on the findings of fact and the September 28th, 2020 Report to the City Council. Background/Summary Barry O’Meara of O’Meara Construction (“Applicant”) has submitted a land use application for a Final Plat for the Subject Property. The Applicant is requesting approval for a Final Plat of a previously approved Preliminary Plat of the Subject Property to subdivide the Subject Property into four (4) single family detached properties. The Subject Property is approximately 3.12 acres in size and is comprised of the decommissioned Lake Johanna Fire Station No.1 building, a detached garage, and parking areas. It is located in the R-2 Single and Two Family Residential District and is guided Very Low Density Residential in the Land Use Plan. At their June 22, 2020 Regular Meeting, the City Council reviewed a Variance and Preliminary Plat request for the Subject Property. The Applicant submitted a land use application to subdivide the Subject Property into 4 single family lots with a reduced minimum lot width of 81.75 feet. However, the zoning ordinance requires a minimum of eighty-five (85) feet in the R-2 district. The Council voted 3-2 to approve the Variance and Preliminary Plat request during its June 22, 2020 meeting. During the previous approval process the Applicant elected not to apply for a Final Plat request simultaneously in case the project did not get approval from the City Council. City of Arden Hills City Council Meeting for September 28, 2020 P:\Planning\Planning Cases\2020\20-018 3246 New Brighton Road Ecko Estates - FP\CC Packet Page 2 of 3 Additional Review Ramsey County The County Surveyor’s Office has reviewed and approved the final plat. Engineering Staff Engineering Staff has reviewed the plat and has no comments at this time. Findings of Fact The Planning Commission reviewed this application at their September 9th, 2020 meeting and voted (7-0) to recommend approval of Planning Case 20-018. The Planning Commission have offered the following findings of fact for your consideration: 1. City Staff received a land use application for a request for Final Plat at the Subject Property 3246 New Brighton Road. 2. The Subject Property at 3246 New Brighton Road is located in the R-2 – Single and Two- Family Residential Zoning District and is guided as very low density on the Land Use plan. 3. The Subject Property is currently comprised of the former Lake Johanna Fire Station 1 building, a detached garage, and parking areas. 4. The City Council approved the Preliminary Plat and Variance for the Subject Property at their June 22, 2020 meeting. 5. The Applicant has requested a Final Plat to finalize the subdivision of the Subject Property into four (4) single-family residential lots. 6. The adjacent properties to the north, east, west and south are zoned R-2 District and are guided for Low Density Residential uses in the Arden Hills 2040 Comprehensive Plan 7. A single-family detached dwelling is a permitted use for the lots in the R-2 district where the Subject Property is located. 8. The proposed Final Plat meets the Subdivision Design requirements included in Section 1130 of the City Code. 9. The proposed development requires public use dedication, as required in Section 1130.08 of the City Code. Council shall consider The following are motion language options for the City Council to consider. 1. Approval: Motion to approve the Final Plat for Planning Case 20-018 at 3246 New Brighton Road, based on the findings of facts, the submitted plans, and as amended by the following conditions: 1. All conditions of the Preliminary Plat approval shall remain in full force and effect. 2. Prior to the release of the Final Plat for recording, the Applicant shall enter into a Development Agreement. City of Arden Hills City Council Meeting for September 28, 2020 P:\Planning\Planning Cases\2020\20-018 3246 New Brighton Road Ecko Estates - FP\CC Packet Page 3 of 3 3. All permanent easements and rights-of-way (ROW) necessary for existing street and utility improvements shall be granted to the City at no cost or paid for by the Developer. 4. The Developer shall be financially responsible for 100 percent of all storm sewer, sanitary sewer and water main area and connection charges applicable to the property. These charges are identified in a preliminary report prepared for the project and shall be in the Development Agreement. 5. Final Plat approval shall expire six months from the date of the City Council approval unless the Final Plat has recorded with Ramsey County or a time extension granted by the City Council. 2. Approval without Conditions: Motion to approve the Final Plat for Planning Case 20-018 at 3246 New Brighton Road, based on the findings of fact and the submitted materials. 3. Denial: Motion to deny Planning Case 20-018 for a Final Plat request at 3246 New Brighton Road, based on the following findings of fact: findings to deny should specifically reference the reasons for denial and why those reasons cannot be mitigated. 4. Table: Motion to table Planning Case 20-018 for a Final Plat request at 3246 New Brighton Road request for the following reasons: a specific reason and/or information request should be included with a motion to table. Deadline for Agency Actions The City of Arden Hills received the completed application for this request on August 28th, 2020. Pursuant to Minnesota State Statute, the City must act on this request by October 27th, 2020 (60 days), unless the City provides the petitioner with written reasons for an additional 60-day review period. With consent of the Applicant, the City may extend the review period beyond the initial 120 days. Budget Impact NA Attachments A. Application B. Location Map C. Final Plat D. Planning Commission Staff Report E. Draft Planning Commission Minutes Attachment A Disclaimer: This map is intended for reference purposes only and is not a legally recorded map or survey. The City of Arden Hills shall not be liable for any damages or claims that arise due to accuracy, availability, use or misuse of the information herein pursuant to MN Statute 466.03 Subd 21. Location Map New B r igh ton RoadLake Johanna BoulevardBeckman Avenue Glen Paul Avenue S a n d e e n R o a d Edgewater Avenue Jerrold Avenue PARK ± Subject Parcel $WWDFKPHQW% Attachment C City of Arden Hills Planning Commission Meeting for September 9, 2020 P:\Planning\Planning Cases\2020\20-018 3246 New Brighton Road Ecko Estates - FP\PC Packets Page 1 of 3 MEMORANDUM DATE:September 9, 2020 PC Agenda Item 3.B TO: Planning Commission Chair and Commissioners FROM:Mike Mrosla, Community Development Manager/City Planner SUBJECT: Planning Case #20-018 – No Public Hearing Required Applicant: Barry O’Meara Property Location: 3246 New Brighton Road Request: Final Plat Requested Action Barry O’Meara of O’Meara Builders (“Applicant”) has submitted a land use application for a Final Plat of 3246 New Brighton Road (“Subject Property”). The Applicant is requesting to Final Plat the previously approved Preliminary Plat in order to subdivide the subject property into four (4) single family detached properties. Background and Project Overview 1. Background The Subject Property at 3246 New Brighton Road is approximately 3.12 acres in size and is comprised of the decommissioned Lake Johanna Fire Station No.1 building, a detached garage, and parking areas. The two (2) existing structures are located along New Brighton Road but the topography slopes down significantly to a pond located on the easterly half of the property. It’s located in the R-2 Single and Two Family Residential District and is guided Very Low Density Residential in the Land Use Plan. At their June 22, 2020 Regular Meeting, the City Council reviewed a Variance and Preliminary Plat request for the Subject Property. The Applicant submitted a Land Use application to subdivide the Subject Property into four single family lots with a reduced minimum lot width of 81.75 feet. However, the zoning ordinance requires a minimum of 85 feet in the R-2 district. The Council voted in the affirmative to approve the Variance and Preliminary Plat request during its June 22, 2020 meeting. During the previous approval process the Applicant elected not to apply for a Final Plat request simultaneously in case the project did not get approval from the City Council. Attachment D City of Arden Hills Planning Commission Meeting for September 9, 2020 P:\Planning\Planning Cases\2020\20-018 3246 New Brighton Road Ecko Estates - FP\PC Packets Page 2 of 3 2. Overview of Request The Applicant has since submitted their Final Plat request subject to the conditions of approval from Planning Case 20-003. A plat is required to create new parcels of land or to adjust the boundary between parcels. The purpose of a Final Plat application is to review the proposed development for conformance with the approved Preliminary Plat, and is the final map on which the Applicants will be submitted to the county register of deeds or register of titles if approved. Findings of Fact The Planning Commission must make a finding as to whether or not the proposed application would adversely affect the surrounding neighborhood or the community as a whole based on the factors of the case. Staff offers the following findings for consideration: General Findings: 1. City Staff received a land use application for a request for Final Plat at the Subject Property 3246 New Brighton Road. 2. The Subject Property at 3246 New Brighton Road is located in the R-2 – Single and Two- Family Residential Zoning District and is guided as very low density on the Land Use plan. 3. The Subject Property is currently comprised of the former Lake Johanna Fire Station 1 building, a detached garage, and parking areas. 4. The City Council approved the Preliminary Plat and Variance for the Subject Property at their June 22, 2020 meeting. 5. The Applicant has requested a Final Plat to finalize the subdivision of the Subject Property into four (4) single-family residential lots. 6. The adjacent properties to the north, east, west and south are zoned R-2 District and are guided for Low Density Residential uses in the Arden Hills 2040 Comprehensive Plan 7. A single-family detached dwelling is a permitted use for the lots in the R-2 district where the Subject Property is located. 8. The proposed Final Plat meets the Subdivision Design requirements included in Section 1130 of the City Code. 9. The proposed development requires public use dedication, as required in Section 1130.08 of the City Code. Additional Review Ramsey County Ramsey County Surveying Office is reviewing the Final Plat. Engineering Staff Engineering Staff has reviewed the plat and has no comments at this time. City of Arden Hills Planning Commission Meeting for September 9, 2020 P:\Planning\Planning Cases\2020\20-018 3246 New Brighton Road Ecko Estates - FP\PC Packets Page 3 of 3 Options and Motion Language Staff has provided the following options and motion language for this case. The Planning Commission should consider providing additional findings of fact as part of the motion to support their recommendation for approval or denial. x Recommend Approval with Conditions: Motion to recommend approval of Planning Case 20-018 for a Final Plat at 3246 New Brighton Road, based on the findings of fact and the submitted plans, as amended by the conditions below: 1. All conditions of the Preliminary Plat approval shall remain in full force and effect. 2.Prior to the release of the Final Plat for recording, the Applicant shall enter into a Development Agreement. 3. All permanent easements and rights-of-way (ROW) necessary for existing street and utility improvements shall be granted to the City at no cost or paid for by the Developer. 4. The Developer shall be financially responsible for 100 percent of all storm sewer, sanitary sewer and water main area and connection charges applicable to the property. These charges are identified in a preliminary report prepared for the project and shall be in the Development Agreement. 5. Final Plat approval shall expire six months from the date of the City Council approval unless the Final Plat has recorded with Ramsey County or a time extension granted by the City Council. x Recommend Approval as Submitted: Motion to recommend approval of Planning Case 20- 018 for a Final Plat at 3246 New Brighton Road, based on the findings of fact and the submitted materials. x Recommend Denial: Motion to recommend denial Planning Case 20-018 for a Final Plat at 3246 New Brighton Road, based on the following findings: findings to deny should specifically reference the reasons for denial and why those reasons cannot be mitigated. x Table: Motion to table Planning Case 20-018 for a Final Plat at 3246 New Brighton Road: a specific reason and information request should be included with a motion to table. Deadline for Agency Actions The City of Arden Hills received the completed application for this request on August 28th, 2020. Pursuant to Minnesota State Statute, the City must act on this request by October 27th, 2020 (60 days), unless the City provides the petitioner with written reasons for an additional 60-day review period. With consent of the Applicant, the City may extend the review period beyond the initial 120 days. Attachments A. Land Use Application B. Location Map C. Final Plat Approved: CITY OF ARDEN HILLS, MINNESOTA PLANNING COMMISSION WEDNESDAY, SEPTEMBER 9, 2020 6:30 P.M. - ARDEN HILLS CITY HALL CALL TO ORDER/ROLL CALL Pursuant to due call and notice thereof, Chair Nick Gehrig called to order the regular Planning Commission meeting at 6:30 p.m. Due to the COVID-19 pandemic this meeting was held virtually. ROLL CALL Present were: Chair Nick Gehrig, Commissioners Marcie Jefferys, Steven Jones, Subbaya Subramanian, Paul Vijums, Kurtis Weber, and Jonathan Wicklund. Absent: Commissioners James Lambeth and Clayton Zimmerman. Also present were: Community Development Manager/City Planner Mike Mrosla, Associate Planner Joe Hartmann, and Councilmember Steve Scott. APPROVAL OF AGENDA – SEPTEMBER 9, 2020 Chair Gehrig stated the agenda will stand as published. APPROVAL OF MINUTES August 5, 2020 – Planning Commission Regular Meeting Chair Gehrig requested all references to himself be changed to Vice Chair Jones within the minutes. Commissioner Jones moved, seconded by Commissioner Jefferys, to approve the August 5, 2020, Planning Commission Regular Meeting as amended. A roll call vote was taken. The motion carried unanimously (7-0). PLANNING CASES A. Planning Case 20-014; 1434 County Road E – Variance Request – No Public Hearing Required $WWDFKPHQW( ARDEN HILLS PLANNING COMMISSION – September 9, 2020 2 Associate Planner Hartmann stated the Applicant is requesting a Variance to expand the current 528 square foot garage on the Subject Property into a 1,100 square foot garage. The maximum size of a garage allowed by right is 728 square feet. The existing garage meets the front and rear yard setbacks which are forty (40) and thirty (30) feet from the front and rear property lines, respectively, but the garage is only three (3) feet from the side yard setback where a ten (10) foot side yard setback is required for an accessory structure in the R-1 district. Due to the size of the request and the current garage’s legal nonconforming side yard setback (refer to Planning Case 00-004 for the previously approved three (3) foot setback variance), the Applicant requires a variance approval for the expansion of the garage. Associate Planner Hartmann reported the Applicant is proposing to expand the accessory structure in order to gain more storage space for their vehicles. According to the Applicant’s narrative submitted as a part of their application, when the sidewalk was installed within the easement facing County Road E, they lost driveway space that they had been using for the storage of vehicles. Expanding the garage will allow them to store their vehicles on the property safely. The Applicant has also indicated to staff that they intend to widen the driveway with permeable pavers and seek a future expansion of the house so that the increased size of the garage will not appear out of character with the property or the neighborhood. No permits have been pulled for these projects yet, and while they would require separate building plan review, these projects would not require a variance. Associate Planner Hartmann reviewed the surrounding area, the Plan Evaluation and provided the Findings of Fact for review: 1. City Staff received a land use application for a request to build a bigger garage for a single family dwelling at the Subject Property 1434 County Road E. 2. A garage for a single-family detached dwelling is a permitted use in the R-1 Single Family Residential District. 3. The Subject Property is a legal nonconforming lot due to the lot not meeting the minimum width requirement for the R-1 District. 4. The Subject Property is non-conforming with the R-1 District’s standards for minimum lot length requirements. 5. The proposed development of the Subject Property would conform to all other requirements and standards of the R-1 district. 6. The Subject Property was previously granted a side yard setback variance of three (3) feet for a garage under Planning Case 00- 004. 7. The proposed structure would not exceed the three (3) foot variance distance previously approved. 8. A variance may be granted if enforcement of a provision in the zoning ordinance would cause the landowner practical difficulties. 9. Variances are only permitted when they are in harmony with the general purposes and intent of the ordinance. Associate Planner Hartmann stated staff recommends approval of Planning Case 20-014 for a Variance at 1434 County Road E, based on the findings of fact and the submitted plans, as amended by the conditions below: 1. A Building Permit shall be issued prior to commencement of construction. ARDEN HILLS PLANNING COMMISSION – September 9, 2020 3 2. The exterior materials of the proposed addition shall be consistent or complementary in color, texture and quality with those visible on the existing structure. 3. The roof of the proposed addition shall be integrated into, and consistent with, the existing roof of the structure and materials. 4. The Subject Property shall be limited to one (1) accessory structure. 5. The proposed building shall conform to all other standards and regulations in the City Code. 6. The proposed garage shall not exceed 1,100 square feet total. Associate Planner Hartmann reviewed the options available to the Planning Commission on this matter: 1. Recommend Approval with Conditions 2. Recommend Approval as Submitted 3. Recommend Denial 4. Table Chair Gehrig opened the floor to Commissioner comments. Commissioner Jefferys stated she appreciated the explanation from the applicant for the detached garage. She asked if the garage would more than double in size. Associate Planner Hartmann reported the garage would go from 528 square feet to 1100 square feet. Commissioner Jefferys indicated this would be a large garage for the neighborhood. She questioned if the neighborhood had any other four-car garages. Associate Planner Hartmann commented the neighboring property at 1426 County Road E had received a variance for a 3” side yard setback. He explained a site plan review was completed in 2019 at 4101 Gail Circle where an additional 703 square feet of garage space was requested. Commissioner Subramanian asked if the applicant would be installing another driveway for this garage. Associate Planner Hartmann stated staff had spoken with Ramsey County regarding this matter and noted a second driveway would not be allowed. He noted the applicant could expand the existing driveway but noted this would require a separate permit. Keith Sandahl 1434 County Road E, explained the purpose of the garage expansion was to allow him to store all four of his vehicles indoors, especially during the winter months. Commissioner Jones questioned if the roofline of the old garage would be perpendicular to the new garage. Associate Planner Hartmann stated this was correct. ARDEN HILLS PLANNING COMMISSION – September 9, 2020 4 Commissioner Jones inquired if the proposed garage was a mirror image to the neighbor’s garage. Mr. Sandahl commented he was asking for a garage that would mirror his neighbor’s garage. Commissioner Jones asked if there would be a problem with water runoff from the garage. Mr. Sandahl discussed how the water ran off from his property to the rear into a creek. Commissioner Jones inquired if the permeable/non-permeable surface requirements were being met for this lot. Associate Planner Hartmann reported these requirements were being met for this zoning district given the fact this was a large R-1 lot. Commissioner Vijums questioned how many cars could be parked on the driveway. Mr. Sandahl stated he could currently park four cars in the driveway. He noted he used to be able to park six cars in his driveway. Further discussion ensued regarding the visibility of the garage on the property. Commissioner Vijums commented what the applicant lost in sidewalk space doesn’t equal what the applicant was asking for. He indicated the Commission would have to consider if the garage size was excessive even though it mimics the neighbor’s garage. Commissioner Weber stated there was a bit of conflicting information in the packet. He noted applicant had hoped to widen the driveway, which wasn’t going to happen anymore. He asked if the applicant planned to install a rear garage door. Associate Planner Hartmann commented according to the applicant’s plans there would be no rear garage door. Commissioner Weber questioned if the applicant would be allowed to complete mechanical work from the garage. Associate Planner Hartmann stated this would not be allowed. Community Development Manager/City Planner Mrosla explained this was a prohibited home occupation. Commissioner Wicklund asked what the dimensions were for the current garage. Associate Planner Hartmann reported the garage was 22 feet by 24 feet in size. Commissioner Wicklund inquired if the existing garage would be demolished. ARDEN HILLS PLANNING COMMISSION – September 9, 2020 5 Mr. Sandahl stated the existing garage would remain in place and the additional square feet would be added (22 feet by 50 feet). Commissioner Wicklund questioned if City Code allowed for two accessory structures totaling 1,456 square feet. Associate Planner Hartmann reported this was the case. Commissioner Wicklund explained the applicant currently has 528 square feet of garage space and the applicant is asking for 1,100 additional square feet or 1,628 total square feet. He noted current City Code only allows for 1,456 square feet. Chair Gehrig thanked Commissioner Wicklund for the clarification. Community Development Manager/City Planner Mrosla stated this information was news to staff. He reported staff had the understanding the existing garage would be demolished. He noted the overall size that was allowed per City Code was 1,456 square feet. He explained the proposal before the Commission does not meet this requirement. Chair Gehrig suggested the Commission table action on this item to allow staff and the applicant to clarify some of the project details and that this matter be reviewed by the Commission in October. Commissioner Jones supported the matter being tabled. He stated he would like to see calculations regarding permeable surfaces with the garage addition and how much was taken by the City for the sidewalk. He commented he would also like to understand more about the neighbor’s garage and variance. He indicated he could support a garage the same size as the neighbor’s, but not exceeding this garage size. Community Development Manager/City Planner Mrosla reported the neighboring garage was roughly 1,000 square feet. He clarified that there was no “taking” of property for the sidewalk as the sidewalk was located within Ramsey County right-of-way. Commissioner Jefferys stated she supported this matter being tabled and she would like to understand how the applicant would be using a six car garage. Commissioner Vijums also supported this Planning Case being tabled. He encouraged the applicant to stick within the City’s zoning requirements for the garage. Chair Gehrig moved and Commissioner Jones seconded a motion to table action on Planning Case 20-014 a Variance for the property at 1434 County Road E to allow staff to clarify the structure size, to better understand the permeable surface area on the lot, as well as investigating other structures in the City that have exceeded the maximum allowable square footage of 1,456 square feet. A roll call vote was taken. The motion carried unanimously (7-0). B. Planning Case 20-018; 3246 New Brighton Road (Ecko Estates) Final Plat Request – No Public Hearing Required ARDEN HILLS PLANNING COMMISSION – September 9, 2020 6 Community Development Manager/City Planner Mrosla stated the Subject Property at 3246 New Brighton Road is approximately 3.12 acres in size and is comprised of the decommissioned Lake Johanna Fire Station No. 1 building, a detached garage, and parking areas. The two (2) existing structures are located along New Brighton Road but the topography slopes down significantly to a pond located on the easterly half of the property. It’s located in the R-2 Single and Two Family Residential District and is guided Very Low Density Residential in the Land Use Plan. Community Development Manager/City Planner Mrosla explained at their June 22, 2020 Regular Meeting, the City Council reviewed a Variance and Preliminary Plat request for the Subject Property. The Applicant submitted a Land Use application to subdivide the Subject Property into four single family lots with a reduced minimum lot width of 81.75 feet. However, the zoning ordinance requires a minimum of 85 feet in the R-2 district. The Council voted in the affirmative to approve the Variance and Preliminary Plat request during its June 22, 2020 meeting. During the previous approval process the Applicant elected not to apply for a Final Plat request simultaneously in case the project did not get approval from the City Council. Community Development Manager/City Planner Mrosla further discussed the Overview of the Request and provided the Findings of Fact for review: 1. City Staff received a land use application for a request for Final Plat at the Subject Property 3246 New Brighton Road. 2. The Subject Property at 3246 New Brighton Road is located in the R-2 – Single and Two Family Residential Zoning District and is guided as very low density on the Land Use plan. 3. The Subject Property is currently comprised of the former Lake Johanna Fire Station 1 building, a detached garage, and parking areas. 4. The City Council approved the Preliminary Plat and Variance for the Subject Property at their June 22, 2020 meeting. 5. The Applicant has requested a Final Plat to finalize the subdivision of the Subject Property into four (4) single-family residential lots. 6. The adjacent properties to the north, east, west and south are zoned R-2 District and are guided for Low Density Residential uses in the Arden Hills 2040 Comprehensive Plan 7. A single-family detached dwelling is a permitted use for the lots in the R-2 district where the Subject Property is located. 8. The proposed Final Plat meets the Subdivision Design requirements included in Section 1130 of the City Code. 9. The proposed development requires public use dedication, as required in Section 1130.08 of the City Code. Community Development Manager/City Planner Mrosla stated staff recommends approval of Planning Case 20-018 for a Final Plat at 3246 New Brighton Road, based on the findings of fact and the submitted plans, as amended by the conditions below: 1. All conditions of the Preliminary Plat approval shall remain in full force and effect. 2. Prior to the release of the Final Plat for recording, the Applicant shall enter into a Development Agreement. ARDEN HILLS PLANNING COMMISSION – September 9, 2020 7 3. All permanent easements and rights-of-way (ROW) necessary for existing street and utility improvements shall be granted to the City at no cost and paid for by the Developer. 4. The Developer shall be financially responsible for 100 percent of all storm sewer, sanitary sewer and water main area and connection charges applicable to the property. These charges are identified in a preliminary report prepared for the project and shall be in the Development Agreement. 5. Final Plat approval shall expire six months from the date of the City Council approval unless the Final Plat has recorded with Ramsey County or a time extension granted by the City Council. Community Development Manager/City Planner Mrosla reviewed the options available to the Planning Commission on this matter: 1. Recommend Approval with Conditions 2. Recommend Approval as Submitted 3. Recommend Denial 4. Table Chair Gehrig opened the floor to Commissioner comments. Commissioner Jones stated he was heartbroken to see the fire station going away, but noted he supported the proposed project. Commissioner Wicklund asked if Condition 3 was standard practice for the City. Community Development Manager/City Planner Mrosla recommended the “or” be changed to “and” in Condition 3. Commissioner Jones moved and Commissioner Subramanian seconded a motion to recommend approval of Planning Case 20-018 for a Final Plat at 3246 New Brighton Road based on the findings of fact and the submitted plans, as amended by the five (5) conditions as amended in the September 9, 2020, report to the Planning Commission. A roll call vote was taken. The motion carried unanimously (7-0). C. Planning Case 20-010; 4200 Round Lake Road – Planned Unit Development Request, Site Plan Review, Conditional Use Permit, Preliminary and Final Plat – Public Hearing Community Development Manager/City Planner Mrosla stated the Subject Property is currently owned by North American Land Company, LLC, a holding company related to Roberts Management Group. The Subject Property comprises two (2) parcels totaling approximately 26.08 acres located south of the cul-de-sac on Gateway Boulevard and north of Interstate 694 and east of 35W. There was a previously existing building located onsite that was removed in 2006. The Subject Property has had a few development proposals in the past. However, none of the projects have come to fruition. The Subject Property has since been vacant with wetlands located adjacent to Interstates (“35W and 694”). ARDEN HILLS PLANNING COMMISSION – September 9, 2020 8 Community Development Manager/City Planner Mrosla indicated the Applicant is proposing to construct a 250,000 square foot office and warehouse facility on the site. The site is highly visible from 694 and 35W. Separate access points to the site will be provided via Gateway Boulevard for employee parking and deliveries. The Applicant’s proposal includes office space, warehousing, and ground level unloading access with 38 dock doors located on the north side of the building. The site proposal includes at-grade office parking lots located on the south side of the building. Community Development Manager/City Planner Mrosla reviewed the surrounding area, the Plan Evaluation and provided the Findings of Fact for review: 1. The Applicant has submitted an application for a Planned Unit Development, Conditional Use Permit and Preliminary/Final Plat at the Subject Property 4200 Round Lake Road. 2. The Applicant is proposing a 250,000 square foot office and warehouse facility on the Subject Property. 3. The Applicant has submitted a preliminary and final plat to plat two (2) properties. 4. Flexibility through the PUD process has been requested in the following areas: district provisions, lot area, lot dimensions, parking setbacks, building height, minimum caliper inches, aesthetics, perennials and shrubberies. 5. The proposed development plan meets or exceeds the minimum requirements of the City Code in the following areas: building setbacks, landscape coverage, parking, planting islands, street trees, tree selection, floor area ratio, drainage wetlands and flood plain tree selection, lighting, screening. 6. Where the plan is not in conformance with the City Code, flexibility has been requested by the Applicant and/or conditions have been placed on an approval that would mitigate the nonconformity. 7. A traffic study has been completed for the proposed use and suggests that Ramsey County to add five (5) seconds to the signal timing for Round Lake Road and Hwy 96 to allow for more northbound left turns during the PM peak hour. 8. Existing public facilities and shall be able to absorb the additional demand for public services needed for the proposed use. 9. The Subject Property is located with the Gateway Business (“GB”) District and is guided as Light Industrial & Office on the 2040 Land Use Plan. 10. The proposed Preliminary Plat and Final Plat are consistent with the Arden Hills Zoning Map and the 2040 Comprehensive Plan. 11. The application is not anticipated to create a negative impact on the immediate area or the community as a whole. Community Development Manager/City Planner Mrosla stated staff recommends approval of Planning Case 20- 010 for a Planned Unit Development, Conditional Use Permit and Preliminary Plat/Final Plat at 4200 Round Lake Road, based on the findings of fact and submitted plans, subject to the following conditions: 1. The project shall be completed in accordance with the plans submitted and as amended by the conditions of approval. Any significant changes to the plans, as determined by the City Planner, shall require review and approval by the City Council. ARDEN HILLS PLANNING COMMISSION – September 9, 2020 9 2. The Preliminary Plat approval shall expire six months from the date of the City Council approval unless the Final Plat has recorded with Ramsey County or a time extension granted by the City Council. 3. The Applicant shall record the Final Plat with Ramsey County and a copy shall be provided to the City within sixty (60) days of the City’s approval. 4. The Applicant shall be financially responsible for all applicable water and sanitary charges. Rates applied shall be those in effect at the time of Final Plat approval and shall be memorialized in the Development Agreement. 5. A Development Agreement shall be prepared by the City Attorney and subject to City Council approval. The Development Agreement shall be fully executed prior to release of a building permit. 6. The Applicant shall submit a park dedication fee that shall be seven and a half (7.5) percent of the fair market value of the unimproved land and subject to the approval of the City Council. The park dedication fee shall be submitted prior to the release of the Final Plat. 7. Survey monuments shall be placed and installed at all block corners, angle points, points of curves in streets, and at intermediate points as shown on the Final Plat. Pipes or steel rods shall be placed at the corners of each lot. 8. The final plat shall provide dedication of a 60-ft wide right of way for Gateway Boulevard on Lot 2, Block 1 overlying the area currently encumbered by existing drainage and utility easement. 9. Prior to the issuance of a grading and erosion permit, planning staff shall approve in writing the final landscaping plan. 10. Prior to the issuance of a grading and erosion permit, engineering staff shall approve in writing the final location of the loading driveway access to align with adjacent commercial driveway or provide adequate offset distance. 11. A cross easement access and maintenance agreement for the proposed share access on Lot 2 shall be submitted and memorialized in the Development Agreement. 12. Site Plan approval shall be required for the construction of the proof of parking area. 13. All light poles, including base, shall be a maximum of 25 feet in height and shall be shoebox style, downward directed, with high-pressure sodium lamps or LED and flush lenses. Other than wash or architectural lighting, attached security lighting shall be shoebox style, downward directed with flush lenses. If complaints are received the lighting adjacent to residential uses shall utilize house shields as directed by the City. In addition, any lighting under canopies (building entries) shall be recessed and use a flush lens. 14. A right of way permit shall be required for work performed within the City right of way. 15. A grading as-built and utility as-built plan shall be provided to the City upon completion of grading and utility work. 16. No exterior storage shall be permitted. 17. This approval does not include signs. A separate sign permit is required for all proposed signage. All signage shall meet the requirements of Sign District 6. 18. Prior to the issuance of a building permit, a landscape financial security of $50,000.00 dollars shall be submitted. Landscape financial security is held for two full growing seasons. 19. All rooftop or ground mounted mechanical equipment shall be hidden from view with the same materials used on the building in accordance with City Code requirements. ARDEN HILLS PLANNING COMMISSION – September 9, 2020 10 20. All fencing and retaining wall materials shall be complementary to the building materials and shall be approved in writing by the Planning Division prior to issuance of a building permit. Retaining walls greater than four (4) feet in height shall be engineered and detailed calculations shall be submitted to the City. 21. Prior to City Council consideration, the Applicant shall submit a materials board to be approved in writing by staff. 22. A Grading and Erosion permit shall be obtained from the City’s Engineering Department prior to commencing any grading, land disturbance or utility activities. The Developer shall be responsible for obtaining any permits necessary from other agencies, including but not limited to, MPCA, Rice Creek Watershed District, and Ramsey County, MNDOT prior to the start of any site activities. 23. The Applicant shall be responsible for protecting the proposed on-site storm sewer infrastructure and components and any existing storm sewer from exposure to any and all stormwater runoff, sediments and debris during all construction activities. Temporary stormwater facilities shall be installed to protect the quality aspect of the proposed and existing stormwater facilities prior to and during construction activities. Maintenance of any and all temporary stormwater facilities shall be the responsibility of the Applicant. 24. Prior to the issuance of the Grading and Erosion permit, the Engineering Department shall review and approve final grading and utility plans in writing. Plans shall be amended to include detail drawings for connection to the sanitary sewer system in Gateway Boulevard, restoration of utility cuts within public streets, and inclusion of City details 3401, 3402, 3408, and 4000. 25. Any future trash enclosures shall utilize wooden gates and be constructed on three sides using the same materials and patterns used on the building. Locations shall be approved by the Planning Department. 26. The Applicant shall provide an executed copy of the City’s standard stormwater maintenance and easement agreement prior to approval of the Development Agreement. 27. All disturbed boulevards shall be restored with sod. 28. All areas of the site, where practical, shall be sodded or seeded and maintained. The property owner shall mow and maintain all site boulevards to the curb line of the public streets. 29. Overnight trailer parking is prohibited onsite other than along the dock wall within the concrete dock apron. 30. The Applicant shall work with Ramsey County to add five (5) seconds to the signal timing for Round Lake Road and Hwy 96 to allow for more northbound left turns during the PM peak hour prior to the issuance of a certificate of occupancy. 31. Warehousing and wholesaling shall not exceed 85 percent of the floor area tenant. The remaining 15 percent of floor area shall be non-warehouse uses such as a combination of uses including-but-not-limited-to office, manufacturing, production, research and development, lab and/or showroom per tenant. Community Development Manager/City Planner Mrosla reviewed the options available to the Planning Commission on this matter: 1. Recommend Approval with Conditions 2. Recommend Approval as Submitted 3. Recommend Denial 4. Table ARDEN HILLS PLANNING COMMISSION – September 9, 2020 11 Chair Gehrig opened the floor to Commissioner comments. Commissioner Jefferys stated this was a complex and detailed proposal. She requested staff provide the Commission with a brief history on this property. Community Development Manager/City Planner Mrosla commented he was unaware of the history this property due to his short time with the City. He understood an office building was previously approved for this site in 2006 when the lot was subdivided into two lots. Commissioner Jones questioned if the size of Lot 2 was going to be a concern. He stated he was surprised the site did not have two driveways to assist with maneuvering semi-trucks through the property. Community Development Manager/City Planner Mrosla reported the applicant had looked at a number of lot designs for Lot 2. He commented under the current standards the parcel could be developed and meet current requirements. He stated some flexibility may be needed for use. He provided further comment on how access was needed to the adjacent property. Ben Johnson, Kimley Horn, discussed the proposed access to the site. He noted two access points were not proposed due to the elevation and grade changes on the property. Dan Salzer explained the site would have a one-way loop through the property. He stated he had investigated two access points, but given the challenging grades, this was not possible. He believed the proposed access was a creative way to address the sites needs. Commissioner Subramanian asked if the size of the building would impact the wetland area. Mr. Johnson discussed the buildable area on the site and noted the building would be 250,000 square feet. Mr. Salzer reported the building would cover 26% of the lot area and the impervious area would an additional percentage of the lot. Mr. Johnson commented further on how he would be addressing the stormwater management for the site. He noted the existing pond would be expanded to hold the site’s water runoff per the Rice Creek Watersheds calculations. Commissioner Vijums questioned why the City was allowing for 10% more warehousing. Community Development Manager/City Planner Mrosla deferred this question to the applicant. Mr. Johnson explained the zoning requires 25% to 50% office, which was more office driven than in other communities. He reported he was asking for 85% warehousing and 15% other uses, which could include office space, lab space or manufacturing. ARDEN HILLS PLANNING COMMISSION – September 9, 2020 12 Commissioner Vijums stated this seemed reasonable and perhaps City Code needed to be amended to reflect how business was being done today. He then asked why the applicant was requesting an additional five feet of building height. Mr. Johnson commented historically buildings of this nature were built to an 18 or 24 foot clear height but over time this clear height has morphed into an increased height. He stated he was trying to plan for the long-term future of this building which led him to request a 40 foot building height. He indicated this building height would allow him greater flexibility to meet the needs of his future tenants. Commissioner Vijums thanked the applicant for answering his questions. He stated he could support the increased building height. Chair Gehrig requested comment from staff or the applicant regarding the building materials selection. Mr. Johnson reported he worked closely with staff on the building exterior. He then described the building materials that were being proposed for the development. Commissioner Vijums commented it appears the applicant is looking for flexibility on building height and percentage of warehousing space. He suggested the City look at changing the overall code versus granting variances/flexibilities for similar requests in the future. Community Development Manager/City Planner Mrosla stated this was a great point. He commented on the recently approved Comprehensive Plan and noted staff could address these concerns as part of the updates being made to the Gateway Business District. Commissioner Jefferys supported Commissioner Vijums recommendation that City Code be addressed. She asked if the applicant had experience with the proposed natural plantings or seed and how well this has worked. Community Development Manager/City Planner Mrosla commented he has had several projects that has used this seed and so long as invasive weeds are addressed, this seed can work really well once it takes. Mr. Johnson explained the proposed seed would be consistent with the native wetlands. He indicated he has had success with a variety of native plantings/seedings in other projects. Commissioner Jones stated he supported a code change as well. He indicated he supported the placement of this warehouse/distribution development. He encouraged staff to consider how signage would be impacted if the building height was raised to 40 feet. He commented overall he supported this project. Chair Gehrig opened the public hearing at 8:14 p.m. Chair Gehrig invited anyone for or against the application to come forward and make comment. Mr. Johnson questioned how quickly the plat had to be filed with the County. ARDEN HILLS PLANNING COMMISSION – September 9, 2020 13 Community Development Manager/City Planner Mrosla commented the applicant would have 60 days to file the plat with the County. Commissioner Jones recommended Condition 3 be amended to read sixty (60) days. There being no additional comment Chair Gehrig closed the public hearing at 8:16 p.m. Commissioner Vijums moved and Commissioner Wicklund seconded a motion to recommend approval of Planning Case 20-010 for a Planned Unit Development, Conditional Use Permit and Preliminary Plat/Final Plat at 4200 Round Lake Road based on the findings of fact and the submitted plans, as amended by the thirty-one (31) conditions as amended in the September 9, 2020, report to the Planning Commission. A roll call vote was taken. The motion carried unanimously (7-0). UNFINISHED AND NEW BUSINESS None. REPORTS A. Report from the City Council Councilmember Scott provided the Commission with an update from the City Council. He reported City Hall remains closed, but all City activities were operational. He noted all City meetings were being held virtually. He explained a Special JDA meeting was held on September 8th but the County representatives were not in attendance. He indicated the Ramsey County Sheriff’s Department would not be participating in Night to Unite. He discussed the staff changes that have occurred at City Hall. He stated he supported Commissioner Vijums recommendation that City Code be addressed to reduce the number of variance requests. B. Planning Commission Comments and Requests Commissioner Jefferys thanked staff for providing the Commission with detailed staff reports for each Planning Case. She stated she looked forward to being able to meet in person someday. Commissioner Weber requested the meeting packets be mailed out sooner in order to provide Commissioner’s with more time to review the material. Community Development Manager/City Planner Mrosla explained the Commission members could pick up their packets at City Hall the Thursday prior to each meeting. He noted staff has discussed the possibility of delivering packets. Councilmember Scott stated he would bring this concern to the City Council and explained all Council packets were hand delivered. ADJOURN ARDEN HILLS PLANNING COMMISSION – September 9, 2020 14 Commissioner Vijums moved, seconded by Commissioner Jefferys, to adjourn the September 9, 2020, Planning Commission Meeting at 8:28 p.m. A roll call vote was taken. The motion carried unanimously (7-0). City of Arden Hills City Council Meeting for September 28, 2020 P:\Planning\Planning Cases\2019\19-001 - Brausen - PUD, SP\CC Packet\DA Page 1 of 2 CONSENT ITEM – 7I MEMORANDUM DATE: September 28, 2020 TO: Honorable Mayor and City Councilmembers Dave Perrault, City Administrator FROM: Mike Mrosla, Community Development Manager/City Planner SUBJECT: Planning Case # 19-001 Applicant: Brausen Family Automotive Repair Property Location: 1310 W County Road E Request: Development Contract Budgeted Amount: Actual Amount: Funding Source: N/A N/A N/A Council Should Consider the Following Motion to approve the Development Agreement with Brausen Family Automotive Repair, based on the City Council approval of Planning Case 19-001 and 19-021. Background At its June 24, 2019 meeting, the City Council reviewed and approved a Land Use Application for a Final Planned Unit Development (PUD) and Site Plan Review at Brausen Automotive Repair. At that time, the Applicant proposed to demolish the exiting service station, and an associated carwash. The structures would be replaced with a new 7,978 square foot convenience store and a 1,600 square foot carwash. In addition, the applicant is proposing a 4,505 square foot garage and repair bay addition. During the PUD process the Applicant received approval for the general site design, building architecture and materials, parking, carwash access, stormwater ponding, landscaping and lighting. After receiving their approvals, the Applicant submitted application for an amended PUD to modify the approved building architecture and materials. The intent of the modifications were to better blend the existing repair garage façade with the proposed additions. However, in order to incorporate the existing repair garage into the design the Applicant requested the flexibility to utilize pre-cast panels on the proposed carwash and repair garage additions. City Code section 1325.05 subd. 7, (D) (3) section below depicts pre-cast panels as an undesirable material. The City of Arden Hills City Council Meeting for September 28, 2020 P:\Planning\Planning Cases\2019\19-001 - Brausen - PUD, SP\CC Packet\DA Page 2 of 2 City Council voted to approve the amended PUD and the material change at their February 24, 2020 meeting. Since that time the project has been delayed due to COVID19 and now the Applicant is moving forward with the project. Constructions is anticipated to start in October 2020. The City Attorney has reviewed the Agreement. The Development Agreement is very basic as no public improvements are proposed and the only security required to be submitted is City permit related escrows. Budget Impact: NA Attachments A. Development Contact with Brausen Family Automotive Repair (reserved for recording information) DEVELOPMENT CONTRACT (Developer Installed Improvements) BRAUSEN’S AUTOMOTIVE This DEVELOPMENT CONTRACT (“Agreement”) is dated effective September 28, 2020, and is entered into by and between the CITY OF ARDEN HILLS, a Minnesota statutory city (“City”) and ________________________________, a Minnesota limited liability company (the “Developer”). 2. CONDITIONS OF APPROVAL. On the 24th day of February, 2020, the Arden Hills City Council approved a amended planned unit development a condition that the Developer enter into this Contract, furnish the security required by it. 3. CITY PLANNING COMMISSION REVIEW AND RECOMMENDATION. On the 5th day of June, 2019, the City Planning Commission reviewed the application at a public hearing and after considering the application, the reports and comments of the City’s staff and consultants, reports and comments of the Developer, and other public comments; and, subject to conditions, recommended approval of the Final Planned Unit Development (PUD) and Site Plan Review. 4. CITY COUNCIL REVIEW. On the 24th day of February, 2020, the City Council reviewed the application, the reports and recommendations of the City’s staff and consultants, the reports and requests of the Developer, and the recommendations of the City Planning Commission, and has approved the Final Planned Unit Development (PUD) and Site Plan Review, all subject to the terms and conditions contained herein. On the 24th day of February, 2020, the Arden Hills City Council approved an amended planned unit development a condition that the Developer enter into this Contract, furnish the security required by it. 5. TERMS AND CONDITIONS. In consideration of the City’s development approvals, in compliance with the City’s development regulations, and in consideration of the undertakings expressed herein, the parties agree: 1. The project shall be completed in accordance with the plans submitted as amended by the conditions of approval. Any significant changes to the plans, as determined by the City Planner, shall require review and approval by the City Council. 2. This approval does not include signs. A separate sign permit is required for all proposed signage. All signage shall meet the requirements of Sign District 4. 3. Prior to the issuance of a building permit, a landscape financial security of $5,000.00 dollars shall be submitted. Landscape financial security is held for two full growing seasons. 4. Before construction, grading, or land clearing begins, trees or tree areas that are to be preserved shall be visibly marked and city-approved tree protection fencing or other method shall be installed and maintained at the critical root zones of the trees to be protected. The location of the fencing shall be in conformance with the approved tree preservation plan and approved by staff in writing. 5. All rooftop or ground mounted mechanical equipment shall be hidden from view with the same materials used on the building in accordance with City Code requirements. 6. Prior to the issuance of a building permit, the Applicant shall submit a materials board to be approved in writing by staff. 7. Prior to the issuance of a building permit, the Applicant shall provide a snow removal and storage plan detailing how snowfalls will be accommodated on site. 8. The Applicant shall be responsible for obtaining a land disturbance permit from the City’s Engineering Division prior to the commencement of any site activities as well as any necessary right-of-way permits from the city and Ramsey County. 9. The Applicant shall be responsible for obtaining any other permits necessary from other agencies, including but not limited to, MPCA, Rice Creek Watershed District, and Ramsey County prior to the start of any site activities. 10. All disturbed boulevards shall be restored with sod. 11. The Applicant shall be responsible for protecting the proposed on-site storm sewer infrastructure and components and any existing storm sewer from exposure to any and all stormwater runoff, sediments and debris during all construction activities. Temporary stormwater facilities shall be installed to protect the quality aspect of the proposed and existing stormwater facilities prior to and during construction activities. Maintenance of any and all temporary stormwater facilities shall be the responsibility of the Applicant. 12. Prior to the issuance of a building permit, the Engineering Division shall review and approve the utility plan in writing. 13. The Applicant shall provide a minimum stacking of four (4) vehicles for the car wash. 14. Bollards or a similar material shall be placed between the carwash queue and the convenience store parking lot and gas pumps to clearly delineate the carwash queuing area. 15. After three (3) months of car wash operation, the Applicant and staff shall review traffic operations. The Applicant shall implement any improvements recommended by the City Engineer at that time. 16. Bike racks shall be provided. 17. If the need is identified by the City, the proof of parking spaces shall be installed. 18. All light poles shall be a maximum of 25 feet in height, including base, and shall be shoebox style, downward directed, with high-pressure sodium or LED lamps and flush lens. Other than wash or architectural lighting, attached security lighting shall be shoebox style, downward directed with flush lens. In addition, any entry lighting under canopies shall be recessed and use a flush lens. Shields shall also be added as directed by the City. 19. No neon banding shall be permitted on the fuel canopy. 20. No exterior storage shall be permitted onsite. 21. Overnight vehicle storage is prohibited. All overnight vehicle storage shall be stored indoors. 22. The final design and orientation of the carwash will be determined prior to review by City Council. 6. DEVELOPMENT PLANS. The plat shall be developed in accordance with the following plans, which will be retained in Arden Hills Planning File No. PC 19-001 and 19-021. The plans shall not be attached to this Contract. The plans are: Plan A – Title Sheet (C1), dated 01/14/19 Plan B - Existing Conditions (C4) dated 01/14/19 Plan C – Sanitary Sewer, Watermain & Storm Sewer Plan (C7), dated 01/14/19 Plan D – Grading & Erosion Control Plan (C5), dated 01/14/19 Plan E - Staging Plan (C6), dated 01/14/19 Plan F – Site Plan (C6), dated 05/08/19 Plan G – Restoration and Paving Plan (C8), dated 01/14/19 Plan H - Tree Survey and Preservation Plan (PP-7 and PP-8), dated 02/25/15 Plan I - Landscape Plan (L1) dated 05/08/19 Plan J - Demolition Plan (D1) dated 05/08/19 Plan K – Floor Plans (A2, A4 - S4) dated 05/08/19 Plan L – Building Elevations (A3) dated 12/11/19 7. PERMITS. The Developer shall obtain or require its contractors and subcontractors to obtain all necessary permits, including but not limited to: • Ramsey County for County Road Access and Work in County Rights-of-Way • City of Arden Hills for Building Permits, Sewer and Water, , Grading and Erosion Control Permit • Rice Creek Watershed District for erosion control permit and storm water management permit 8. LICENSE. The Developer hereby grants the City, its agents, employees, officers and contractors a license to enter the subject property to perform all work and inspections deemed appropriate by the City in conjunction with plat development. 9. EROSION CONTROL. The plat shall be graded in accordance with the approved grading development and erosion control plan. The plan shall conform to City of Arden Hills specifications. Within thirty (30) days after completion of the grading and before the City approves individual building permits the Developer shall provide the City with an "as constructed" grading plan certified by a registered land surveyor or engineer that all ponds, swales, and ditches for public drainage have been constructed on public easements or land owned by the City. Notwithstanding the foregoing, the City may issue building permits to the Developer, prior to completion of all grading, provided the City Engineer has determined that adequate erosion control measures are in place. The "as constructed" plan shall include field verified elevations of the following: a) cross sections of ponds; b) location and elevations along all swales, wetlands, wetland mitigation areas if any, ditches, locations and dimensions of borrow areas/stockpiles, and installed "conservation area" posts; and c) lot corner elevations. The City will withhold issuance of building permits until the approved certified grading plan is on file with the City and all erosion control measures are in place as determined by the City Engineer. 10. CLEAN UP. The Developer shall clean dirt and debris from streets that has resulted from construction work by the Developer, home builders, subcontractors, their agents or assigns. Prior to any construction in the plat, the Developer shall identify in writing a responsible party and schedule for erosion control, street cleaning, and street sweeping. 11. CONSTRUCTION ACCESS. Construction traffic access and egress for grading, public utility construction, and building construction is restricted to access the subdivision via County Road E. No construction traffic is permitted on the adjacent local streets. 12. LANDSCAPING & TREE PRESERVATION. All landscaping including tree plantings shall be installed in accordance with the approved landscape plan, Plan L1. 13. TOTAL SECURITIES, ESCROWS AND CASH REQUIREMENTS: The following is a summary of the cash requirements under this Agreement which must be furnished to the City at the time of issuance of a building permit: Amount a. Right of way/Sewer/Sanitary Sewer $ 4,000.00 b. Grading & Erosion Control $ 3,675.00 c. Landscaping $ 5,000.00 Total Cash Requirements $ 12,675.00 14. DEVELOPER’S DEFAULT. In the event of default by the Developer as to any of the work to be performed by it hereunder, the City may, at its option, perform the work and the Developer shall promptly reimburse the City for any expense incurred by the City, provided the Developer, except in an emergency as determined by the City, is first given notice of the work in default, not less than forty-eight (48) hours in advance. This Contract is a license for the City to act, and it shall not be necessary for the City to seek a Court order for permission to enter the land. When the City does any such work, the City may, in addition to its other remedies, assess the cost in whole or in part. 15. Miscellaneous. If the City determines that the plat does not comply, the City may, at its option, refuse to allow construction or development work in the plat until the Developer does comply. Upon the City’s demand, the Developer shall cease work until there is compliance. In addition to all legal or equitable remedies, breach of any material term of this Agreement by the Developer shall be grounds for denial of building permits, including lots sold to third parties, and Certificates of Occupancy. CITY: CITY OF ARDEN HILLS By: ______________________________________ David Grant, Mayor (SEAL) And _____________________________________ Julie Hanson, City Clerk STATE OF MINNESOTA ) ( ss. COUNTY OF RAMSEY ) The foregoing instrument was acknowledged before me this _______ day of _________________, 2020, by David Grant and by Julie Hanson, respectively the Mayor and City Clerk of the City of Arden Hills, a Minnesota statutory city, on behalf of the City and pursuant to the authority granted by its City Council. __________________________________________ Notary Public DEVELOPER: _______________________________ By: ______________________________________ __________, Its _____________________ STATE OF MINNESOTA ) ( ss. COUNTY OF RAMSEY ) The foregoing instrument was acknowledged before me this ________ day of ______________, 2020 by _______________________, the ____________________ of _______________________________, a Minnesota limited liability company, on behalf of the limited liability company. _____________________________________________ Notary Public Page 1 of 1 PUBLIC HEARING – 9A MEMORANDUM DATE: September 28, 2020 TO: Honorable Mayor and City Councilmembers Dave Perrault, City Administrator FROM: Gayle Bauman, Finance Director Mary Tomnitz, Accounting Clerk SUBJECT: Public Hearing Regarding Quarterly Special Assessments for Delinquent Utilities Budgeted Amount: Actual Amount: Funding Source: $ $ $ Council Should Consider the Following Hold a Public Hearing regarding delinquent utilities. Background Water customers whose accounts are 90 days past due were informed that the City intends to certify delinquent charges to Ramsey County to be collected with property taxes. These customers have the right to a hearing in front of the City Council to discuss this matter prior to certification. PUBLIC HEARING – 9B MEMORANDUM DATE: September 28, 2020 TO: Honorable Mayor and City Councilmembers Dave Perrault, City Administrator FROM: Mike Mrosla, Community Development Manager/City Planner SUBJECT: Planning Case # 20-010 – Public Hearing Required Applicant: Scannell Properties Property Location: 4200 Round Lake Road Request: Master Planned Unit Development, Conditional Use Permit, Site Plan and Preliminary/Final Plat Budgeted Amount: Actual Amount: Funding Source: N/A N/A N/A Council Should Consider the Following: Hold the required public hearing for Planning Case 20-010 for application for a Planned Unit Development, Conditional Use Permit, Site Plan, and Preliminary and Final Plat for a project located at 4200 Road Lake Road. The City Council will be asked to make a formal decision regarding the application under Agenda Item 10B. Background Dan Salzer of Scannell Properties (“Applicant”) has submitted an application for a Planned Unit Development, Conditional Use Permit, Site Plan, and Preliminary and Final Plat for a project located at 4200 Road Lake Road (“Subject Property”). The Applicant is proposing to construct a 250,000 square foot office and warehouse facility on the existing vacant land. The Applicant is also requesting to subdivide the subject parcel into two (2) lots of record. The Subject Property is zoned GB, Gateway Business District and is guided as Light Industrial & Office on the Land Use Plan. 1. Existing Site Conditions: The Subject Property is currently owned by North American Land Company, LLC, a holding company related to Roberts Management Group. The Subject Property comprises two (2) parcels totaling approximately 26.08 acres located south of the cul-de-sac on Gateway Boulevard and north of Interstate 694 and east of 35W. There was a previously existing building located onsite that was removed in 2006. The Subject Property has had a few development proposals in the past. City of Arden Hills City Council Meeting for September 28, 2020 P:\Planning\Planning Cases\2020\20-010 4200 Round Lake Road PP PUD\CC Packets Page 2 of 9 However, none of the projects have come to fruition. The Subject Property has since been vacant with wetlands located adjacent to Interstates (“35W and 694”). The Applicant is proposing to construct a 250,000 square foot office and warehouse facility on the site. The site is highly visible from 694 and 35W. Separate access points to the site will be provided via Gateway Boulevard for employee parking and deliveries. The Applicant’s proposal includes office space, warehousing, and ground level unloading access with 38 dock doors located on the north side of the building. The site proposal includes at-grade office parking lots located on the south side of the building. Plan Evaluation A PUD proposal shall identify any requested modifications from the applicable zoning requirements as well as the reasons why the modifications would be in the public interest and would be consistent with the purpose of the GB District. Modifications to these requirements may be granted by the City without a variance through the PUD process. A full evaluation of the proposal was presented to the Planning Commission on September 9, 2020. The memo to the Planning Commission on this case is provided in Attachment D. Draft minutes from the meeting are included in Attachment E. 1. Chapter 11, Subdivisions A. Preliminary and Final Plat The Applicant is proposing to re-plat the Subject Property. As shown in the image below, the existing land from Lot 2 adjacent to Gateway Boulevard is proposed to transfer to Lot 1 of the Subject Property. City of Arden Hills City Council Meeting for September 28, 2020 P:\Planning\Planning Cases\2020\20-010 4200 Round Lake Road PP PUD\CC Packets Page 3 of 9 Proposed Lots Total Acres Use Lot 1 21.94 Development Parcel Lot 2 3.87 Access drive serving Lot 1 and future development on Lot 2 B. Easements and Right of Way The Subject Parcel requires several easements as part of this proposal. The Subject Property is encumbered by existing sightline easements with Clear Channel for two (2) billboards and an overhead power line easement. In addition, the site has existing wetlands located adjacent to 35W and 694 that require drainage and utility easements be placed over the wetlands. The subdivision ordinance requires streets serving commercial and industrial areas to have a right of way (ROW) width of 70 feet. As part of the platting process the Applicant is required to dedicate approximately .41 acres or approximately 17,860 square feet of ROW along Gateway Boulevard to the City. This dedication of ROW impacted parking lot setbacks. The GB zoning district requires a 50 foot setback from public streets. The applicant was requesting a 30 foot parking lot setback from Gateway Boulevard and due to the required ROW dedication, the Applicant is now requesting a 20 foot setback to the parking area on the north side of the subject parcel. However, several properties along Round Lake Road and Gateway Boulevard have similar or greater reduction in parking lot setbacks. C. Required Improvements All other required improvements, including sewer, water, utilities, and driveway connections to Gateway Boulevard will be constructed in accordance with the City’s Subdivision Code. As a condition of approval, engineering staff shall review and approve final utility and grading plans prior to the issuance of a grading and erosion permit. City of Arden Hills City Council Meeting for September 28, 2020 P:\Planning\Planning Cases\2020\20-010 4200 Round Lake Road PP PUD\CC Packets Page 4 of 9 2. Chapter 13, Zoning Code Review A. District Provisions 1320.13- Flexibility requested According to City Code Section 1320.13, office uses cannot occupy less than 25 percent of a project's total floor area and not more than 50 percent. In addition, warehousing and wholesaling uses shall not exceed 75 percent of the building in which it is located. While the final tenants are unknown at this time, the Applicant is anticipating to attract a wide variety of light industrial tenants with uses including office, manufacturing, research and development, and/or warehousing. The Applicant is requesting flexibility to increase this requirement for warehousing and wholesaling to 85 percent and the remaining 15 percent dedicated to non-warehouse uses such as a combination of uses including-but-not-limited-to office, manufacturing, production, R&D, lab and/or showroom. B. Lot Area – Flexibility Requested The proposed Lot 1 is 21.94 acres and Lot 2 is 3.87 acres in size. The Zoning Code requires a minimum lot size of 5 acres in the GB District. Proposed Lot 2 does not meet this requirement. Lot 2 is highly impacted by numerous encumbrances as shown below. It is important to note the developable area of Lot 2 does not change no matter the platted lot size due to the site constraints. C. Lot Dimensions - Flexibility Requested The City Code requires parcels within the GB District to have a street frontage of at least 100 feet and a lot depth of at least 130 feet. Lot frontage is measured at the minimum front yard setback, which allows buildings to be constructed on a radius, such as on a cul-de-sac or curve. Lot 1 has over 1,400 feet of street frontage along Gateway Boulevard and the minimum lot depth of 326.61 feet. Lot 2 is an existing non-conforming lot with a minimum street frontage width of 50 feet instead of the required 100 feet. The submitted plans are showing a 40 foot street frontage width, the reduction is due to 10 feet being dedicated to the City as ROW as required by the Subdivision code. City of Arden Hills City Council Meeting for September 28, 2020 P:\Planning\Planning Cases\2020\20-010 4200 Round Lake Road PP PUD\CC Packets Page 5 of 9 D. Building Setbacks – Meets Requirements Building setbacks in the GB District are 50 feet for the front yard, 20 feet for the side yard with a minimum of 40 feet total for both side yards, and 20 feet for the rear yard. The proposed building is unique as it has frontage on three (3) streets (I-694, I-35W and Gateway Boulevard). In addition, the Subject Parcel is located on the corner of Round Lake Road and Gateway Boulevard. City Code defines the front yard for corner lots as the shortest street lot line shall be the front lot line. The shortest street lot line is located adjacent to Gateway Boulevard. The proposed building has a minimum front yard setback of 74.8 feet from Gateway Boulevard. Proposed building has a minimum side yard setback from Lot 2 of approximately 32.5 feet and has secondary side yard setback to Lot 2 of 127.9 feet for a total of 160.4 feet. The minimum rear setback is 94.4 feet. E. Parking Setbacks - Flexibility Requested The GB district requires a 50 foot setback for parking areas from public streets and ROW. The applicant was requesting a 30 foot parking lot setback from Gateway Boulevard ROW and due to the required ROW dedication the Applicant is now requesting a 20 foot setback to the parking area on the north side of the subject parcel. According to the Site Plan the proposed parking areas are located approximately 50 feet from the back of curb of Gateway Boulevard. However, several properties along Round Lake Road and Gateway Boulevard have similar or greater reduction in parking lot setbacks. F. Building Height – Flexibility Requested Section 1305.04 of the City Code defines building height as “the vertical distance from the average elevation of the grade along a face of a building to the highest point of the roof surface of flat roofs, the deck line of mansard roofs, or the average height between the eaves and the highest ridge of gable, hip, or gambrel roofs.” These measurements are illustrated in the drawing below. Maximum height in the GB district is 35 feet. The Applicant is proposing a facility with maximum interior clear height of 32 feet. As it directly relates to the interior clear height, the proposed maximum building height measured from the finished floor elevation is 40 feet. However, special requirements for the GB district state that in order to accomplish the intensity and scale of development consistent with the defined purpose of the GB District, multi-story buildings will be encouraged. City of Arden Hills City Council Meeting for September 28, 2020 P:\Planning\Planning Cases\2020\20-010 4200 Round Lake Road PP PUD\CC Packets Page 6 of 9 3. General District Provisions A. Aesthetics - Flexibility Requested The GB district requires materials and colors selected for any individual building shall be compatible with other buildings in the GB District. The Applicant is proposing to use a color palette similar to the existing buildings on Gateway Boulevard. In addition, the GB district requires the exterior materials be a mixture of brick, stone, glass or any combination thereof, except trim and accessories may be metal. The Applicant is requesting flexibility in exterior building materials is requested to better complement the surrounding architecture found on Round Lake Road and Gateway Boulevard. The Applicant is requesting to utilize a combination of painted pre-cast, glass, architectural metal panels with concealed fasteners, and thin brick veneer. B. Screening – Meets Requirements The GB District requires screening for fences, walls, landscaping, and berms including materials with construction details that match or complement the construction of the principle building. The Site Plan submitted by the Applicant depicts significant landscaping along Gateway Boulevard which will assist in screening the loading area and docks from the view of the public. A minimum of one tree shall be provided along the right of way for every 50 feet of public street frontage. The proposed frontage on Gateway Boulevard is 1,484 feet and requires 30 trees. The Applicant is proposing to plant 71 trees along the right of way adjacent to Gateway Boulevard area. Rooftop mechanical equipment is to be screened so as to completely obscure the equipment for view. Any future outdoor trash and waste storage facilities would need to be screened per City Code. City of Arden Hills City Council Meeting for September 28, 2020 P:\Planning\Planning Cases\2020\20-010 4200 Round Lake Road PP PUD\CC Packets Page 7 of 9 C. Parking and Site Operations – Meets Requirements The proposed Site Plan shows three (3) accesses onto Gateway Boulevard. The proposed accesses can be classified as employee and loading driveway accesses. The employee accesses shown are 24 feet wide and the loading driveway access is 35.6 feet wide. The loading access will provide access to the 38 dock doors located on the north side of the building. The eastern employee access is located on Lot 2. This proposed access will be a shared access driveway for both Lot 1 and Lot 2 when it develops. This will require a cross access and maintenance agreement between the two parcels which will be further addressed in the Development Agreement related to the Project. The Zoning Code has access/driveway width standards for streets classified as minor and collector streets. However, Gateway Boulevard is classified as neither a minor or collector roadway and instead it is identified as a municipal state aid street. The Public Works Director/City Engineer has reviewed the proposed accesses and determined they are sufficiently sized for the proposed use. The Applicant has provided a semi-trailer turning exhibit showing that the vehicles can access and maneuver appropriately in the proposed loading area. The Applicant is proposing that building would be a maximum of 85 percent warehouse and a minimum of 15 percent office. Per City Code, Business & Professional Office uses must provide one (1) parking space for each 250 sq. ft. of gross floor area. The proposed office floor area is 37,500 square feet and that would require 150 parking stalls. Other Business and Industry uses City of Arden Hills City Council Meeting for September 28, 2020 P:\Planning\Planning Cases\2020\20-010 4200 Round Lake Road PP PUD\CC Packets Page 8 of 9 would need to provide one (1) for each employee on shift plus one (1) for each vehicle used in conducting the business or one (1) for each 1,000 sq. ft. of floor area, whichever is greater. The Applicant is proposing a floor area of 212,500 square feet and would require 212 parking stalls. The Site Plan depicts 364 parking spaces and the proposed uses require 362 stalls. In the event additional parking is required to meet the demands of the future tenant the Applicant is proposing 230 proof of parking stalls located in the northwest sections of the site as shown below. This would bring the total parking onsite to 593 parking stalls. If the proof of parking stalls are needed the Applicant will need to construct an underground retention area in the same area to replace the existing stormwater pond. D. Minimum Caliper Inches – Flexibility Requested Tree mitigation is not required as the current site has no trees deemed significant per City Code. The Zoning Code requires that a minimum number of caliper inches of trees be provided based on the gross square footage of the building on the property. A single story building in excess of thirty (30) feet in height shall be considered a two-story building for the purposes of determining gross square footage. The proposed building would be considered a two-stories, and includes 499,552 gross square feet. This requires a minimum of 1,561 caliper inches or 624 two (2) caliper trees. The proposed site is limited to where trees can be planted onsite due the wetlands and overhead power lines. In response the Applicant is proposing 310 caliper inches or 110 trees. The proposed landscape plan includes a variety of tree species, including maples, oaks and evergreens, ranging in size from two and half (2.5) to six (6) caliper inches. This is consistent with ordinance requirements. The Applicant is proposing to plant six (6) to twelve (12) foot tall evergreens. E. Landscaped Area and Perennials and Shrubberies – Flexibility Requested Zoning Code requires 35 percent of the site to be landscaped or 339,674 square feet. The landscaping plan shows that the total landscaped area provided on the site is 652,668 square feet. The Zoning Code requires a minimum of 10 percent of the total landscaped area to be covered with perennials and/or shrubbery. The total landscaped area on the site is 652,668 square feet, resulting in the need for a minimum of 65,266 square feet of perennial and shrubbery cover. The Applicant is proposing 2,888 square feet perennial and shrub planting beds. However, the Applicant is proposing to use over 170,000 square feet of Mesic Prairie seed mix onsite. Mesic Prairie is a prairie plant community dominated by native grasses such as big bluestem, switchgrasses and including abundant wildflowers. F. Traffic Study A traffic study was required and was completed by Kimley-Horn and Associates. The anticipated trip generation during AM peak is 80 vehicles in and out of the site. The 80 vehicles includes eight (8) warehouse related vehicles and 72 passenger vehicles. The PM peak is 83 vehicles in and out of the site. The 80 vehicles includes eight (8) warehouse related vehicles and 75 passenger vehicles. The proposed trip generation is fairly low based on the proposed use of 85 percent warehouse and 15 percent office space. The traffic study only had one recommended improvement. The recommendation requests Ramsey County to add five (5) seconds to the signal timing for Round Lake Road and Hwy 96 to allow for more northbound left turns during the PM peak hour. City of Arden Hills City Council Meeting for September 28, 2020 P:\Planning\Planning Cases\2020\20-010 4200 Round Lake Road PP PUD\CC Packets Page 9 of 9 G. Park Dedication City Code 1130.08 requires that all subdivisions dedicate land to the City for a public use as a condition of approval for the development. In commercial or industrial subdivisions where a land dedication is required, seven and a half (7.5) percent of the gross area of the subdivision shall be used to determine the parkland dedication. For the 21.94 acre development proposed, a 1.64 acre park dedication would be required. A cash contribution in lieu of land dedication may be required at the discretion of the City. The cash contribution fee shall be seven and a half (7.5) percent of the fair market value of the unimproved land. Cash contributions for land dedication or park improvements are to be calculated at the time of the Final Plat approval. The City may require the payment prior to the release of the Final Plat or at a later time under terms agreed upon in the development agreement. Park dedication for Lot 2 will be determined at the time of development. Public Notice and Comments A Notice was published in the Pioneer Press on September 18, 2020. Staff has not received and comments. Attachments A. Application B. Location Map C. 11x17 Plan Sets D. Traffic Study E. September 9, 2020 - Planning Commission Memo F. September 9, 2020 - Draft Planning Commission Minutes G. CC PowerPoint Presentation Attachment A T0V(`5 CE ` sSFd9151?x|5:!|5d.8wv5ke"g1G fl#@$U_y6/mz263a$tn{6 D6Hm;~36jKZ[A% gl*6UI&,]>r| h3Oa@6l|oVPb W&M646^$pp} $$X\+QJ7q|cYl<B6R=nc$NmiC7~6Liu)l '7 - $WWDFKPHQW% Attachment C K:\TWC_LDEV\Scannell\arden hills, mn\3 Design\CAD\plansheets\C0-COVER SHEET.dwg August 21, 2020 - 1:00pmSHEETNOT FOR CONSTRUCTIONBRJBRJ/LEC71155-200422020 KIMLEY-HORN AND ASSOCIATES, INC.767 EUSTIS STREET, SUITE 100, ST. PAUL, MN 551141 CITY SUBMITTAL 5/1/20202 CITY SUBMITTAL 7/20/20203 WATERSHED UPDATE 7/24/20204 WATERSHED UPDATE 8/21/2020NORTHVICINITYN.T.S.SITEARDEN HILLS, RAMSEY COUNTY, MN1. CONTRACTOR SHALL CONFIRM THAT THE EXISTING CONDITIONS FOR THE SITE MATCHWHAT IS SHOWN ON THE DRAWINGS INCLUDED PRIOR TO CONSTRUCTION.2. IF REPRODUCED, THE SCALES SHOWN ON THESE PLANS ARE BASED ON A 30x42 SHEET.3. ALL NECESSARY INSPECTIONS AND/OR CERTIFICATIONS REQUIRED BY CODES AND/ORUTILITY SERVICES COMPANIES SHALL BE PERFORMED PRIOR TO ANNOUNCED BUILDINGPOSSESSION AND THE FINAL CONNECTION OF SERVICES.4. ALL GENERAL CONTRACTOR WORK TO BE COMPLETED (EARTHWORK, FINAL UTILITIES,AND FINAL GRADING) BY THE MILESTONE DATE IN PROJECT DOCUMENTS.NOTES:PROJECT TEAM:GATEWAY INTERSTATESECTION 21, TOWNSHIP 30N, RANGE 23WFORSITE DEVELOPMENT PLANSLANDSCAPE ARCHITECTRYAN HYLLESTED, P.L.A.767 EUSTIS STREET, SUITE 100ST. PAUL, MN 55114TELEPHONE (651) 645-4197GEOTECHNICAL ENGINEERAMERICAN ENGINEERING TESTING, INC.550 CLEVELAND AVENUE NORTHST. PAUL, MN 55114TELEPHONE: (651)-659-1305CONTACT: JEFFERY K. VOYEN, PESURVEYORSUNDE LAND SURVEYING6776 LAKE DRIVE NE, SUITE 110BLOOMINGTON, MN, 55420-3435TELEPHONE: (952)-881-2455FAX: (952)-888-9526CONTACT: LEONARD F. CARLSON, P.L.S.ENGINEERKIMLEY-HORN AND ASSOCIATES, INC.BENJAMIN R. JOHNSON, PE767 EUSTIS STREET, SUITE 100ST. PAUL, MN 55114TELEPHONE (651) 645-4197OWNER / DEVELOPERSCANNELL PROPERTIES8801 RIVER CROSS BLVD., SUITE 300INDIANAPOLIS, IN 46240TELEPHONE: (763) 331-8854CONTACT: DAN SALZER694INTERSTATE 35WSheet List TableSheet Number Sheet TitleC000 COVER SHEETC200 EXISTING CONDITIONS AND REMOVALS PLANC300 EROSION AND SEDIMENT CONTROL PLAN - PHASE 1C301 EROSION AND SEDIMENT CONTROL PLAN - PHASE 2C400 SITE PLANC500 GRADING PLANC501 STORMWATER MANAGEMENT PLANC600UTILITY PLANC601 WATERMAIN PROFILEC602 WATERMAIN PROFILEC603 WATERMAIN PROFILEC604 WATERMAIN PROFILEC605 WATERMAIN PROFILEC700 CIVIL DETAILSL100 LANDSCAPE PLANL101 LANDSCAPE ENLARGEMENT- NORTHEASTL102 LANDSCAPE ENLARGEMENT - SOUTHWESTL103 LANDSCAPE ENLARGEMENT - SOUTHEASTL104LANDSCAPE DETAILS, NOTES, & SCHEDULEEX-1SITE EXHIBIT - SNOW STORAGE, TRUCK ACCESS, FUTURE PARKING K:\TWC_LDEV\Scannell\arden hills, mn\3 Design\CAD\plansheets\C2-DEMO PLAN.dwg August 21, 2020 - 1:01pmSHEETNOT FOR CONSTRUCTIONBRJBRJ/LEC71155-200422020 KIMLEY-HORN AND ASSOCIATES, INC.767 EUSTIS STREET, SUITE 100, ST. PAUL, MN 551141 CITY SUBMITTAL 5/1/20202 CITY SUBMITTAL 7/20/20203 WATERSHED UPDATE 7/24/20204 WATERSHED UPDATE 8/21/20201. THE CONTRACTOR IS RESPONSIBLE FOR THE DEMOLITION, REMOVAL, AND DISPOSAL (IN ALOCATION APPROVED BY ALL GOVERNING AUTHORITIES) ALL STRUCTURES, PADS, WALLS,FLUMES, FOUNDATIONS, PARKING, DRIVES, DRAINAGE STRUCTURES, UTILITIES, ETC. SUCH THATTHE IMPROVEMENTS ON THE PLANS CAN BE CONSTRUCTED. ALL FACILITIES TO BE REMOVEDSHALL BE UNDERCUT TO SUITABLE MATERIAL AND BROUGHT TO GRADE WITH SUITABLECOMPACTED FILL MATERIAL PER THE PROJECT DOCUMENTS.2. THE CONTRACTOR IS RESPONSIBLE FOR REMOVING ALL DEBRIS FROM THE SITE AND DISPOSINGTHE DEBRIS IN A LAWFUL MANNER. THE CONTRACTOR IS RESPONSIBLE FOR OBTAINING ALLPERMITS REQUIRED FOR DEMOLITION AND DISPOSAL. CONTRACTOR SHALL PROVIDE COPIES OFTHE PERMIT AND RECEIPTS OF DISPOSAL OF MATERIALS TO THE OWNER AND OWNERSREPRESENTATIVE.3. THE CONTRACTOR SHALL MAINTAIN ALL UTILITY SERVICES TO ADJACENT PROPERTIES AT ALLTIMES. UTILITY SERVICES SHALL NOT BE INTERRUPTED WITHOUT APPROVAL FROM THECONSTRUCTION MANAGER AND COORDINATION WITH THE ADJACENT PROPERTIES AND/OR THECITY.4. THE CONTRACTOR SHALL COORDINATE WITH RESPECTIVE UTILITY COMPANIES PRIOR TO THEREMOVAL AND/OR RELOCATION OF UTILITIES. THE CONTRACTOR SHALL COORDINATE WITH THEUTILITY COMPANY CONCERNING PORTIONS OF WORK WHICH MAY BE PERFORMED BY THE UTILITYCOMPANY'S FORCES AND ANY FEES WHICH ARE TO BE PAID TO THE UTILITY COMPANY FOR THEIRSERVICES. THE CONTRACTOR IS RESPONSIBLE FOR PAYING ALL FEES AND CHARGES.5. THE LOCATIONS OF ALL EXISTING UTILITIES SHOWN ON THE PLAN HAVE BEEN DETERMINED FROMTHE BEST INFORMATION AVAILABLE AND ARE GIVEN FOR THE CONVENIENCE OF THECONTRACTOR. THE ENGINEER ASSUMES NO RESPONSIBILITY FOR THEIR ACCURACY. PRIOR TOTHE START OF ANY DEMOLITION ACTIVITY, THE CONTRACTOR SHALL NOTIFY THE UTILITYCOMPANIES FOR LOCATIONS OF EXISTING UTILITIES WITHIN ALL AREAS OF PROPOSED WORK.6. ALL EXISTING SEWERS, PIPING AND UTILITIES SHOWN ARE NOT TO BE INTERPRETED AS THEEXACT LOCATION, OR AS ANY OBSTACLES THAT MAY OCCUR ON THE SITE. VERIFY EXISTINGCONDITIONS AND PROCEED WITH CAUTION AROUND ANY ANTICIPATED FEATURES. GIVE NOTICETO ALL UTILITY COMPANIES REGARDING DESTRUCTION AND REMOVAL OF ALL SERVICE LINES ANDCAP ALL LINES BEFORE PRECEDING WITH THE WORK.7. ELECTRICAL, TELEPHONE, CABLE, WATER, FIBER OPTIC, AND/OR GAS LINES NEEDING TO BEREMOVED OR RELOCATED SHALL BE COORDINATED WITH THE AFFECTED UTILITY COMPANY.ADEQUATE TIME SHALL BE PROVIDED FOR RELOCATION AND CLOSE COORDINATION WITH THEUTILITY COMPANY IS NECESSARY TO PROVIDE A SMOOTH TRANSITION IN UTILITY SERVICE.CONTRACTOR SHALL PAY CLOSE ATTENTION TO EXISTING UTILITIES WITHIN ANY ROADRIGHT-OF-WAY DURING CONSTRUCTION.8. CONTRACTOR MUST PROTECT THE PUBLIC AT ALL TIMES WITH FENCING, BARRICADES,ENCLOSURES, ETC. (AND OTHER APPROPRIATE BEST MANAGEMENT PRACTICES) AS APPROVEDBY THE CONSTRUCTION MANAGER. MAINTENANCE OF TRAFFIC CONTROL SHALL BECOORDINATED IN ACCORDANCE WITH ARDEN HILLS, RAMSEY COUNTY AND MN/DOT.9. CONTRACTOR SHALL MAINTAIN ACCESS TO ALL ADJACENT PROPERTIES DURING CONSTRUCTION,AND SHALL NOTIFY ALL PROPERTIES IF ACCESS WILL BE INTERRUPTED OR ALTERED AT ANY TIMEDURING CONSTRUCTION.10. PRIOR TO DEMOLITION OCCURRING, ALL EROSION CONTROL DEVICES ARE TO BE INSTALLED.11. CONTRACTOR MAY LIMIT SAW-CUT AND PAVEMENT REMOVAL TO ONLY THOSE AREAS WHERE IT ISREQUIRED AS SHOWN ON THESE CONSTRUCTION PLANS BUT IF ANY DAMAGE IS INCURRED ONANY OF THE SURROUNDING PAVEMENT, ETC. THE CONTRACTOR SHALL BE RESPONSIBLE FOR ITSREMOVAL AND REPAIR.12. THE CONTRACTOR SHALL COORDINATE WATER MAIN WORK WITH THE FIRE DEPT. AND THE CITYWATER DEPARTMENT TO PLAN PROPOSED IMPROVEMENTS AND TO ENSURE ADEQUATE FIREPROTECTION IS CONSTANTLY AVAILABLE TO THE SITE THROUGHOUT THIS SPECIFIC WORK ANDTHROUGH ALL PHASES OF CONSTRUCTION. CONTRACTOR WILL BE RESPONSIBLE FORARRANGING/PROVIDING ANY REQUIRED WATER MAIN SHUT OFFS WITH THE CITY OF ARDEN HILLSDURING CONSTRUCTION. ANY COSTS ASSOCIATED WITH WATER MAIN SHUT OFFS WILL BE THERESPONSIBILITY OF THE CONTRACTOR AND NO EXTRA COMPENSATION WILL BE PROVIDED.13. REFER TO SURVEY FOR ALL EXISTING INVERT AND RIM ELEVATIONS.14. ALL UTILITIES SHOWN ARE EXISTING UTILITIES.15. IN THE EVENT A WELL IS FOUND, THE CONTRACTOR SHALL CONTACT THE ENGINEER AND OWNERIMMEDIATELY. ALL WELLS SHALL BE SEALED BY A LICENSED WELL CONTRACTOR IN ACCORDANCEWITH ALL STATE OF MN REQUIREMENTS.16. IN THE EVENT THAT UNKNOWN CONTAINERS OR TANKS ARE ENCOUNTERED, THE CONTRACTORSHALL CONTACT THE OWNER AND/OR OWNERS REPRESENTATIVE IMMEDIATELY. ALL CONTAINERSSHALL BE DISPOSED OF AT A PERMITTED LANDFILL PER THE PROJECT DOCUMENTS.17. CONTRACTOR SHALL NOTIFY THE ENGINEER IF ANY EXISTING DRAINTILE IS ENCOUNTERED ONSITE. NO ACTIVE DRAINTILE SHALL BE REMOVED WITHOUT APPROVAL FROM THE ENGINEER.DEMOLITION PLAN NOTESNORTHKEYNOTE LEGENDPROTECT IN PLACE EXISTING UNDERGROUND UTILITYPROTECT IN PLACE EXISTING UTILITY STRUCTUREPROTECT IN PLACE EXISTING OVERHEAD POWERPROTECT IN PLACE EXISTING POWER POLEPROTECT IN PLACE EXISTING SIGN; LOCATION APPROXIMATE -CONTRACTOR TO VERIFY LOCATION IN FIELDPROTECT IN PLACE EXISTING BILLBOARDPROTECT IN PLACE EXISTING STREET LIGHT POLE; LOCATIONAPPROXIMATE - CONTRACTOR TO VERIFY LOCATION IN FIELDPROTECT IN PLACE EXISTING FIRE HYDRANTREMOVE EXISTING ABANDONED SANITARY SEWER PER CITYSPECIFICATIONSREMOVE EXISTING WATERMAIN PER CITY SPECIFICATIONSPROTECT IN PLACE EXISTING TREEREMOVE EXISTING TREEREMOVE, SALVAGE, AND REINSTALL EXISTING STREET LIGHT POLE;COORD W/CITY OF ARDEN HILLS. LOCATION APPROXIMATE -CONTRACTOR TO VERIFY LOCATION IN FIELDEXISTING MONITORING WELL, REMAIN PROTECT FROM DAMAGEPROTECT IN PLACE EXISTING FENCEREMOVE EXISTING SANITARY MANHOLE PER CITY SPECIFICATIONSREMOVE EXISTING FIRE HYDRANT PER CITY SPECIFICATIONSFULL DEPTH SAWCUTREMOVE, SALVAGE, AND REINSTALL EXISTING SIGNREMOVE EXISTING POWER POLE; COORD. W/ PRIVATE UTILITYRELOCATE EXISTING OVERHEAD POWER UNDERGROUND; COORD.W/ PRIVATE UTILITYEXISTING IMPACTED VEGETATIONREMOVE EXISTING STORM SEWERREMOVE EXISTING STORM SEWER STRUCTUREREMOVE EXISTING RAILORAD TRACKS AND REPLACE WITHPERMANENT TYPE 3 BARRIER, EXISTING ACCESS ROAD TO REMAINABCDEFGHIJKLMNOPQRSTUVWXYLIMITS OF CONSTRUCTIONREMOVE BITUMINOUS SURFACEREMOVE CONCRETE SURFACEWETLAND IMPACT (±1.63 AC)REMOVE TREEREMOVE CONCRETE CURB & GUTTERREMOVE UTILITY LINESPROPERTY LINEEXISTING OVERHEAD POWER LINEEXISTING CHAINLINK FENCEEXISTING SANITARY SEWEREXISTING STORM SEWEREXISTING WATERMAINEXISTING GAS MAINEXISTING UNDERGROUND TELEPHONEEXISTING UNDERGROUND CABLEEXISTING CONTOUREXISTING SIGNEXISTING FLARED END SECTIONEXISTING STORM MANHOLEEXISTING STORM CATCHBASINEXISTING GAS METEREXISTING POST INDICATOR VALVEEXISTING WELLEXISTING AUTOMATIC SPRINKLEREXISTING ROOF DRAINEXISTING GATE VALVEEXISTING HYDRANTEXISTING METAL COVEREXISTING ELECTRICAL METEREXISTING AIR CONDITIONEREXISTING TELEPHONE MANHOLEEXISTING CABLE BOXEXISTING GUY WIREEXISTING POWER POLEEXISTING LIGHT POLEEXISTING TREECLEARING & GRUBBINGFILL & ABANDON UTILITY LINESEXISTING TREE LINEEXISTING CURB & GUTTERLEGENDFULL DEPTH SAWCUT K:\TWC_LDEV\Scannell\arden hills, mn\3 Design\CAD\plansheets\C3-EROS PH1 PLAN.dwg August 21, 2020 - 1:01pmSHEETNOT FOR CONSTRUCTIONBRJBRJ/LEC71155-200422020 KIMLEY-HORN AND ASSOCIATES, INC.767 EUSTIS STREET, SUITE 100, ST. PAUL, MN 551141 CITY SUBMITTAL 5/1/20202 CITY SUBMITTAL 7/20/20203 WATERSHED UPDATE 7/24/20204 WATERSHED UPDATE 8/21/2020XCXXXNORTHEROSION CONTROL PLAN NOTES1. ALL PERIMETER SILT FENCE AND ROCK CONSTRUCTION ENTRANCES SHALL BEINSTALLED PRIOR TO CONSTRUCTION.2. THE CONTRACTOR SHALL CONSTRUCT DRAINAGE BASINS PRIOR TO SITE GRADING.3. THE CONTRACTOR SHALL INSTALL CATCH BASIN EROSION CONTROL MEASURES.4. WITHIN ONE WEEK (7 DAYS) OF SITE GRADING, ALL DISTURBED AREAS SHALL BESTABILIZED WITH SEED, SOD, OR ROCK BASE. REFER TO LANDSCAPE PLANS FORMATERIALS.5. ALL EROSION CONTROL MEASURES SHALL BE INSTALLED AND MAINTAINED INACCORDANCE WITH CITY, STATE, AND WATERSHED DISTRICT PERMITS.6. THE CONTRACTOR SHALL MAINTAIN ALL EROSION CONTROL MEASURES, INCLUDINGTHE REMOVAL OF SILT IN FRONT OF SILT FENCES DURING THE DURATION OF THECONSTRUCTION.7. ANY EXCESS SEDIMENT IN PROPOSED BASINS SHALL BE REMOVED BY THECONTRACTOR.8. REMOVAL ALL EROSION CONTROL MEASURES AFTER VEGETATION IS ESTABLISHED.9. THE CONTRACTOR SHALL REMOVE ALL SOILS AND SEDIMENT TRACKED ONTOEXISTING STREETS AND PAVED AREAS AND SHALL SWEEP ADJACENT STREETS ASNECESSARY IN ACCORDANCE WITH CITY REQUIREMENTS.10. IF BLOWING DUST BECOMES A NUISANCE, THE CONTRACTOR SHALL APPLY WATERFROM A TANK TRUCK TO ALL CONSTRUCTION AREAS.UPON IMPLEMENTATION AND INSTALLATION OF THE FOLLOWING AREAS: TRAILER,PARKING, LAYDOWN, PORTA-POTTY, WHEEL WASH, CONCRETE WASHOUT, FUELAND MATERIAL STORAGE CONTAINERS, SOLID WASTE CONTAINERS, ETC.,IMMEDIATELY DENOTE THEM ON THE SITE MAPS AND NOTE ANY CHANGES INLOCATION AS THEY OCCUR THROUGHOUT THE CONSTRUCTION PROCESS.BMP AND EROSION CONTROL INSTALLATION SEQUENCE SHALL BE AS FOLLOWS:1. INSTALL INLET PROTECTION AT EXISTING STORMWATER CULVERTS.2. CONSTRUCT STABILIZED CONSTRUCTION ENTRANCE (1), CONCRETE WASHOUTPIT (1) AND INSTALL SILT FENCE.3. PREPARE TEMPORARY PARKING AND STORAGE AREA.4. CONSTRUCT AND STABILIZE DIVERSIONS AND TEMPORARY SEDIMENT TRAPS.5. PERFORM CLEARING AND GRUBBING OF THE SITE. PERFORM MASS GRADING.ROUGH GRADE TO ESTABLISH PROPOSED DRAINAGE PATTERNS.6. START CONSTRUCTION OF THE BUILDING PAD AND STRUCTURES.7. TEMPORARILY SEED WITH PURE LIVE SEED, THROUGHOUT CONSTRUCTION,DISTURBED AREAS THAT WILL BE INACTIVE FOR 7 DAYS OR MORE OR ASREQUIRED BY NPDES AND/OR CITY OF ARDEN HILLS GRADING PERMIT.SEQUENCE OF CONSTRUCTION:ROCK ENTRANCEINLET PROTECTIONSILT FENCELIMITS OF DISTURBANCESAFETY FENCEBIOROLLLEGENDKEYNOTE LEGENDLIMITS OF DISTURBANCEINLET PROTECTIONSILT FENCECONSTRUCTION ENTRANCEDIVERSION DITCHSAFETY FENCEABCDEF132 BHAYDEN FINE SANDY LOAM132 CHAYDEN FINE SANDY LOAM860 CURBAN LAND-HAYDEN-KINGSLEYCOMPLEXDRAINAGE DELINEATIONSOIL BOUNDARYDIVERSION DITCHTEMPORARY SEDIMENT TRAPDRAINAGE AREA AND SEDIMENTTRAP TABLETRIBUTARYDRAINAGEAREASEDIMENTBASINVOLUMESEDIMENT BASIN 1 5.48 AC19,733 CFSEDIMENT BASIN 2 2.16 AC7,773 CFSEDIMENT BASIN 3 4.92 AC17,706 CFSEDIMENT BASIN 4 2.31 AC8,316 CFLIMITS OF DISTURBANCE 17.60 ACTOTAL SITE AREA 26.22 ACPRE-DEVELOPMENT PERVIOUS AREA 25.93 ACPRE-DEVELOPMENT IMPERVIOUS AREA 0.29 ACPOST-DEVELOPMENT PERVIOUS AREA 14.56 ACPOST-DEVELOPMENT IMPERVIOUS AREA 11.66 ACRECEIVING BODY OF WATER: THE SITEDISCHARGES TO ADJACENT WETLAND ON-SITEAND OFF-SITE. THE SITE IS WITHIN 1 MILE OF THEIMPAIRED VALENTINE LAKE, BUT IT DOES NOTCONTRIBUTE FLOW DIRECTLY TO THESE WATERSAS THE DISCHARGE IS LIMITED TO THEADJACENT WETLANDSPH. I BMP QUANTITIESBMP UNITQUANTITYCONSTRUCTIONENTRANCEEA. 1INLET PROTECTION EA12SILT FENCE LF±2,700CONSTRUCTION FENCE LF±1,500THE GC MUST UPDATE THE SWPPP, INCLUDING THE JOBSITE BINDER ANDSITE MAPS, TO REFLECT THE PROGRESS OF CONSTRUCTION ACTIVITIESAND GENERAL CHANGES TO THE PROJECT SITE. UPDATES SHALL BE MADEDAILY TO TRACK PROGRESS WHEN ANY OF THE FOLLOWING ACTIVITIESOCCUR: BMP INSTALLATION, MODIFICATION OR REMOVAL, CONSTRUCTIONACTIVITIES (E.G., PAVING, STORM SEWER INSTALLATION, FOOTINGINSTALLATION, ETC.), CLEARING, GRUBBING OR GRADING, OR TEMPORARYOR PERMANENT STABILIZATION.SWPPP UPDATES AND AMENDMENTSDELINEATED WETLAND K:\TWC_LDEV\Scannell\arden hills, mn\3 Design\CAD\plansheets\C3-EROS PH2 PLAN.dwg August 21, 2020 - 1:02pmSHEETNOT FOR CONSTRUCTIONBRJBRJ/LEC71155-200422020 KIMLEY-HORN AND ASSOCIATES, INC.767 EUSTIS STREET, SUITE 100, ST. PAUL, MN 551141 CITY SUBMITTAL 5/1/20202 CITY SUBMITTAL 7/20/20203 WATERSHED UPDATE 7/24/20204 WATERSHED UPDATE 8/21/2020NORTHEROSION CONTROL PLAN NOTES1. ALL PERIMETER SILT FENCE AND ROCK CONSTRUCTION ENTRANCES SHALL BEINSTALLED PRIOR TO CONSTRUCTION.2. THE CONTRACTOR SHALL CONSTRUCT DRAINAGE BASINS PRIOR TO SITE GRADING.3. THE CONTRACTOR SHALL INSTALL CATCH BASIN EROSION CONTROL MEASURES.4. WITHIN ONE WEEK (7 DAYS) OF SITE GRADING, ALL DISTURBED AREAS SHALL BESTABILIZED WITH SEED, SOD, OR ROCK BASE. REFER TO LANDSCAPE PLANS FORMATERIALS.5. ALL EROSION CONTROL MEASURES SHALL BE INSTALLED AND MAINTAINED INACCORDANCE WITH CITY, STATE, AND WATERSHED DISTRICT PERMITS.6. THE CONTRACTOR SHALL MAINTAIN ALL EROSION CONTROL MEASURES, INCLUDINGTHE REMOVAL OF SILT IN FRONT OF SILT FENCES DURING THE DURATION OF THECONSTRUCTION.7. ANY EXCESS SEDIMENT IN PROPOSED BASINS SHALL BE REMOVED BY THECONTRACTOR.8. REMOVAL ALL EROSION CONTROL MEASURES AFTER VEGETATION IS ESTABLISHED.9. THE CONTRACTOR SHALL REMOVE ALL SOILS AND SEDIMENT TRACKED ONTOEXISTING STREETS AND PAVED AREAS AND SHALL SWEEP ADJACENT STREETS ASNECESSARY IN ACCORDANCE WITH CITY REQUIREMENTS.10. IF BLOWING DUST BECOMES A NUISANCE, THE CONTRACTOR SHALL APPLY WATERFROM A TANK TRUCK TO ALL CONSTRUCTION AREAS.UPON IMPLEMENTATION AND INSTALLATION OF THE FOLLOWING AREAS: TRAILER,PARKING, LAYDOWN, PORTA-POTTY, WHEEL WASH, CONCRETE WASHOUT, FUELAND MATERIAL STORAGE CONTAINERS, SOLID WASTE CONTAINERS, ETC.,IMMEDIATELY DENOTE THEM ON THE SITE MAPS AND NOTE ANY CHANGES INLOCATION AS THEY OCCUR THROUGHOUT THE CONSTRUCTION PROCESS.BMP AND EROSION CONTROL INSTALLATION SEQUENCE SHALL BE AS FOLLOWS:1. INSTALL INLET PROTECTION AT EXISTING STORMWATER CULVERTS.2. CONSTRUCT STABILIZED CONSTRUCTION ENTRANCE (1), CONCRETE WASHOUTPIT (1) AND INSTALL SILT FENCE.3. PREPARE TEMPORARY PARKING AND STORAGE AREA.4. CONSTRUCT AND STABILIZE DIVERSIONS AND TEMPORARY SEDIMENT TRAPS.5. PERFORM CLEARING AND GRUBBING OF THE SITE. PERFORM MASS GRADING.ROUGH GRADE TO ESTABLISH PROPOSED DRAINAGE PATTERNS.6. START CONSTRUCTION OF THE BUILDING PAD AND STRUCTURES.7. TEMPORARILY SEED WITH PURE LIVE SEED, THROUGHOUT CONSTRUCTION,DISTURBED AREAS THAT WILL BE INACTIVE FOR 7 DAYS OR MORE OR ASREQUIRED BY NPDES AND/OR CITY OF ARDEN HILLS GRADING PERMIT.SEQUENCE OF CONSTRUCTION:ROCK ENTRANCEINLET PROTECTIONSILT FENCELIMITS OF DISTURBANCESAFETY FENCELEGENDKEYNOTE LEGENDLIMITS OF DISTURBANCEINLET PROTECTIONSILT FENCECONSTRUCTION ENTRANCERIP RAPINSTALL EROSION CONTROL BLANKET ON SLOPES 4:1 AND STEEPERABCDEFLIMITS OF DISTURBANCE 17.60 ACTOTAL SITE AREA 26.22 ACPRE-DEVELOPMENT PERVIOUS AREA 25.93 ACPRE-DEVELOPMENT IMPERVIOUS AREA 0.29 ACPOST-DEVELOPMENT PERVIOUS AREA 14.56 ACPOST-DEVELOPMENT IMPERVIOUS AREA 11.66 ACRECEIVING BODY OF WATER: THE SITEDISCHARGES TO ADJACENT WETLAND ON-SITEAND OFF-SITE. THE SITE IS WITHIN 1 MILE OF THEIMPAIRED VALENTINE LAKE, BUT IT DOES NOTCONTRIBUTE FLOW DIRECTLY TO THESE WATERSAS THE DISCHARGE IS LIMITED TO THEADJACENT WETLANDSPH. II BMP QUANTITIESBMPUNITQUANTITYCONSTRUCTIONENTRANCEEA. 1INLET PROTECTION EA 27SILT FENCE LF±3,000THE GC MUST UPDATE THE SWPPP, INCLUDING THE JOBSITE BINDER ANDSITE MAPS, TO REFLECT THE PROGRESS OF CONSTRUCTION ACTIVITIESAND GENERAL CHANGES TO THE PROJECT SITE. UPDATES SHALL BE MADEDAILY TO TRACK PROGRESS WHEN ANY OF THE FOLLOWING ACTIVITIESOCCUR: BMP INSTALLATION, MODIFICATION OR REMOVAL, CONSTRUCTIONACTIVITIES (E.G., PAVING, STORM SEWER INSTALLATION, FOOTINGINSTALLATION, ETC.), CLEARING, GRUBBING OR GRADING, OR TEMPORARYOR PERMANENT STABILIZATION.SWPPP UPDATES AND AMENDMENTSDELINEATED WETLANDEROSION CONTROL BLANKET BUILDING DATA SUMMARYAREASPROPOSED PROPERTY1,142,156 SF (26.22 AC)BUILDING AREA250,000 SF (22.9% OF TOTALPROPERTY AREA)PARKINGREQUIRED PARKING363 SPACES @ 4/1,000 SFPROPOSED PARKING363 SPACES @ 4/1,000 RATIOADA STALLS REQ'D / PROVIDED8 STALLS / 8 STALLSPROPERTY SUMMARYGATEWAY INTERSTATETOTAL PROPERTY AREA1,142,156 SF (26.22 AC)LOT #1 21.94 ACLOT #2 3.87 ACR.O.W. DEDICATION 0.41 ACPROPOSED IMPERVIOUS AREA 11.66 ACPROPOSED PERVIOUS AREA 14.56 ACTOTAL DISTURBED AREA 17.60 ACZONING SUMMARYEXISTING ZONINGGATEWAY BUSINESSDISTRICTPROPOSED ZONINGGATEWAY BUSINESSDISTRICTPARKING SETBACKSSIDE/REAR = 20'ROAD = 50'BUILDING SETBACKSFRONT = 50'SIDE = 20'REAR = 20'PROPOSED CURB AND GUTTERPROPERTY LINEPROPOSED FENCESETBACK LINERETAINING WALLPROPOSED STANDARD DUTY ASPHALTPROPOSED CONCRETE PAVEMENTPROPOSED STORMWATER MANAGEMENT AREAPROPOSED CONCRETE SIDEWALKLEGENDPROPOSED HEAVY DUTY ASPHALTK:\TWC_LDEV\Scannell\Arden Hills, MN\3 Design\CAD\PlanSheets\C4-SITE PLAN.dwg August 21, 2020 - 1:30pmSHEETNOT FOR CONSTRUCTIONBRJBRJ/LEC71155-200422020 KIMLEY-HORN AND ASSOCIATES, INC.767 EUSTIS STREET, SUITE 100, ST. PAUL, MN 551141 CITY SUBMITTAL 5/1/20202 CITY SUBMITTAL 7/20/20203 WATERSHED UPDATE 7/24/20204 WATERSHED UPDATE 8/21/2020SITE PLAN NOTES1. ALL WORK AND MATERIALS SHALL COMPLY WITH ALL CITY/COUNTY REGULATIONSAND CODES AND O.S.H.A. STANDARDS.2. CONTRACTOR SHALL REFER TO THE ARCHITECTURAL PLANS FOR EXACTLOCATIONS AND DIMENSIONS OF VESTIBULES, SLOPE PAVING, SIDEWALKS, EXITPORCHES, TRUCK DOCKS, PRECISE BUILDING DIMENSIONS AND EXACT BUILDINGUTILITY ENTRANCE LOCATIONS.3. ALL INNER CURBED RADII ARE TO BE 3' AND OUTER CURBED RADII ARE TO BE 10'UNLESS OTHERWISE NOTED. STRIPED RADII ARE TO BE 5'.4. ALL DIMENSIONS AND RADII ARE TO THE FACE OF CURB UNLESS OTHERWISENOTED.5. EXISTING STRUCTURES WITHIN CONSTRUCTION LIMITS ARE TO BE ABANDONED,REMOVED OR RELOCATED AS NECESSARY. ALL COST SHALL BE INCLUDED IN BASEBID.6. CONTRACTOR SHALL BE RESPONSIBLE FOR ALL RELOCATIONS, (UNLESSOTHERWISE NOTED ON PLANS) INCLUDING BUT NOT LIMITED TO, ALL UTILITIES,STORM DRAINAGE, SIGNS, TRAFFIC SIGNALS & POLES, ETC. AS REQUIRED. ALLWORK SHALL BE IN ACCORDANCE WITH GOVERNING AUTHORITIES REQUIREMENTSAND PROJECT SITE WORK SPECIFICATIONS AND SHALL BE APPROVED BY SUCH. ALLCOST SHALL BE INCLUDED IN BASE BID.7. SITE BOUNDARY, TOPOGRAPHY, UTILITY AND ROAD INFORMATION TAKEN FROM ASURVEY BY SUNDE LAND SURVEYING, DATED 03/18/2020.KIMLEY-HORN ASSUMES NO LIABILITY FOR ANY ERRORS, INACCURACIES, OROMISSIONS CONTAINED THEREIN.8. TOTAL LAND AREA IS 26.220 ACRES.9. PYLON / MONUMENT SIGNS SHALL BE CONSTRUCTED BY OTHERS. SIGNS ARESHOWN FOR GRAPHICAL & INFORMATIONAL PURPOSES ONLY. CONTRACTOR TOVERIFY SIZE, LOCATION AND ANY REQUIRED PERMITS NECESSARY FOR THECONSTRUCTION OF THE PYLON / MONUMENT SIGN.10. CONTRACTOR SHALL REFERENCE ARCH / MEP PLANS FOR SITE LIGHTING ANDELECTRICAL PLAN.11. NO PROPOSED LANDSCAPING SUCH AS TREES OR SHRUBS, ABOVE ANDUNDERGROUND STRUCTURES, OR OTHER OBSTRUCTIONS SHALL BE LOCATEDWITHIN EXISTING OR PROPOSED UTILITY EASEMENTS AND RIGHTS OF WAY UNLESSSPECIFICALLY NOTED ON PLANS OTHERWISE.12. REFER TO FINAL PLAT OR ALTA SURVEY FOR EXACT LOT AND PROPERTYBOUNDARY DIMENSIONS.13. ALL AREAS ARE ROUNDED TO THE NEAREST SQUARE FOOT.14. ALL DIMENSIONS ARE ROUNDED TO THE NEAREST TENTH FOOT.15. ALL PARKING STALLS TO BE 9' IN WIDTH AND 18' IN LENGTH UNLESS OTHERWISEINDICATED.16. THERE ARE 1.485 ACRES OF WETLAND IMPACTS.NORTHKEYNOTE LEGENDCONCRETE SIDEWALKB612 CURB & GUTTER (TYP.)MATCH EXISTING EDGE OF PAVEMENT/ CURB & GUTTERACCESSIBLE CURB RAMPACCESSIBLE PARKING SIGNACCESSIBLE PARKINGAREA STRIPED WITH 4" SYSL @ 45° 2' O.C.STANDARD DUTY ASPHALT PAVEMENTLANDSCAPE AREA - SEE LANDSCAPE PLANSHEAVY DUTY ASPHALT PAVEMENTHEAVY DUTY CONCRETE PAVEMENTTIP-OUT GUTTERTRANSITION CURBFLAT CURBCOMMERCIAL DRIVEWAY APRONTRANSFORMER PADEXISTING STREET LIGHT POLE; LOCATION APPROXIMATE -CONTRACTOR TO VERIFY LOCATION IN FIELDREINSTALLED STREET LIGHT POLE ; COORD. W/ CITY OF ARDEN HILLSEXISTING SIGN; LOCATION APPROXIMATE - CONTRACTOR TOVERIFY LOCATION IN FIELDREINSTALLED EXISTING SIGNABCDEFGHIJKLMNOPQRST K:\TWC_LDEV\Scannell\arden hills, mn\3 Design\CAD\plansheets\C5-GRADING PLAN.dwg August 21, 2020 - 1:03pmSHEETNOT FOR CONSTRUCTIONBRJBRJ/LEC71155-200422020 KIMLEY-HORN AND ASSOCIATES, INC.767 EUSTIS STREET, SUITE 100, ST. PAUL, MN 551141 CITY SUBMITTAL 5/1/20202 CITY SUBMITTAL 7/20/20203 WATERSHED UPDATE 7/24/20204 WATERSHED UPDATE 8/21/2020GRADING PLAN NOTES1. ALL WORK SHALL BE PERFORMED IN ACCORDANCE WITH THE CITY OF ARDEN HILLS,SPECIFICATIONS AND BUILDING PERMIT REQUIREMENTS.2. CONTRACTOR TO CALL GOPHER STATE CALL ONE @ <1-800-252-1166> AT LEAST TWOWORKING DAYS PRIOR TO EXCAVATION/CONSTRUCTION FOR UTILITY LOCATIONS.3. CONTRACTOR TO FIELD VERIFY THE LOCATIONS AND ELEVATIONS OR EXISTINGUTILITIES AND TOPOGRAPHIC FEATURES PRIOR TO THE START OF SITE GRADING. THECONTRACTOR SHALL IMMEDIATELY NOTIFY THE PROJECT ENGINEER OF ANYDISCREPANCIES OR VARIATIONS.4. SUBGRADE EXCAVATION SHALL BE BACKFILLED IMMEDIATELY AFTER EXCAVATION TOHELP OFFSET ANY STABILITY PROBLEMS DUE TO WATER SEEPAGE OR STEEP SLOPES.WHEN PLACING NEW SURFACE MATERIAL ADJACENT TO EXISTING PAVEMENT, THEEXCAVATION SHALL BE BACKFILLED PROMPTLY TO AVOID UNDERMINING OF EXISTINGPAVEMENT.5. CONTRACTOR SHALL EXCAVATE DRAINAGE TRENCHES TO FOLLOW PROPOSED STORMSEWER ALIGNMENTS.6. GRADES SHOWN ARE FINISHED GRADES. CONTRACTOR SHALL ROUGH GRADE TOSUBGRADE ELEVATION AND LEAVE STREET READY FOR SUBBASE.7. ALL EXCESS MATERIAL, BITUMINOUS SURFACING, CONCRETE ITEMS, ANY ABANDONEDUTILITY ITEMS, AND OTHER UNSTABLE MATERIALS SHALL BECOME THE PROPERTY OFTHE CONTRACTOR AND SHALL BE DISPOSED OF OFF THE CONSTRUCTION SITE.8. REFER TO THE UTILITY PLAN FOR SANITARY SEWER MAIN, WATER MAIN SERVICELAYOUT AND ELEVATIONS AND CASTING / STRUCTURE NOTATION.9. CONTRACTOR IS RESPONSIBLE FOR CONSTRUCTION OF PAVEMENTS AND CURB ANDGUTTER WITH SMOOTH UNIFORM SLOPES TO PROVIDE POSITIVE DRAINAGE.10. INSTALL A MINIMUM OF 4" CLASS 5 AGGREGATE BASE UNDER CURB AND GUTTER ANDCONCRETE SIDEWALKS.11. UPON COMPLETION OF EXCAVATION AND FILLING, CONTRACTOR SHALL RESTORE ALLSTREETS AND DISTURBED AREAS ON SITE. ALL DISTURBED AREAS SHALL BERE-VEGETATED WITH A MINIMUM OF 4" OF TOPSOIL.12. ALL SPOT ELEVATIONS/CONTOURS ARE TO GUTTER / FLOW LINE UNLESS OTHERWISENOTED.13. GRADING FOR ALL SIDEWALKS AND ACCESSIBLE ROUTES INCLUDING CROSSINGDRIVEWAYS SHALL CONFORM TO CURRENT ADA STATE/NATIONAL STANDARDS. IN NOCASE SHALL ACCESSIBLE RAMP SLOPES EXCEED 1 VERTICAL TO 12 HORIZONTAL. IN NOCASE SHALL SIDEWALK CROSS SLOPES EXCEED 2% . IN NO CASE SHALL LONGITUDINALSIDEWALK SLOPES EXCEED 5%. IN NO CASE SHALL ACCESSIBLE PARKING STALLS ORAISLES EXCEED 2% (1.5% TARGET) IN ALL DIRECTIONS. SIDEWALK ACCESS TO EXTERNALBUILDING DOORS AND GATES SHALL BE ADA COMPLIANT. CONTRACTOR SHALL NOTIFYENGINEER IMMEDIATELY IF ADA CRITERIA CANNOT BE MET IN ANY LOCATION PRIOR TOPAVING. NO CONTRACTOR CHANGE ORDERS WILL BE ACCEPTED FOR A.D.A COMPLIANCEISSUES.14. MAINTAIN A MINIMUM OF 0.5% GUTTER SLOPE TOWARDS LOW POINTS.15. MAINTAIN A MINIMUM OF 1.25% SLOPE IN BITUMINOUS PAVEMENT AREAS, 0.5% SLOPE INCONCRETE PAVEMENT AREAS.16. CONTRACTOR SHALL REVIEW PAVEMENT GRADIENT AND CONSTRUCT "INFALL CURB"WHERE PAVEMENT DRAINS TOWARD GUTTER, AND "OUTFALL" CURB WHERE PAVEMENTDRAINS AWAY FROM GUTTER.PROPOSED STORM SEWERPROPOSED STORM SEWERPROPERTY LINEEXISTING CONTOURPROPOSED CONTOUR925PROPOSED SPOT ELEVATION100.00LEGENDPROPOSED FLUSH PAVEMENT ELEVATION PROPOSED EMERGENCY OVERFLOW T/G:0.0EOF:0.00.0%PROPOSED DRAINAGE DIRECTION ME:0.0MATCH EXISTING ELEVATION PROPOSED STORM MANHOLE (SOLID CASTING)PROPOSED STORM MANHOLE (ROUND INLET CASTING)PROPOSED STORM MANHOLE/ CATCH BASIN (CURB INLET CASTING)PROPOSED STORM SEWER CLENOUTPROPOSED RIPRAPPROPOSED FLARED END SECTIONCODNORTHRETAINING WALL COORDINATION PLAN NOTES1. RETAINING WALL SHOWN IS ONLY SCHEMATIC. ACTUAL DETAILS SHALL BE DESIGNED BYTHE CONTRACTOR AND SUBMITTED FOR APPROVAL BY ENGINEER.2. THE CONTRACTOR SHALL DETERMINE ALL DIMENSIONS AND DETAILS NECESSARY FORINSTALLATION.3. RETAINING WALL SHALL BE RECON BLOCK WALL OR APPROVED EQUAL.4. CONTRACTOR SHALL COORDINATE TIMING OF THE INSTALLATION OF THE RETAININGWALL WITH ALL UTILITIES, SPECIFICALLY THE STORM SEWER AND WATERMAINADJACENT TO THE PROPOSED WALL.5. GEOTECHNICAL BORING INFORMATION BASEDON THE REPORT LISTED ON SHEET C100.6. FINISHED ELEVATIONS ON THE GRADING PLAN ARE AS STATED ON THE PLAN WITH THETOP OF WALL SPOTS AND BOTTOM OF WALL SPOTS DENOTING THE FINISHED GRADEELEVATIONS. ACTUAL BOTTOM AND TOP OF RETAINING WALL ELEVATIONS MAY VARYDUE TO MANUFACTURER REQUIREMENTS AND RECOMMENDATIONS.7. THE CONTRACTOR SHALL COORDINATE ALL ACTIVITIES WITH THE WALL REINFORCINGAND ROADWAY CONSTRUCTION AND WETLAND LIMITS. CONTRACTOR SHALL PERFORMALL NECESSARY COORDINATION, STAGING, TEMPORARY SHORING, AND SEQUENCINGAT NO EXTRA COST.Emb. Varies (6" Min.)APPROXIMATE LIMITS OF EXCAVATION(VARIES)Geogrid Depth ("L")TYPICAL REINFORCED WALL SECTIONPERFORATEDDRAINTILE (4" MIN)4" DRAIN TODAYLIGHT(or inlet whereapplicable)8" LOW PERMEABLE SOILUNIT DRAINAGE FILLRECON UNITCRUSHED STONE ORUNREINFORCED CONCRETE(6" MINIMUM THICKNESS) K:\TWC_LDEV\Scannell\arden hills, mn\3 Design\CAD\plansheets\C5-STORM SEWER PLAN.dwg August 21, 2020 - 1:04pmSHEETNOT FOR CONSTRUCTIONBRJBRJ/LEC71155-200422020 KIMLEY-HORN AND ASSOCIATES, INC.767 EUSTIS STREET, SUITE 100, ST. PAUL, MN 551141 CITY SUBMITTAL 5/1/20202 CITY SUBMITTAL 7/20/20203 WATERSHED UPDATE 7/24/20204 WATERSHED UPDATE 8/21/2020STORMWATER MANAGEMENT PLAN NOTES1. ALL WORK SHALL BE PERFORMED IN ACCORDANCE WITH THE CITY OF ARDEN HILLS,SPECIFICATIONS AND BUILDING PERMIT REQUIREMENTS.2. CONTRACTOR TO CALL GOPHER STATE CALL ONE @ <1-800-252-1166> AT LEAST TWOWORKING DAYS PRIOR TO EXCAVATION/CONSTRUCTION FOR UTILITY LOCATIONS.3. STORM SEWER PIPE SHALL BE AS FOLLOWS:RCP PER ASTM C-76HDPE: 0" - 10" PER AASHTO M-252HDPE: 12" OR GREATER PER ASTM F-2306PVC SCH. 40 PER ASTM D-3034WHEN STORM SEWER CROSSES ABOVE WATERMAIN: STORM SEWER (18" ANDSMALLER) SHALL BE PVC SHC 40 PER ASTM D-1785; PROVIDE 18" MINIMUMVERTICAL CLEARANCE OUTER EDGE TO OUTER EDGESTORM SEWER FITTINGS SHALL BE AS FOLLOWS:RCP PER ASTM C-76, JOINTS PER ASTM C-361, C-990, AND C-443HDPE PER ASTM 3212PVC PER ASTM D-3034, JOINTS PER ASTM D-3212WHEN STORM SEWER CROSSES ABOVE WATERMAIN: STORM SEWER (18" AND SMALLER) FITTINGS SHALL BE PVC SHC 40 PER ASTM D-2665; PROVIDE 18" MINIMUMVERTICAL CLEARANCE OUTER EDGE TO OUTER EDGE4. CONTRACTOR TO FIELD VERIFY THE LOCATIONS AND ELEVATIONS OR EXISTINGUTILITIES AND TOPOGRAPHIC FEATURES PRIOR TO THE START OF SITE GRADING. THECONTRACTOR SHALL IMMEDIATELY NOTIFY THE PROJECT ENGINEER OF ANYDISCREPANCIES OR VARIATIONS.5. SUBGRADE EXCAVATION SHALL BE BACKFILLED IMMEDIATELY AFTER EXCAVATION TOHELP OFFSET ANY STABILITY PROBLEMS DUE TO WATER SEEPAGE OR STEEP SLOPES.WHEN PLACING NEW SURFACE MATERIAL ADJACENT TO EXISTING PAVEMENT, THEEXCAVATION SHALL BE BACKFILLED PROMPTLY TO AVOID UNDERMINING OF EXISTINGPAVEMENT.6. CONTRACTOR SHALL BE RESPONSIBLE FOR ALL HORIZONTAL AND VERTICAL CONTROL.7. CONTRACTOR SHALL EXCAVATE DRAINAGE TRENCHES TO FOLLOW PROPOSED STORMSEWER ALIGNMENTS.8. ALL EXCESS MATERIAL, BITUMINOUS SURFACING, CONCRETE ITEMS, ANY ABANDONEDUTILITY ITEMS, AND OTHER UNSTABLE MATERIALS SHALL BECOME THE PROPERTY OFTHE CONTRACTOR AND SHALL BE DISPOSED OF OFF THE CONSTRUCTION SITE.9. REFER TO THE UTILITY PLAN FOR SANITARY SEWER MAIN, WATER MAIN SERVICELAYOUT AND ELEVATIONS AND CASTING / STRUCTURE NOTATION.10. CONTRACTOR IS RESPONSIBLE FOR CONSTRUCTION OF PAVEMENTS AND CURB ANDGUTTER WITH SMOOTH UNIFORM SLOPES TO PROVIDE POSITIVE DRAINAGE.11. CONTRACTOR TO PROVIDE 3" INSULATION BY 5' WIDE CENTERED ON STORM PIPE IFLESS THAN 4' OF COVER IN PAVEMENT AREAS AND LESS THAN 3' OF COVER INLANDSCAPE AREAS.12. ALL STORM SEWER CONNECTIONS SHALL BE GASKETED AND WATER TIGHT INCLUDINGMANHOLE CONNECTIONS.13. ALL STORM SEWER PIPE SHALL BE AIR TESTED IN ACCORDANCE WITH THE CURRENTPLUMBING CODE.14. ALL PORTIONS OF THE STORM SEWER SYSTEM LOCATED WITHIN 10 FEET OF THEBUILDING OR WATER SERVICE LINE MUST BE TESTED IN ACCORDANCE WITH MINNESOTARULES, CHAPTER 474, SECTION 1109.15. ALL STORM PIPE ENTERING STRUCTURES SHALL BE WATERTIGHT OR BE OF FLEXIBLECOMPRESSION JOINTS. JOINT CONNECTIONS SHALL BE FLEXIBLE WATER STOPS,RESILIENT CONNECTORS, OR OTHER FLEXIBLE SYSTEMS APPROVED BY THE ENGINEERTO MAKE WATERTIGHT CONNECTION TO MANHOLES AND OTHER STRUCTURES UNLESSOTHERWISE STATED BY CITY AND STATE DESIGN STANDARDS AND SPECIFICATIONS.CEMENT MORTAR JOINTS ARE NOT APPROVED.PROPOSED STORM MANHOLE (SOLID CASTING)PROPOSED STORM SEWERPROPOSED STORM MANHOLE (ROUND INLET CASTING)PROPOSED STORM SEWERPROPERTY LINELEGENDPROPOSED SANITARY SEWERPROPOSED WATERMAINCOPROPOSED STORM MANHOLE/ CATCH BASIN (CURB INLET CASTING)PROPOSED STORM SEWER CLENOUTPROPOSED RIPRAPPROPOSED FLARED END SECTIONDNORTHSTORMWATER POND NOTES1. BASIN EXCAVATION SHALL BE HELD 1' ABOVE THE BOTTOM OF THE BASIN UNTIL THECONTRIBUTING DRAINAGE AREAS WITH EXPOSED SOILS HAVE BEEN FULLY STABILIZEDAND BITUMINOUS BASE COURSE INSTALLED ON THE CONTRIBUTING AREAS.2. DIVERT UPLAND DRAINAGE AREAS TO PREVENT RUNOFF FROM ENTERING THEEXCAVATED CELL OR INTO THE WORK AREA.3. CARE MUST BE TAKEN TO AVOID CONTAMINATION OF ENGINEERED SOILS WITHSEDIMENT, IN-SITU, OR TOPSOIL DURING AND AFTER INSTALLATION. MATERIALS MUSTBE SEGREGATED.4. INSTALLATION WITH DRY SOIL CONDITIONS IS CRITICAL TO PREVENT SMEARING.SCHEDULE WORK FOR PERIODS OF DRY WEATHER.5. IN THE EVENT THAT THE SEDIMENT IS INTRODUCED INTO THE BMP DURING ORIMMEDIATELY FOLLOWING EXCAVATION, REMOVE SEDIMENT PRIOR TO INITIATING THENEXT STEP IN THE BASIN CONSTRUCTION PROCESS.6. EXCAVATE SEDIMENT BUILT UP DURING CONSTRUCTION AFTER STABILIZATION OFUPSTREAM AREAS AND BEFORE PLACEMENT OF HYDRAULIC SOIL STABILIZER TYPESPECIAL.7. STOCKPILING OF MATERIAL SHALL NOT BE ALLOWED IN PROPOSED BASIN.8. ALL BASINS CONSTRUCTION ACTIVITIES SHALL BE COMPLETED DURING DRY SOILCONDITIONS.9. ALL WET PONDS SHALL BE PROTECTED DURING CONSTRUCTION OPERATIONS. K:\TWC_LDEV\Scannell\arden hills, mn\3 Design\CAD\plansheets\C6-UTILITY PLAN.dwg August 21, 2020 - 1:04pmSHEETNOT FOR CONSTRUCTIONBRJBRJ/LEC71155-200422020 KIMLEY-HORN AND ASSOCIATES, INC.767 EUSTIS STREET, SUITE 100, ST. PAUL, MN 551141 CITY SUBMITTAL 5/1/20202 CITY SUBMITTAL 7/20/20203 WATERSHED UPDATE 7/24/20204 WATERSHED UPDATE 8/21/2020UTILITY PLAN NOTES1. ALL FILL MATERIAL IS TO BE IN PLACE, AND COMPACTED BEFORE INSTALLATION OFPROPOSED UTILITIES.2. SANITARY SEWER PIPE SHALL BE AS FOLLOWS:8" PVC SDR35 PER ASTM D-3034, FOR PIPES LESS THAN 12' DEEP 8" PVC SDR26 PER ASTM D-3034, FOR PIPES MORE THAN 12' DEEP6" PVC SCHEDULE 40 PER ASTM D-3034DUCTILE IRON PIPE PER AWWA C1503. WATER LINES SHALL BE AS FOLLOWS:6" AND LARGER, PVC C-900 PER ASTM D 2241CLASS 200 UNDER COUNTY ROADS, OTHERWISE CLASS 1504" AND LARGER DUCTILE IRON PIPE PER AWWA C150SMALLER THAN 3" PIPING SHALL BE COPPER TUBE TYPE "K" PERANSI 816.22 OR PVC, 200 P.S.I., PER ASTM D1784 AND D2241.4. MINIMUM TRENCH WIDTH SHALL BE 2 FEET.5. ALL WATER JOINTS ARE TO BE MECHANICAL JOINTS WITH RESTRAINTS SUCH AS THRUSTBLOCKING, WITH STAINLESS STEEL OR COBALT BLUE BOLTS, OR AS INDICATED IN THECITY SPECIFICATIONS AND PROJECT DOCUMENTS.6. ALL UTILITIES SHOULD BE KEPT TEN (10') APART (PARALLEL) OR WHEN CROSSING 18"VERTICAL CLEARANCE (OUTSIDE EDGE OF PIPE TO OUTSIDE EDGE OF PIPE ORSTRUCTURE).7. CONTRACTOR SHALL MAINTAIN A MINIMUM OF 7'-5" COVER ON ALL WATERLINES.N THE EVENT OF A VERTICAL CONFLICT BETWEEN WATER LINES, SANITARY LINES,STORM LINES AND GAS LINES, OR ANY OBSTRUCTION (EXISTING AND PROPOSED), THESANITARY LINE SHALL BE SCH. 40 OR C900 WITH MECHANICAL JOINTS AT LEAST 10 FEETON EITHER SIDE OF THE CENTER LINE OF THE CROSSING. THE WATER LINE SHALL HAVEMECHANICAL JOINTS WITH APPROPRIATE FASTENERS AS REQUIRED TO PROVIDE AMINIMUM OF 18" VERTICAL SEPARATION. MEETING REQUIREMENTS OF ANSI A21.10 ORANSI 21.11 (AWWA C-151) (CLASS 50).9. LINES UNDERGROUND SHALL BE INSTALLED, INSPECTED AND APPROVED BEFOREBACKFILLING.10. TOPS OF MANHOLES SHALL BE RAISED AS NECESSARY TO BE FLUSH WITH PROPOSEDPAVEMENT ELEVATIONS, AND TO BE ONE FOOT ABOVE FINISHED GROUND ELEVATIONS, INGREEN AREAS, WITH WATERTIGHT LIDS.11. ALL CONCRETE FOR ENCASEMENTS SHALL HAVE A MINIMUM 28 DAY COMPRESSIONSTRENGTH AT 3000 P.S.I.12. EXISTING UTILITIES SHALL BE VERIFIED IN FIELD PRIOR TO INSTALLATION OF ANY NEWLINES.13. REFER TO INTERIOR PLUMBING DRAWINGS FOR TIE-IN OF ALL UTILITIES.14. CONTRACTOR IS RESPONSIBLE FOR COMPLYING TO THE SPECIFICATIONS OF THE CITYOF ARDEN HILLS AND/OR STATE OF MN WITH REGARDS TO MATERIALS AND INSTALLATIONOF THE WATER AND SEWER LINES.15. THE CONTRACTOR IS SPECIFICALLY CAUTIONED THAT THE LOCATION AND/OR ELEVATIONOF EXISTING UTILITIES AS SHOWN ON THESE PLANS IS BASED ON RECORDS OF THEVARIOUS UTILITY COMPANIES, AND WHERE POSSIBLE, MEASUREMENTS TAKEN IN THEFIELD. THE INFORMATION IS NOT TO BE RELIED ON AS BEING EXACT OR COMPLETE. THECONTRACTOR MUST CALL THE APPROPRIATE UTILITY COMPANIES AT LEAST 72 HOURSBEFORE ANY EXCAVATION TO REQUEST EXACT FIELD LOCATION OF UTILITIES. IT SHALLBE THE RESPONSIBILITY OF THE CONTRACTOR TO RELOCATE ALL EXISTING UTILITIESWHICH CONFLICT WITH THE PROPOSED IMPROVEMENTS SHOWN ON THE PLANS.16. CONTRACTOR IS RESPONSIBLE FOR ALL NECESSARY INSPECTIONS AND/ORCERTIFICATIONS REQUIRED BY CODES AND/OR UTILITY SERVICE COMPANIES.17. CONTRACTOR SHALL COORDINATE WITH ALL UTILITY COMPANIES FOR INSTALLATIONREQUIREMENTS AND SPECIFICATIONS.18. CONTRACTOR SHALL REFERENCE ARCH / MEP PLANS FOR SITE LIGHTING ANDELECTRICAL PLAN.19. BACKFLOW DEVICES (DDCV AND PRZ ASSEMBLIES) AND METERS ARE LOCATED IN THEINTERIOR OF THE BUILDING. REF. ARCH / MEP PLANS.20. ALL ONSITE WATERMAINS AND SANITARY SEWERS SHALL BE PRIVATELY OWNED ANDMAINTAINED.21. ALL WATERMAIN STUBOUTS SHALL BE MECHANICALLY RESTRAINED WITH REACTIONBLOCKING.SANITARY SEWER MANHOLESTORM SEWERSANITARY SEWERWATERMAINGATE VALVEHYDRANTTEEREDUCERUNDERGROUND ELECTRICTELEPHONEGAS MAINSTORM SEWERLEGENDCOSANITARY CLEANOUTCOEXISTING PROPOSEDNORTHKEYNOTE LEGENDWET TAP CONNECTION, PROVIDE 12"X12" TAPPING SLEEVE8" GATE VALVEFIRE HYDRANT ASSEMBLY, PROVIDE 8"X6" TEE, 6" WATERMAIN AND 6"GATE VALVE8" FIRE SERVICE TO BUILDING, COORD W/MEP6" DOMESTIC SERVICE TO BUILDING, COORD W/MEP8" WATERMAIN BEND6" WATERMAIN BEND12" x 8" TEE AND 8" GATE VALVE12" X 6" TEE AND 6" GATE VALVEPROPOSED FIRE HYDRANT COVER - 200' RADIUS6" SANITARY SERVICE TO BUILDING, COORD W/MEPSEWER/WATERMAIN CROSSING, PROVIDE MINIMUM 18" VERTICALSEPARATION, WHERE STORM SEWER CROSSES ABOVE WATER THEPIPE SHALL PVC SCHEDULE 40 PER ASTM D-1785. ONE FULL LENGTH OFWATER PIPE SHALL BE CENTERED AT THE CROSSING SUCH THATJOINTS ARE AS FAR FROM SEWER CROSSING AS POSSIBLEFIRE HYDRANT ASSEMBLY, PROVIDE 12"X6" TEE, 6" WATERMAIN AND 6"GATE VALVE12" BEND12" GATE VALVEEXISTING FIRE HYDRANTEXISTING FIRE HYDRANT COVER - 200' RADIUSEXISTING POWER POLEEXISTING OVERHEAD POWEREXISTING TRANSMISSION TOWERPROPOSED TRANSFORMERABCDEFGHIJKLMNOPQRSTU K:\TWC_LDEV\Scannell\arden hills, mn\3 Design\CAD\plansheets\WATERMAIN PROFILE.dwg August 21, 2020 - 1:43pmSHEETNOT FOR CONSTRUCTIONBRJBRJ/LEC71155-200422020 KIMLEY-HORN AND ASSOCIATES, INC.767 EUSTIS STREET, SUITE 100, ST. PAUL, MN 551141 CITY SUBMITTAL 5/1/20202 CITY SUBMITTAL 7/20/20203 WATERSHED UPDATE 7/24/20204 WATERSHED UPDATE 8/21/2020NORTH NORTHK:\TWC_LDEV\Scannell\arden hills, mn\3 Design\CAD\plansheets\WATERMAIN PROFILE.dwg August 21, 2020 - 1:43pmSHEETNOT FOR CONSTRUCTIONBRJBRJ/LEC71155-200422020 KIMLEY-HORN AND ASSOCIATES, INC.767 EUSTIS STREET, SUITE 100, ST. PAUL, MN 551141 CITY SUBMITTAL 5/1/20202 CITY SUBMITTAL 7/20/20203 WATERSHED UPDATE 7/24/20204 WATERSHED UPDATE 8/21/2020 K:\TWC_LDEV\Scannell\arden hills, mn\3 Design\CAD\plansheets\WATERMAIN PROFILE.dwg August 21, 2020 - 1:05pmSHEETNOT FOR CONSTRUCTIONBRJBRJ/LEC71155-200422020 KIMLEY-HORN AND ASSOCIATES, INC.767 EUSTIS STREET, SUITE 100, ST. PAUL, MN 551141 CITY SUBMITTAL 5/1/20202 CITY SUBMITTAL 7/20/20203 WATERSHED UPDATE 7/24/20204 WATERSHED UPDATE 8/21/2020NORTH K:\TWC_LDEV\Scannell\arden hills, mn\3 Design\CAD\plansheets\WATERMAIN PROFILE.dwg August 21, 2020 - 1:05pmSHEETNOT FOR CONSTRUCTIONBRJBRJ/LEC71155-200422020 KIMLEY-HORN AND ASSOCIATES, INC.767 EUSTIS STREET, SUITE 100, ST. PAUL, MN 551141 CITY SUBMITTAL 5/1/20202 CITY SUBMITTAL 7/20/20203 WATERSHED UPDATE 7/24/20204 WATERSHED UPDATE 8/21/2020NORTH K:\TWC_LDEV\Scannell\arden hills, mn\3 Design\CAD\plansheets\WATERMAIN PROFILE.dwg August 21, 2020 - 1:05pmSHEETNOT FOR CONSTRUCTIONBRJBRJ/LEC71155-200422020 KIMLEY-HORN AND ASSOCIATES, INC.767 EUSTIS STREET, SUITE 100, ST. PAUL, MN 551141 CITY SUBMITTAL 5/1/20202 CITY SUBMITTAL 7/20/20203 WATERSHED UPDATE 7/24/20204 WATERSHED UPDATE 8/21/2020NORTH K:\TWC_LDEV\Scannell\arden hills, mn\3 Design\CAD\plansheets\C7-CIVIL DETAILS.dwg August 21, 2020 - 1:06pmSHEETNOT FOR CONSTRUCTIONBRJBRJ/LEC71155-200422020 KIMLEY-HORN AND ASSOCIATES, INC.767 EUSTIS STREET, SUITE 100, ST. PAUL, MN 551141 CITY SUBMITTAL 5/1/20202 CITY SUBMITTAL 7/20/20203 WATERSHED UPDATE 7/24/20204 WATERSHED UPDATE 8/21/2020SCALE: NTSEMERGENCY SPILLWAY - BMP 26DEAD STORAGE10'TOP BERM: 890.50NWL: 882.75BOTTOM OFPOND: 872.753:1 MAX SIDE SLOPE3:1 MAX SIDE SLOPE10' WIDE SAFETEY BENCH, 10:1 SLOPETOP BENCH: 882.75BOTTOM BENCH: 881.75HOLEHOLESECTIONPRECAST 48"DIAM. MANHOLESTEPS AS PER 16"O.C.CONSTRUCT 1.5" KEYWAY OR SUPPLYCERTIFIED SHOP DRAWING DETAILINGCONCRETE WALL CONNECTOR TOMANHOLE SIDE WALL.6" THICK WEIR WALL WITH ORIFICE,SEE SECTION VIEW FOR ORIFICESIZE AND ELEVATIONTOP OFWEIR WALLEL:887.0048"5"15" STROMINLET IE=879.006" PRE-CASTBASE48"5"24" STORMOUTLETIE=881.40PLAN1/2" SS ANCHOR BOLTSWITH CLIPS (4 THUS)1/4"x1" FLAT BAR 1" TOOUTSIDE MH WALLHOT-DIPPEDGALVANIZED GRATE#5 SMOOTH BARS @4" O.C. EACH WAYSKIMMERCOVER, SEEPLAN9"RIM EL: 890.50NWL=882.75ORIFICE IN WEIRWALL, SEE SECTION6" WEIRWALLTOP OFWEIR WALLEL: 887.00FINISHEDGRADE(2) 8" ORIFICE:EL: 882.75IE: 879.006"SCALE: NTSOCS 11SCALE: NTSBMP 1 - TYPICAL SECTION2SCALE: NTSOCS 23SCALE: NTSBMP 2 - TYPICAL SECTION4SCALE: NTSEMERGENCY SPILLWAY - BMP 15#4 REBAR 12" O.C. EWCENTERED ON WEIRWITH 2" MINIMUMCLEARANCE TO FACEOF CONCRETESECTION B-BSECTION A-ADEAD STORAGE7'NWL: 887.00BOTTOM OFPOND: 881.003:1 MAX SIDE SLOPE3:1 MAX SIDE SLOPE10' WIDE SAFETEY BENCH, 10:1 SLOPETOP BENCH: 887.00BOTTOM BENCH: 886.00HOLEHOLEPRECAST 48"DIAM. MANHOLESTEPS AS PER 16"O.C.CONSTRUCT 1.5" KEYWAY OR SUPPLYCERTIFIED SHOP DRAWING DETAILINGCONCRETE WALL CONNECTOR TOMANHOLE SIDE WALL.6" THICK WEIR WALL WITH ORIFICE,SEE SECTION VIEW FOR ORIFICESIZE AND ELEVATIONTOP OFWEIR WALLEL:889.5048"5"(1) 6" ORIFICE:EL: 887.0015" STROMINLET IE: 884.006" PRE-CASTBASE48"5"24" STORMOUTLETIE=884.29PLAN1/2" SS ANCHOR BOLTSWITH CLIPS (4 THUS)1/4"x1" FLAT BAR 1" TOOUTSIDE MH WALLHOT-DIPPEDGALVANIZED GRATE#5 SMOOTH BARS @4" O.C. EACH WAYSKIMMERCOVER, SEEPLAN9"RIM EL=891.00NWL=887.00ORIFICE IN WEIRWALL, SEE SECTION6" WEIRWALLTOP OFWEIR WALLEL:889.50FINISHEDGRADE(2) 5" ORIFICE:EL: 888.50IE: 884.006"#4 REBAR 12" O.C. EWCENTERED ON WEIRWITH 2" MINIMUMCLEARANCE TO FACEOF CONCRETESECTION B-BSECTION A-A2'3:1 (MAX.)X XXXXXXX6"6'6"CLASS 3 RIPRAPPROFILESECTION A-AEMBANKMENTGEOTEXTILE FILTERFABRICEL. 890.85'EL. 890.35'XXXXXXXXXXXX6"3:1 (MAX.)GEOTEXTILE FILTERFABRIC6"AAEL. 890.85'EL. 890.35'EL. 887.00'12CLASS 3 RIPRAP4'3:1 (MAX.)X XXXXXXX6"6'6"CLASS 3 RIPRAPPROFILESECTION A-AEMBANKMENTGEOTEXTILE FILTERFABRICEL. 891.25'EL. 890.75'XXXXXXXXXXXX6"3:1 (MAX.)GEOTEXTILE FILTERFABRIC6"AAEL. 891.25'EL. 890.75'EL. 887.00'12CLASS 3 RIPRAP(1) 12" ORIFICE:EL: 884.00TOP BERM: 891.00 PARKINGREQUIRED PARKING363 SPACES @ 4/1,000 SFPROPOSED PARKING363 SPACES @ 4/1,000 RATIOADDITIONAL POTENTIAL FUTUREPARKING STALLS±230 SPACESTOTAL POTENTIAL FUTURE PARKINGSTALLS±593 SPACESPROPOSED CURB AND GUTTERPROPERTY LINELEGENDSNOW STORAGE AREAK:\TWC_LDEV\Scannell\arden hills, mn\3 Design\CAD\plansheets\C4-SITE ACCESS SNOW STORAGE PARKING EXHIBIT.dwg August 21, 2020 - 1:46pmSHEETNOT FOR CONSTRUCTIONBRJBRJ/LEC71155-200422020 KIMLEY-HORN AND ASSOCIATES, INC.767 EUSTIS STREET, SUITE 100, ST. PAUL, MN 551141 CITY SUBMITTAL 5/1/20202 CITY SUBMITTAL 7/20/20203 WATERSHED UPDATE 7/24/20204 WATERSHED UPDATE 8/21/2020NORTH K:\TWC_LDEV\Scannell\arden hills, mn\3 Design\CAD\plansheets\L1-LANDSCAPE PLAN.dwg August 21, 2020 - 1:06pmSHEETNOT FOR CONSTRUCTION71155-200422020 KIMLEY-HORN AND ASSOCIATES, INC.767 EUSTIS STREET, SUITE 100, ST. PAUL, MN 55114RAHRAH/ JH1 CITY SUBMITTAL 5/1/20202 CITY SUBMITTAL 7/20/20203 WATERSHED UPDATE 7/24/20204 WATERSHED UPDATE 8/21/2020MINIMUM LANDSCAPE LOT AREA REQUIRED: 339,674 SF970,496 SF LOT AREA *0.35MINIMUM LANDSCAPE LOT AREA PROVIDED: 652,668 SFTREE RATIO (BUILDING STORIES: 2)SIZE: 6-7' HT 8-10' HT 11-14' HT(2.5-3") (3.5-4") (4.5-6")REQUIRED: 50% 30% 20%PROPOSED: 50% 30% 20%LANDSCAPE REQUIREMENTSSTREET TREES REQUIRED - GATEWAY BLVD: 30 TREES1484 LF / 50 =STREET TREES PROVIDED - GATEWAY BLVD: 71 TREESPERENNIALS/SHRUBS REQUIRED: 65,266 SF652,668 SF LANDSCAPE AREA * 0.1 =PERENNIAL/SHRUBS PROVIDED: 2,888 SFREQUIRED PLANTING ISLANDS: 11,177 SF111,769 SF PARKING AREA *0.1PROVIDED PLANTING ISLANDS: 6,178 SF(MINIMUM 150 SF)REQUIRED PLANTING ISLAND TREES: 33 TREES33 PLANTING ISLANDS x 1 TREEPROVIDED PLANTING ISLANDS: 34 TREESDIVERSE SELECTION REQUIRED: FULL COMPLIMENT OF OVERSTORY,ORNAMENTAL, AND EVERGREEN TREES, SHRUBBERY, AND GROUNDCOVERS PROVIDING YEAR-ROUND COLOR AND INTERESTDIVERSE SELECTION PROVIDED: FULL COMPLIMENT OF OVERSTORY,ORNAMENTAL, AND EVERGREEN TREES, SHRUBBERY, AND GROUNDCOVERS PROVIDING YEAR-ROUND COLOR AND INTERESTSCREENING REQUIRED - LOAD SERVICE: MAY INCLUDE A COMBINATIONOF THE FOLLOWING - BERMS, SHRUBS TREES AT A HEIGHT AND DEPTHCONSISTENT WITH THE HEIGHT AND SIZE OF THE AREA TO BE SCREENED.NATURAL MATERIALS TO ACHIEVE 60% OPACITY YEAR ROUND ATMATURITY.SCREENING PROVIDED- LOAD SERVICE: A COMBINATION OF BERMS,SHRUBS TREES AT A HEIGHT AND DEPTH CONSISTENT WITH THE HEIGHTAND SIZE OF THE AREA TO BE SCREENED. PLANT MATERIALS TO ACHIEVE60% OPACITY YEAR ROUND AT MATURITY.MINIMUM CALIPER INCHES REQUIRED: 1,561 IN.499,552 BUILDING GROSS SQUARE FOOTAGE / 320*MINIMUM CALIPER INCHES PROVIDED: 310 IN.*A SINGLE STORY BUILDING IN EXCESS OF THIRTY (30) FEET IN HEIGHTSHALL BE CONSIDERED A TWO-STORY BUILDING FOR THE PURPOSESOF DETERMINING GROSS SQUARE FOOTAGE.NORTH K:\TWC_LDEV\Scannell\arden hills, mn\3 Design\CAD\plansheets\L1-LANDSCAPE PLAN.DWG August 21, 2020 - 1:07pmSHEETNOT FOR CONSTRUCTION71155-200422020 KIMLEY-HORN AND ASSOCIATES, INC.767 EUSTIS STREET, SUITE 100, ST. PAUL, MN 55114RAHRAH/ JH1 CITY SUBMITTAL 5/1/20202 CITY SUBMITTAL 7/20/20203 WATERSHED UPDATE 7/24/20204 WATERSHED UPDATE 8/21/2020LANDSCAPE ENLARGEMENT- NORTHWESTSCALE: 1"=20'L1011NORTH K:\TWC_LDEV\Scannell\arden hills, mn\3 Design\CAD\plansheets\L1-LANDSCAPE PLAN.DWG August 21, 2020 - 1:08pmSHEETNOT FOR CONSTRUCTION71155-200422020 KIMLEY-HORN AND ASSOCIATES, INC.767 EUSTIS STREET, SUITE 100, ST. PAUL, MN 55114RAHRAH/ JH1 CITY SUBMITTAL 5/1/20202 CITY SUBMITTAL 7/20/20203 WATERSHED UPDATE 7/24/20204 WATERSHED UPDATE 8/21/2020LANDSCAPE ENLARGEMENT- SOUTHWESTSCALE: 1"=20'L1021NORTH K:\TWC_LDEV\Scannell\arden hills, mn\3 Design\CAD\plansheets\L1-LANDSCAPE PLAN.DWG August 21, 2020 - 1:08pmSHEETNOT FOR CONSTRUCTION71155-200422020 KIMLEY-HORN AND ASSOCIATES, INC.767 EUSTIS STREET, SUITE 100, ST. PAUL, MN 55114RAHRAH/ JH1 CITY SUBMITTAL 5/1/20202 CITY SUBMITTAL 7/20/20203 WATERSHED UPDATE 7/24/20204 WATERSHED UPDATE 8/21/2020LANDSCAPE ENLARGEMENT- SOUTHEASTSCALE: 1"=20'L1031NORTHMATCHLINE - SEE SHEET L102MATCHLINE - SEE SHEET L101MATCHLINE - SEE SHEET L101 K:\TWC_LDEV\Scannell\arden hills, mn\3 Design\CAD\plansheets\L1-LANDSCAPE PLAN.DWG August 21, 2020 - 1:08pmSHEETNOT FOR CONSTRUCTION71155-200422020 KIMLEY-HORN AND ASSOCIATES, INC.767 EUSTIS STREET, SUITE 100, ST. PAUL, MN 55114RAHRAH/ JH1 CITY SUBMITTAL 5/1/20202 CITY SUBMITTAL 7/20/20203 WATERSHED UPDATE 7/24/20204 WATERSHED UPDATE 8/21/2020DOUBLE SHREDDED HARDWOOD MULCHNOTES:2X ROOT BALL WIDTHSOD4" TOPSOILPREPARED PLANTING BED ANDBACKFILL SOIL(THOROUGHLY LOOSENED)NOTES:1. SCARIFY SIDES AND BOTTOM OF HOLE.2. PROCEED WITH CORRECTIVE PRUNING OF TOP AND ROOT.3. REMOVE CONTAINER AND SCORE OUTSIDE OF SOIL MASS TO REDIRECTAND PREVENT CIRCLING FIBROUS ROOTS. REMOVE OR CORRECT STEMGIRDLING ROOTS.4. PLUMB AND BACKFILL WITH PLANTING SOIL.5. WATER THOROUGHLY WITHIN 2 HOURS TO SETTLE PLANTS AND FILLVOIDS.6. BACK FILL VOIDS AND WATER SECOND TIME.7. PLACE MULCH WITHIN 48 HOURS OF THE SECOND WATERING UNLESSSOIL MOISTURE IS EXCESSIVE.8. MIX IN 3-4" OF ORGANIC COMPOST.1. SCARIFY SIDES AND BOTTOM OF HOLE.2. PROCEED WITH CORRECTIVE PRUNING.3. SET PLANT ON UNDISTURBED NATIVE SOIL ORTHOROUGHLY COMPACTED PLANTING SOIL.INSTALL PLANT SO THE ROOT FLARE IS AT OR UPTO 2" ABOVE THE FINISHED GRADE WITH BURLAPAND WIRE BASKET, (IF USED), INTACT.4. SLIT REMAINING TREATED BURLAP AT 6"INTERVALS.5. BACKFILL TO WITHIN APPROXIMATELY 12" OF THETOP OF THE ROOTBALL, THEN WATER PLANT.REMOVE THE TOP 1/3 OF THE BASKET OR THE TOPTWO HORIZONTAL RINGS WHICHEVER ISGREATER. REMOVE ALL BURLAP AND NAILS FROMTHE TOP 1/3 OF THE BALL. REMOVE ALL TWINE.REMOVE OR CORRECT STEM GIRDLING ROOTS.6. PLUMB AND BACKFILL WITH PLANTING SOIL.7. WATER THOROUGHLY WITHIN 2 HOURS TOSETTLE PLANTS AND FILL VOIDS.8. BACK FILL VOIDS AND WATER SECOND TIME.9. PLACE MULCH WITHIN 48 HOURS OF THE SECONDWATERING UNLESS SOIL MOISTURE IS EXCESSIVE.10. FINAL LOCATION OF TREE TO BE APPROVED BYOWNER.PLANTING SOILTREE PLANTING DETAILSCALE: N.T.S.L1041SHRUB / PERENNIAL PLANTING DETAILSCALE: N.T.S.3FINISHED GRADE AT LAWN, 1/2" BELOW TOP OF DIVIDER.LAWN SIDE"BLACK DIAMOND" EDGING BYVALEEY VIEW SPECIALTIES CO.USE 20 FT. LENGTHS. USEKNURLED CONNECTOR AT SPLICES, USE CORNER, TEE, VEE, OR WIDEANBLE CONNECTORS AT ANGLE10" X 7/8" METAL ANCHORSTAKES AT 48" O.C., AND ATCHANGES.EACH END.PLASTIC DIVIDER:FINISHED GRADE ATSHRUBS/ PERENNIALS, 1" BELOW TOPOF DIVIDER.PLANTING BEDPOLY EDGER DETAILSCALE: N.T.S.L1044SPADED EDGE DETAILSCALE: 1-1/2"=1'L1046MULCH AT PLANTING AREASPADED EDGE "V" SHAPED, 4" WIDTH,4" DEPTH, MORE VERTICAL ON LAWNSIDELAWN GRASSFINISHED GRADEBUILDING, EXTERIOR WALLPROVIDE POSITIVE DRAINAGEAWAY FROM BUILDINGSPECIFIED ROCK MULCH1.5' MAINTENANCE STRIPEDGER, AS SPECIFIEDSOIL MIX TO BE MINIMUMOF 4" BELOW EDGING TOPTO ALLOW FOR ADEQUATELIP FOR MULCH.SPECIFIED SOIL MIXFINISH GRADE FOR LAWNMAINTENANCE STRIP DETAILSCALE: 1-1/2"=1'L10454"1"NOTE:1. EXTENDED EXCAVATION AND BACKFILL SOIL TO A POINT DOWNSLOPEEQUAL TO OR LOWER IN ELEVATION THAN THE BOTTOM OF THE HOLEDIRECTLY BENEATH THE PLANT TO INSURE ADEQUATE DRAINAGE INHEAVY SOILS. GRANULAR SOIL MUST BE ADDED AS BACKFILL IN AREASOF POOR DRAINAGE.STEEP SLOPE PLANTINGSCALE: N.T.S.L1042EXISTING GRADECUT AREAPLANT ACCORDING TOPLANTING DETAILSAPPLICABLE AS SHOWNBACKFILL AREA1. CONTRACTOR SHALL CONTACT COMMON GROUND ALLIANCE AT 811 OR CALL811.COM TOVERIFY LOCATIONS OF ALL UNDERGROUND UTILITIES PRIOR TO INSTALLATION OF ANY PLANTSOR LANDSCAPE MATERIAL.2. ACTUAL LOCATION OF PLANT MATERIAL IS SUBJECT TO FIELD AND SITE CONDITIONS.3. NO PLANTING WILL BE INSTALLED UNTIL ALL GRADING AND CONSTRUCTION HAS BEENCOMPLETED IN THE IMMEDIATE AREA.4. ALL SUBSTITUTIONS MUST BE APPROVED BY THE LANDSCAPE ARCHITECT PRIOR TOSUBMISSION OF ANY BID AND/OR QUOTE BY THE LANDSCAPE CONTRACTOR.5. CONTRACTOR SHALL PROVIDE TWO YEAR GUARANTEE OF ALL PLANT MATERIALS. THEGUARANTEE BEGINS ON THE DATE OF THE LANDSCAPE ARCHITECT'S OR OWNER'S WRITTENACCEPTANCE OF THE INITIAL PLANTING. REPLACEMENT PLANT MATERIAL SHALL HAVE A ONEYEAR GUARANTEE COMMENCING UPON PLANTING.6. ALL PLANTS TO BE SPECIMEN GRADE, MINNESOTA-GROWN AND/OR HARDY. SPECIMEN GRADESHALL ADHERE TO, BUT IS NOT LIMITED BY, THE FOLLOWING STANDARDS:ALL PLANTS SHALL BE FREE FROM DISEASE, PESTS, WOUNDS, SCARS, ETC.ALL PLANTS SHALL BE FREE FROM NOTICEABLE GAPS, HOLES, OR DEFORMITIES.ALL PLANTS SHALL BE FREE FROM BROKEN OR DEAD BRANCHES.ALL PLANTS SHALL HAVE HEAVY, HEALTHY BRANCHING AND LEAFING.CONIFEROUS TREES SHALL HAVE AN ESTABLISHED MAIN LEADER AND A HEIGHT TO WIDTHRATIO OF NO LESS THAN 5:3.7. PLANTS TO MEET AMERICAN STANDARD FOR NURSERY STOCK (ANSI Z60.1-2014 OR MOSTCURRENT VERSION) REQUIREMENTS FOR SIZE AND TYPE SPECIFIED.8. PLANTS TO BE INSTALLED AS PER MNLA & ANSI STANDARD PLANTING PRACTICES.9. PLANTS SHALL BE IMMEDIATELY PLANTED UPON ARRIVAL AT SITE. PROPERLY HEEL-INMATERIALS IF NECESSARY; TEMPORARY ONLY.10. PRIOR TO PLANTING, FIELD VERIFY THAT THE ROOT COLLAR/ROOT FLAIR IS LOCATED AT THETOP OF THE BALLED & BURLAP TREE. IF THIS IS NOT THE CASE, SOIL SHALL BE REMOVEDDOWN TO THE ROOT COLLAR/ROOT FLAIR. WHEN THE BALLED & BURLAP TREE IS PLANTED, THEROOT COLLAR/ROOT FLAIR SHALL BE EVEN OR SLIGHTLY ABOVE FINISHED GRADE.11. OPEN TOP OF BURLAP ON BB MATERIALS; REMOVE POT ON POTTED PLANTS; SPLIT AND BREAKAPART PEAT POTS.12. PRUNE PLANTS AS NECESSARY - PER STANDARD NURSERY PRACTICE AND TO CORRECT POORBRANCHING OF EXISTING AND PROPOSED TREES.13. WRAP ALL SMOOTH-BARKED TREES - FASTEN TOP AND BOTTOM. REMOVE BY APRIL 1ST.14. STAKING OF TREES AS REQUIRED; REPOSITION, PLUMB AND STAKE IF NOT PLUMB AFTER ONEYEAR.15. THE NEED FOR SOIL AMENDMENTS SHALL BE DETERMINED UPON SITE SOIL CONDITIONS PRIORTO PLANTING. LANDSCAPE CONTRACTOR SHALL NOTIFY LANDSCAPE ARCHITECT FOR THENEED OF ANY SOIL AMENDMENTS.16. BACKFILL SOIL AND TOPSOIL TO ADHERE TO MN/DOT STANDARD SPECIFICATION 3877 (SELECTTOPSOIL BORROW) AND TO BE EXISTING TOP SOIL FROM SITE FREE OF ROOTS, ROCKS LARGERTHAN ONE INCH, SUBSOIL DEBRIS, AND LARGE WEEDS UNLESS SPECIFIED OTHERWISE.MINIMUM 4" DEPTH TOPSOIL FOR ALL LAWN GRASS AREAS AND 12" DEPTH TOPSOIL FOR TREE,SHRUBS, AND PERENNIALS.17. MULCH TO BE AT ALL TREE, SHRUB, PERENNIAL, AND MAINTENANCE AREAS. TREE AND SHRUBPLANTING BEDS SHALL HAVE 4" DEPTH OF DOUBLE SHREDDED HARDWOOD MULCH. DOUBLESHREDDED HARDWOOD MULCH TO BE USED AROUND ALL PLANTS WITHIN TURF AREAS.PERENNIAL AND ORNAMENTAL GRASS BEDS SHALL HAVE 2" DEPTH DOUBLE SHREDDEDHARDWOOD MULCH. MULCH TO BE FREE OF DELETERIOUS MATERIAL AND COLORED DARKWALNUT, OR APPROVED EQUAL. ROCK MULCH TO BE RIVER ROCK, 1 1/2" TO 3" DIAMETER, ATMINIMUM 3" DEPTH, OR APPROVED EQUAL. ROCK MULCH TO BE ON COMMERCIAL GRADEFILTER FABRIC, BY TYPAR, OR APPROVED EQUAL WITH NO EXPOSURE. MULCH AND FABRIC TOBE APPROVED BY OWNER PRIOR TO INSTALLATION. MULCH TO MATCH EXISTING CONDITIONS(WHERE APPLICABLE).18. EDGING TO BE COMMERCIAL GRADE VALLEY-VIEW BLACK DIAMOND (OR EQUAL) POLY EDGINGOR SPADED EDGE, AS INDICATED. POLY EDGING SHALL BE PLACED WITH SMOOTH CURVES ANDSTAKED WITH METAL SPIKES NO GREATER THAN 4 FOOT ON CENTER WITH BASE OF TOP BEADAT GRADE, FOR MOWERS TO CUT ABOVE WITHOUT DAMAGE. UTILIZE CURBS AND SIDEWALKSFOR EDGING WHERE POSSIBLE. SPADED EDGE TO PROVIDE V-SHAPED DEPTH AND WIDTH TOCREATE SEPARATION BETWEEN MULCH AND GRASS. INDIVIDUAL TREE, SHRUB, ORRAIN-GARDEN BEDS TO BE SPADED EDGE, UNLESS NOTED OTHERWISE. EDGING TO MATCHEXISTING CONDITIONS (WHERE APPLICABLE).19. ALL DISTURBED AREAS TO BE SODDED OR SEEDED, UNLESS OTHERWISE NOTED. SOD TO BESTANDARD MINNESOTA GROWN AND HARDY BLUEGRASS MIX, FREE OF LAWN WEEDS. ALLTOPSOIL AREAS TO BE RAKED TO REMOVE DEBRIS AND ENSURE DRAINAGE. SLOPES OF 3:1 ORGREATER SHALL BE STAKED. SEED AS SPECIFIED AND PER MN/DOT SPECIFICATIONS. IF NOTINDICATED ON LANDSCAPE PLAN, SEE EROSION CONTROL PLAN.20. PROVIDE IRRIGATION TO ALL PLANTED AREAS ON SITE. IRRIGATION SYSTEM TO BEDESIGN/BUILD BY LANDSCAPE CONTRACTOR. LANDSCAPE CONTRACTOR TO PROVIDE SHOPDRAWINGS TO LANDSCAPE ARCHITECT FOR APPROVAL PRIOR TO INSTALLATION OF IRRIGATIONSYSTEM. CONTRACTOR TO PROVIDE OPERATION MANUALS, AS-BUILT PLANS, AND NORMALPROGRAMMING. SYSTEM SHALL BE WINTERIZED AND HAVE SPRING STARTUP DURING FIRSTYEAR OF OPERATION. SYSTEM SHALL HAVE ONE-YEAR WARRANTY ON ALL PARTS AND LABOR.ALL INFORMATION ABOUT INSTALLATION AND SCHEDULING CAN BE OBTAINED FROM THEGENERAL CONTRACTOR.21. CONTRACTOR SHALL PROVIDE NECESSARY WATERING OF PLANT MATERIALS UNTIL THE PLANTIS FULLY ESTABLISHED OR IRRIGATION SYSTEM IS OPERATIONAL. OWNER WILL NOT PROVIDEWATER FOR CONTRACTOR.22. REPAIR, REPLACE, OR PROVIDE SOD/SEED AS REQUIRED FOR ANY ROADWAY BOULEVARDAREAS ADJACENT TO THE SITE DISTURBED DURING CONSTRUCTION.23. REPAIR ALL DAMAGE TO PROPERTY FROM PLANTING OPERATIONS AT NO COST TO OWNER.LANDSCAPE NOTESNOTE: PLANT QUANTITIES SHOWN ARE FOR THE CONVENIENCE OF THE OWNERAND JURISDICTIONAL REVIEW AGENCIES. THE CONTRACTOR IS RESPONSIBLE FORVERIFYING ALL PLANT QUANTITIES PER PLAN AND FIELD CONDITIONS. ),567/(9(/ 723$5$3(7 ,168/$7('35(&$67&21&5(7(3&$67,168/$7('35(&$67&21&5(7(3&$67,168/$7('35(&$67&21&5(7(3&$67,168/$7('35(&$67&21&5(7(3&$67)/$6+)/$6+$/80,1806725()5217:,1'2:6<67(0$)672&/(5(6725< ),567/(9(/ 723$5$3(7 ,168/$7('35(&$67&21&5(7(3&$67,168/$7('35(&$67&21&5(7(3&$67,168/$7('35(&$67&21&5(7(3&$67,168/$7('35(&$67&21&5(7(3&$67&21&($/(')$67(1(50(7$/3$1(/03)/$6+)/$6+$/80,1806725()5217:,1'2:6<67(0$)672&/(5(6725< 7207/3$1(/ ),567/(9(/ 723$5$3(7 72(175< )/$6+)/$6+,168/$7('35(&$67&21&5(7(3&$67,168/$7('35(&$67&21&5(7(3&$67,168/$7('35(&$67&21&5(7(3&$67,168/$7('35(&$67&21&5(7(3&$67&21&($/(')$67(1(50(7$/3$1(/03$/80,1806725()5217:,1'2:6<67(0$)6,168/$7('35(&$67&21&5(7(3&$67,168/$7('35(&$67&21&5(7(3&$67$/80,1806725()5217:,1'2:6<67(0$)6726725()5217 7+,1%5,&. 726725()5217 727+,1%5,&. 7207/3$1(/ ),567/(9(/ 723$5$3(7 72(175< ,168/$7('35(&$67&21&5(7(3&$67,168/$7('35(&$67&21&5(7(3&$67,168/$7('35(&$67&21&5(7(3&$67,168/$7('35(&$67&21&5(7(3&$67,168/$7('35(&$67&21&5(7(3&$67&21&($/(')$67(1(50(7$/3$1(/03,168/$7('35(&$67&21&5(7(3&$67,168/$7('35(&$67&21&5(7(3&$67$/80,1806725()5217:,1'2:6<67(0$)6)/$6+)/$6+7207/3$1(/ 727+,1%5,&. 726725()5217 7+,1%5,&. 726725()5217 ),567/(9(/ 723$5$3(7 72(175< )/$6+)/$6+&21&($/(')$67(1(50(7$/3$1(/03,168/$7('35(&$67&21&5(7(3&$67,168/$7('35(&$67&21&5(7(3&$67,168/$7('35(&$67&21&5(7(3&$67,168/$7('35(&$67&21&5(7(3&$67,168/$7('35(&$67&21&5(7(3&$67&21&($/(')$67(1(50(7$/3$1(/03$/80,1806725()5217:,1'2:6<67(0$)6,168/$7('35(&$67&21&5(7(3&$67,168/$7('35(&$67&21&5(7(3&$67$/80,1806725()5217:,1'2:6<67(0$)67207/3$1(/ 727+,1%5,&. 726725()5217 7+,1%5,&. 726725()5217 $$$$6$6$6$6$6/YY[KY°GTJ°8K\OYOUTY )USSOYYOUT°4U *XG]T°H_ )NKIQKJ°H_ 6+((7ϭϮϵϱEE>sE͕^h/dϮϬϬ^d͘Wh>͕DEϱϱϭϬϴͲϮϳϯϱ;ϲϱϭͿϲϰϮͲϵϮϬϬͮ&y;ϲϱϭͿϲϰϮͲϭϭϬϭǁǁǁ͘ƉŽƉĞĂƌĐŚ͘ĐŽŵWKWZ,/dd^͕/E͘127)25&216758&7,21 758(6+((76&$/($0&?5HYLW3URMHFWV?B$UGHQ+LOOVB5BUWHMHGDUYW$635(/,0,1$5<(;7(5,25(/(9$7,216%00)*$7(:$<,17(567$7($5'(1+,//601 $6&(175$/'2&. $6:,1*'2&. $6:,1*)$&$'( $6(1')$&$'( $60$,1)$&$'($)6 $/80,180:,1'2:)5$0(6 7%' $12',=(' &/($5$12',=(' 6(((/(9$7,216$)6)/$6+ :,1'2:6,//)/$6+,1* 7%' 0$7&+$)6 0$7&+$)6 6(((/(9$7,216)/$6+ &$3)/$6+,1* 6((63(&,),&$7,216 3$,17(' 6:3(33(5&2516(((/(9$7,216)/$6+ &$3)/$6+,1* 6((63(&,),&$7,216 3$,17(' 6:$0$=,1**5$<6(((/(9$7,21603 &21&($/(')$67(1(50(7$/3$1(/6 6((63(&,),&$7,216 3$,17(' 0$7&+$/8&2%21'6,/9(50(7$//,&6(((/(9$7,2163&$67 35(&$67&21&5(7(:$//3$1(/6 7%' 60227+ 6:3(33(5&2516(((/(9$7,2163&$67 35(&$67&21&5(7(:$//3$1(/6 7%' &$67,1%5,&. '$5.%52:1 6(((/(9$7,2163&$67 35(&$67&21&5(7(:$//3$1(/6 7%' 60227+ 6:)(/7(':22/6(((/(9$7,2163&$67 35(&$67&21&5(7(:$//3$1(/6 7%' 60227+ 6:$0$=,1**5$<6(((/(9$7,2160$7(5,$/,' 0$7(5,$/ 0$18)$&785(5 ),1,6+ &2/25 /2&$7,21(;7(5,250$7(5,$/),1,6+6&+('8/(127(0$7(5,$/),1,6+(6$1'&2/256$5(35(/,0,1$5<$1'0$<&+$1*(&,7<68%0,77$/ '2&. 6) 6):,1*'2&. 6) 6) 6)(1' 6) 6) 6) 6):,1* 6) 6) 6) 6)0$,1 6) 6) 6) 6)0(7$/3$1(/ %5,&. */$66 3$,17('35(&$67)$&$'( 0$7(5,$/(;7(5,250$7(5,$/%<)$d$'( Filename: D:\Gateway Interstate\Working Files\AGI\Gateway Interstate 00464771B.AGIThe Lighting Analysis, ezLayout, Energy Analysis and/or Visual Simulation ("Lighting Design") provided byRAB Lighting Inc. ("RAB") represents an anticipated prediction of lighting system performance based upon designparameters and information supplied by others. These design parameters and information provided by others havenot been field verified by RAB and therefore actual measured results may vary from the actual field conditions.RAB recommends that design parameters and other information be field verified to reduce variation.RAB neither warranties, either implied or stated with regard to actual measured light levels or energy consumptionlevels as compared to those illustrated by the Lighting Design. RAB neither warranties, either implied or stated, norrepresents the appropriateness, completeness or suitability of the Lighting Design intent as compliant with anyapplicable regulatory code requirements with the exception of those specifically stated on drawings created andsubmitted by RAB. The Lighting design is issued, in whole or in part, as advisory documents for informational purposesand is not intended for construction nor as being part of a project's construction documentation package.Scale: as notedDate:7/20/2020Filename: Gateway Interstate 00464771B.AGIPrepared For:Rouzer Group7003 West Lake StreetSuite 300Louis Park, MN 55426Tel: 952-737-6320PROJECT # 151888Drawn By: K. Gonzales, LCNOTES:* The light loss factor (LLF) is a product of many variables, only lamp lumen depreciation (LLD)has been applied to the calculated results unless otherwise noted. The LLD is the result (quotient)of mean lumens / initial lumens per lamp manufacturers' specifications.* Illumination values shown (in footcandles) are the predicted results for planes of calculationeither horizontal, vertical or inclined as designated in the calculation summary. Meter orientationis normal to the plane of calculation.* The calculated results of this lighting simulation represent an anticipated prediction of systemperformance. Actual measured results may vary from the anticipated performance and are subjectto means and methods which are beyond the control of RAB Lighting Inc.* Mounting height determination is job site specific, our lighting simulations assume a mountingheight (insertion point of the luminaire symbol) to be taken at the top of the symbol for ceilingmounted luminaires and at the bottom of the symbol for all other luminaire mounting configurations.* It is the Owner’s responsibility to confirm the suitability of the existing or proposed poles and basesto support the proposed fixtures, based on the weight and EPA of the proposed fixtures and the owner’ssite soil conditions and wind zone. It is recommended that a professional engineer licensed to practicein the state the site is located be engaged to assist in this determination.* The landscape material shown hereon is conceptual, and is not intended to be an accuraterepresentation of any particular plant, shrub, bush, or tree, as these materials are living objects,and subject to constant change. The conceptual objects shown are for illustrative purposes only.The actual illumination values measured in the field will vary.* Photometric model elements such as buildings, rooms, plants, furnishings or any architecturaldetails which impact the dispersion of light must be detailed by the customer documents for inclusionin the RAB lighting design model. RAB is not responsible for any inaccuracies caused by incompleteinformation on the part of the customer, and reserves the right to use best judgement when translatingcustomer requests into photometric studies.* RAB Lighting Inc. luminaire and product designs are protected under U.S. and International intellectualproperty laws. Patents issued or pending apply.Job Name:Gateway InterstateLighting LayoutVersion BCASE # 00464771Luminaire Schedule All quotes/orders generated from this layout must be forwarded to the Local Rep AgencyLuminaire Tag SummaryTagQtyA21SymbolQtyTagLabelArrangementLLFDescriptionBUG Rating Calculation SummaryExpanded Luminaire Location SummaryLumNoTagXExpanded Luminaire Location SummaryLumNoYMTG HTOrient1LabelCalcTypeUnitsAvgMaxC551766.393201834.04320256.2132CMinAvg/Min21AWPLED4T150SINGLE1.000Wall mounted551623.787201814.83120TagXYMTG HTOrient24B1-U0-G3167.2422B552113.339201347.4613052.07925Max/MinDescriptionPtSpcLrPtSpcTbMeter TypeBack DriveIlluminanceFc2.7610.8B552153.297201317.4053052.0790.213.8054.00readings taken at grade10BC551626.713201814.16920347.2423A551852.384201740.223099.35326A551762.667201304.43730233.6662710HorizontalDrive 1Illuminance164A551886.205201733.4453011.4165A551755.009201719.3453099.3536CA552436.16201308.0983094.642Fc3.3210.20.48.3025.50readings taken at grade10552056.742201713.58920250.2017B28B552407.175201306.8383094.64210HorizontalDrive 2IlluminanceFc3.409.30.56.8018.60readings taken at grade1010HorizontalLoading DockIlluminanceFc16BWPLED4T360 D10SINGLE1.000Wall mountedB1-U0-G58CALED3T150SINGLE1.000Pole mounted (Type III)B1-U0-G31CALED3T150 x2@180BACK-BACK1.000Pole mounted (Type III) x2@180B1-U0-G3C10551891.425201709.4153011.8628A551657.634201698.473099.3539A551650.286201666.3530190.24810B551901.888201660.5223011.86211C552169.223201645.96720238.81512B551912.35201611.6293011.86213A551671.193201568.5630190.24814C552277.776201567.6120229.49215B551922.813201562.7363011.86216B551933.276201513.8433011.86217C552382.247201470.38520228.01318A551692.101201470.7730190.24819B551953.507201467.6843052.07920B551993.465201437.6283052.07921B552033.423201407.5723052.07922B552073.381201377.5173052.07923A551713.008201372.9830190.248Total Quantity: 47 ( 24 shown, 1 through 24 )29B552357.297201303.3433094.64230C552535.982201297.76720351.06531B552307.419201299.8493094.64232B552261.792201296.3543094.64233B552211.914201293.1093094.64234A552466.778201279.401304.00435A551842.673201244.44530233.66636A551922.68201184.45430233.66637A552473.886201179.654304.00438C552598.541201168.0142030.62639A552002.686201124.46230233.66640A552480.995201079.907304.00441A552449.33201064.40630272.86242A552082.692201064.4730233.66643A552349.59201057.18830272.86244A552249.851201049.97130272.86245A552150.112201042.75330272.86246C552641.922201042.25120123.485Total Quantity: 47 ( 23 shown, 25 through 47 )9.2613.23.22.894.13readings taken at grade1010HorizontalParkingIlluminanceFc2.329.60.37.7332.00readings taken at grade1010HorizontalSiteIlluminanceFc0.1810.70.0N.A.N.A.readings taken at grade1010HorizontalScale: 1 inch= 100 Ft.DRIVE 1DRIVE 2BACK DRIVEPARKINGPARKINGPARKINGPARKINGPARKINGLOADING DOCKOVERHEAD UTILITY LINESRETAINING WALLUGCGR AV ELGRAVELGRAVELGRAVELB I T U M I N O U S B I T U M I N O U SB I T U M I N O U SB I T U M I N O U SB I T U M I N O U SGRAVELCONCRETEGRAVELGRAVELGRAV EL GASOHE OHEOHEOHEOHE OHE OHE OHEOHEOHEOHE OHE OHE INTERSTATE HIGHWAY NO. 694INTERSTATE HIGHGATEWAY BLVD.GATEWAY BLVD.35-24135-24135-24133-26133-26133-26133-26133-26135-24125-13125-13135-24135-24125-13125-13125-13135-24135-24135-24135-24135-24135-24135-24133-262886.2886.4884.3886.0886.1883.2885.6886.1888.8896.1895.9893.7885.9893.1892.9892.1892.1895.8899.0897.8908.8908.5908.2887.8888.7889.4889.8895.63902.5901.7880.3880.2896.0882.2880.8894.6889.6892.5894.3895.5896.2897.8896.295.7886.6887.5888.4889.0889.2889.8890.2889.7886.7885.6885.4886.2887.2887.5890.0889.3888.7887.7883.6879.4879.1879.7882.8899.2902.4904.1903.5900.8898.2895.8893.2892.1892.6892.1891.9891.4891.5892.4892.8893.4893.3896.3899.9894.3907.6905.2901.3909.2905.3893.35 FT. CHAIN LINK FENCE5 FT. CHAIN LINK FENCE5 FT. CHAIN LINK FENCE5 FT. CHAIN LINK FENCE5 FT CHAIN LINK FENCE5 FT CHAIN LINK FENCE4 FT BARBED WIRE FE4 FT BARBED WIRE F4 FT BARBED WIRE F4 FT BARBED WIRE FINTERSTATE HIGHW AY 35W INTERSTATE HIGHWAY 35W18" RCPSTUCTURE885.3880.4(NE)INV=881.9(W)TOP=INV=C12CA34AA5C67BA8A910BC11B12A13C1415BB16C17A1819B20B21BB22A23B2425BA26A2728BB29C3031B32BB33A34A35A3637AC38A39A4041AA42A43A44A45C460.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.10.10.10.10.10.10.10.10.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.20.20.20.20.20.20.20.20.20.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.1 0.2 0.2 0.2 0.2 0.2 0.3 0.3 0.3 0.3 0.3 0.3 0.3 0.3 0.3 0.3 0.3 0.3 0.30.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.10.10.10.10.10.10.10.10.10.10.10.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.2 0.2 0.2 0.3 0.3 0.3 0.4 0.4 0.4 0.5 0.5 0.5 0.5 0.5 0.4 0.4 0.4 0.4 0.4 0.40.40.40.40.30.30.30.30.30.30.30.30.30.30.30.30.20.20.20.20.20.20.20.20.10.10.10.10.10.10.10.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.3 0.4 0.4 0.4 0.5 0.6 0.6 0.7 0.8 0.8 0.7 0.7 0.6 0.6 0.6 0.6 0.6 0.60.60.60.60.50.50.50.50.50.50.40.40.40.40.40.40.40.40.30.30.30.30.30.30.20.20.20.20.10.10.10.10.10.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.3 0.4 0.5 0.5 0.5 0.6 0.6 0.7 0.8 0.9 1.0 1.0 1.0 0.9 0.9 0.8 0.8 0.8 0.8 0.80.90.90.80.80.70.70.60.60.60.70.70.70.60.60.60.50.50.50.50.50.50.40.40.40.30.30.20.20.10.10.10.10.10.10.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.2 0.2 0.2 0.3 0.4 0.5 0.6 0.6 0.7 1.1 1.1 1.0 0.9 0.8 0.8 0.8 0.9 0.9 0.9 0.9 0.9 0.8 0.8 0.7 0.7 0.7 0.7 0.7 0.7 0.7 0.6 0.6 0.5 0.4 0.3 0.2 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.3 0.4 0.6 0.7 0.8 0.9 0.9 0.9 1.4 1.00.9 0.9 0.9 1.0 0.9 0.9 0.8 0.7 0.5 0.4 0.3 0.3 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.2 0.2 0.2 0.3 0.4 0.5 0.6 0.8 0.91.30.2 0.2 0.2 0.2 0.2 0.2 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.00.00.00.00.00.00.00.00.10.10.10.10.10.20.20.30.30.40.50.70.81.00.4 0.5 0.4 0.3 0.2 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.4 0.4 0.5 0.7 0.8 1.0 1.9 2.1 2.20.8 1.1 1.5 1.4 0.8 0.5 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.4 0.5 0.6 0.7 0.8 1.8 1.6 1.73.11.80.50.20.10.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.3 0.4 0.5 0.7 0.8 0.8 1.3 0.8 0.8 1.8 3.3 3.7 2.5 1.3 0.8 0.7 0.7 1.0 1.8 3.5 5.71.5 2.03.1 1.1 0.4 0.2 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.4 0.5 0.6 0.8 0.9 0.9 1.0 2.51.9 2.1 1.6 0.9 0.6 0.5 0.6 0.8 1.5 3.0 5.0 5.3 3.5 1.9 1.0 2.6 2.8 1.0 1.0 3.8 1.2 0.4 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.2 0.2 0.2 0.3 0.4 0.5 0.7 0.8 1.0 5.7 3.80.4 0.4 0.5 0.6 1.1 2.5 4.1 4.3 2.8 1.4 2.7 3.8 3.8 1.6 1.2 0.8 1.1 1.9 3.2 3.5 1.1 0.3 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.3 0.4 0.5 0.7 0.9 1.0 2.5 1.93.7 1.0 0.8 0.6 0.6 0.7 0.9 1.4 2.6 3.1 1.7 0.6 0.2 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.1 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.4 0.4 0.6 0.7 0.8 1.0 1.6 0.94.8 1.0 0.8 0.6 0.5 0.5 0.5 0.7 1.1 1.9 1.3 0.7 0.3 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.4 0.5 0.6 0.7 0.8 1.5 0.9 0.53.6 1.0 0.7 0.5 0.4 0.3 0.3 0.4 0.6 0.9 0.9 0.6 0.3 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.3 0.4 0.5 0.7 0.8 0.8 1.2 0.52.1 0.9 0.7 0.5 0.3 0.3 0.3 0.3 0.4 0.5 0.7 0.6 0.4 0.2 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.1 0.2 0.2 0.3 0.4 0.5 0.6 0.8 0.9 1.0 2.51.2 0.8 0.6 0.4 0.3 0.2 0.2 0.2 0.3 0.5 0.4 0.3 0.2 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.2 0.2 0.2 0.3 0.4 0.5 0.7 0.8 1.0 5.7 3.80.9 0.8 0.6 0.4 0.3 0.2 0.3 0.3 0.5 0.6 0.5 0.4 0.3 0.2 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.20.20.3 0.3 0.4 0.5 0.7 0.9 1.0 2.5 1.90.9 0.7 0.6 0.4 0.3 0.3 0.4 0.7 0.7 0.5 0.3 0.2 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.4 0.4 0.6 0.7 0.8 1.0 1.7 0.91.1 0.7 0.6 0.4 0.3 0.4 0.8 2.3 1.3 0.8 0.5 0.3 0.2 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.4 0.5 0.6 0.7 0.8 0.9 0.50.6 0.7 0.6 0.4 0.3 0.7 2.0 1.5 0.8 0.4 0.3 0.2 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.3 0.4 0.5 0.7 0.8 0.8 1.2 0.51.3 1.0 0.8 0.6 0.4 0.4 1.0 6.0 3.0 1.6 0.8 0.4 0.2 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.4 0.5 0.6 0.8 0.9 1.0 5.8 2.52.6 1.0 0.8 0.6 0.5 0.9 3.4 2.8 1.2 0.6 0.3 0.2 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.2 0.2 0.2 0.3 0.4 0.5 0.7 0.8 1.0 5.7 3.83.5 7.1 6.9 5.1 2.2 1.5 1.1 0.9 0.6 0.7 1.6 3.5 1.8 0.8 0.4 0.2 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.20.20.30.30.40.50.70.91.0 2.51.92.7 4.8 5.2 4.1 2.5 2.0 1.4 1.1 0.9 0.7 0.8 2.5 2.6 0.9 0.5 0.3 0.2 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.3 0.4 0.5 0.7 0.8 1.0 0.91.5 3.0 3.5 2.9 2.2 1.8 1.3 1.0 0.9 0.7 0.9 2.8 1.5 0.7 0.3 0.2 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.4 0.5 0.6 0.7 0.8 0.9 0.50.9 1.8 2.4 2.3 1.9 1.5 1.2 1.0 0.9 0.8 1.1 1.7 0.9 0.5 0.3 0.2 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.4 0.5 0.6 0.8 0.8 1.1 1.2 0.50.7 1.3 1.7 1.7 1.6 1.3 1.2 1.1 1.0 0.9 1.2 0.9 0.6 0.4 0.2 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.4 0.6 0.8 0.9 0.9 2.50.7 1.3 1.5 1.5 1.4 1.3 1.3 1.3 1.2 0.9 0.8 0.5 0.4 0.2 0.2 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.4 0.6 0.8 0.9 5.6 3.80.9 1.5 1.8 1.7 1.5 1.4 1.7 1.7 1.5 0.7 0.5 0.4 0.3 0.2 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.2 0.3 0.4 0.6 0.8 1.0 1.6 2.5 1.91.5 2.3 2.6 2.1 1.8 1.7 2.3 2.5 0.7 0.5 0.4 0.3 0.2 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.2 0.3 0.4 0.5 0.7 0.9 1.1 0.92.9 3.7 3.6 2.5 2.1 2.0 3.7 1.2 0.7 0.5 0.3 0.2 0.2 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.4 0.6 0.9 0.55.0 5.5 5.0 2.9 2.3 2.3 4.4 1.4 0.7 0.4 0.3 0.2 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.3 0.4 1.2 0.52.06.57.05.83.32.52.54.7 1.50.70.40.20.20.10.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.2 0.3 0.3 0.4 0.5 0.6 2.51.64.55.14.52.72.12.14.8 1.70.70.40.20.10.10.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.2 0.3 0.3 0.4 0.5 0.6 5.6 3.80.9 2.6 3.2 3.0 2.2 1.8 1.6 3.8 0.8 0.4 0.2 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.2 0.3 0.4 0.5 0.6 0.7 2.4 1.82.8 1.8 2.1 2.4 2.4 1.9 1.5 1.4 2.8 6.8 0.8 0.5 0.3 0.2 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.4 0.6 0.7 0.8 1.2 0.75.1 3.1 2.3 2.0 1.8 1.4 1.2 1.1 1.8 4.6 4.6 0.9 0.5 0.3 0.2 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.2 0.4 0.5 0.7 0.9 1.1 1.5 0.9 0.55.3 3.7 2.6 1.9 1.4 1.1 0.9 0.8 1.1 2.9 3.1 2.1 1.4 0.8 0.4 0.2 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.4 0.6 0.8 1.1 1.5 1.14.6 3.5 2.4 1.7 1.2 0.9 0.7 0.6 0.7 1.2 1.7 1.4 1.0 0.6 0.4 0.2 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.5 0.7 0.9 1.3 1.8 1.73.8 2.9 2.0 1.4 1.0 0.8 0.6 0.5 0.5 0.7 0.9 0.9 0.7 0.5 0.3 0.2 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.2 0.3 0.5 0.8 1.1 2.53.0 2.3 1.7 1.2 0.9 0.6 0.5 0.4 0.3 0.4 0.5 0.5 0.4 0.3 0.2 0.2 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.2 0.4 0.6 0.8 2.62.3 1.8 1.4 1.0 0.7 0.5 0.4 0.3 0.3 0.2 0.3 0.3 0.3 0.2 0.2 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.4 0.6 0.8 4.9 4.61.7 1.4 1.1 0.8 0.6 0.5 0.3 0.3 0.2 0.2 0.2 0.2 0.2 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.2 0.3 0.4 0.6 0.8 2.31.6 1.3 1.1 0.9 0.7 0.5 0.4 0.3 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.2 0.3 0.5 0.7 0.8 1.11.2 1.0 0.8 0.7 0.6 0.4 0.3 0.3 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.4 0.5 0.7 0.9 0.60.9 0.7 0.6 0.5 0.4 0.4 0.3 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.4 0.6 0.8 0.40.80.70.50.50.40.30.30.20.20.10.10.10.10.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.4 0.7 0.9 0.90.9 0.9 0.8 0.8 0.8 0.8 0.8 0.8 0.8 0.9 0.9 0.9 0.6 0.5 0.4 0.4 0.3 0.3 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.2 0.3 0.5 0.8 1.0 1.10.90.80.70.60.60.60.60.60.60.60.70.70.81.01.2 1.20.60.40.30.30.30.20.20.20.10.10.10.10.10.10.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.2 0.3 0.5 0.8 1.1 1.70.80.70.60.50.50.50.40.40.50.50.50.60.70.81.21.9 2.20.70.40.30.30.20.20.20.10.10.10.10.10.10.10.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.4 0.6 0.9 2.20.7 0.6 0.5 0.5 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.5 0.5 0.7 0.9 1.6 2.9 0.9 0.5 0.3 0.2 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.4 0.6 0.9 6.4 2.10.8 0.7 0.6 0.5 0.4 0.4 0.3 0.3 0.3 0.3 0.3 0.4 0.4 0.5 0.5 0.7 1.0 2.8 1.0 0.4 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.2 0.3 0.5 0.6 0.9 1.1 1.6 3.90.7 0.6 0.5 0.4 0.4 0.3 0.3 0.3 0.3 0.3 0.3 0.3 0.4 0.4 0.5 0.6 0.8 2.4 0.7 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.2 0.3 0.5 0.7 0.9 2.9 2.7 1.90.7 0.6 0.5 0.4 0.4 0.3 0.3 0.3 0.3 0.3 0.3 0.3 0.4 0.4 0.5 0.6 0.6 1.3 0.7 0.3 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.4 0.5 0.7 0.9 0.80.8 0.7 0.6 0.5 0.4 0.3 0.3 0.3 0.3 0.2 0.2 0.3 0.3 0.4 0.4 0.5 0.6 0.7 0.6 0.4 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.4 0.6 0.7 0.50.80.60.50.40.40.30.30.30.20.20.20.30.30.30.50.60.91.0 0.30.20.20.10.10.10.10.10.10.10.10.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.4 0.6 0.8 0.80.70.60.50.40.40.30.30.30.20.20.20.30.30.30.40.71.11.6 0.20.10.10.10.10.10.10.10.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.5 0.7 0.9 0.80.9 0.7 0.6 0.5 0.4 0.3 0.3 0.3 0.3 0.2 0.2 0.3 0.3 0.3 0.4 0.5 0.7 1.1 0.8 0.3 0.1 0.1 0.1 0.1 0.0 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.2 0.3 0.5 0.8 1.0 1.10.9 0.7 0.6 0.5 0.4 0.3 0.3 0.3 0.3 0.2 0.2 0.3 0.3 0.3 0.4 0.5 0.8 1.3 2.1 0.5 0.2 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.2 0.4 0.6 0.9 1.1 1.60.8 0.6 0.5 0.4 0.3 0.3 0.3 0.3 0.2 0.3 0.3 0.3 0.3 0.4 0.5 0.8 1.4 3.1 0.9 0.3 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.4 0.6 0.9 5.8 1.90.8 0.7 0.5 0.4 0.3 0.3 0.3 0.3 0.3 0.3 0.3 0.3 0.4 0.4 0.5 0.7 1.1 4.4 1.2 0.4 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.4 0.7 0.9 5.51.0 0.7 0.6 0.4 0.4 0.3 0.3 0.3 0.3 0.3 0.3 0.3 0.4 0.4 0.5 0.6 0.8 3.7 0.7 0.4 0.2 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.2 0.3 0.5 0.7 0.9 3.20.8 0.6 0.5 0.4 0.3 0.3 0.3 0.3 0.3 0.3 0.4 0.5 0.5 0.6 0.7 2.1 0.9 0.2 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.2 0.3 0.5 0.7 0.9 1.4 1.40.8 0.6 0.5 0.4 0.3 0.3 0.3 0.3 0.3 0.4 0.5 0.7 1.0 1.0 0.6 0.3 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.4 0.5 0.7 1.4 0.60.7 0.5 0.4 0.4 0.4 0.4 0.4 0.4 0.5 0.6 0.9 1.4 0.2 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.4 0.6 0.8 0.40.9 0.7 0.5 0.4 0.4 0.4 0.4 0.5 0.6 0.8 1.1 2.0 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.4 0.6 0.8 0.80.8 0.6 0.5 0.5 0.4 0.5 0.5 0.7 1.1 1.7 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.5 0.7 0.9 0.80.8 0.6 0.5 0.5 0.5 0.6 0.7 1.0 1.7 0.6 0.2 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.5 0.8 1.0 1.00.8 0.7 0.6 0.6 0.6 0.7 0.9 5.1 1.8 0.7 0.3 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.6 0.8 1.50.8 0.8 0.7 0.7 0.8 0.8 2.9 0.6 0.4 0.2 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.4 0.6 0.8 5.91.0 1.0 1.1 1.1 2.1 1.2 0.7 0.2 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.4 0.6 0.8 1.1 4.71.41.7 0.60.50.40.20.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.4 0.5 0.7 3.5 3.6 2.50.6 0.4 0.2 0.2 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.5 0.7 2.6 2.4 1.00.90.40.20.10.10.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.4 2.5 3.1 4.1 4.9 3.8 1.82.9 1.0 0.4 0.2 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.4 2.7 1.8 1.0 0.7 0.6 0.53.8 1.8 0.8 0.4 0.2 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.2 0.32.5 3.8 4.6 2.9 1.22.3 1.1 0.6 0.5 0.3 0.2 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.2 0.31.4 0.8 0.6 0.51.00.90.70.40.10.20.20.10.10.10.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.2 0.3 1.42.7 3.9 3.9 2.0 4.2 9.5 10.7 10.1 0.9 0.7 0.6 0.4 0.3 0.2 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.2 0.4 0.5 1.3 1.86.1 6.6 4.2 2.1 4.1 6.8 7.6 7.3 6.1 5.0 3.7 2.7 2.1 1.6 1.2 1.0 0.7 0.5 0.4 0.3 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.4 0.6 1.4 2.06.3 6.1 4.2 2.8 3.5 4.7 5.3 5.0 4.4 3.7 2.9 2.2 1.7 1.3 1.0 0.8 0.6 0.4 0.3 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.2 0.3 0.4 0.7 1.8 2.9 3.0 2.7 2.2 1.7 2.2 4.5 3.5 2.9 3.0 3.3 3.8 3.5 3.2 2.6 2.2 1.7 1.4 1.1 0.8 0.6 0.5 0.4 0.3 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.2 0.3 0.4 0.8 1.4 3.5 4.4 4.4 3.6 2.7 1.7 1.2 1.1 1.0 1.1 1.2 1.8 1.8 2.5 2.3 2.2 2.3 2.3 2.4 2.4 2.2 1.9 1.6 1.3 1.1 0.9 0.7 0.5 0.4 0.3 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.2 0.3 0.5 0.9 1.9 5.2 6.4 4.5 3.4 1.7 1.1 1.1 1.3 1.6 1.7 2.0 2.0 1.8 1.7 1.7 1.7 1.6 1.6 1.5 1.3 1.2 1.0 0.8 0.7 0.5 0.4 0.3 0.3 0.2 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.4 0.9 2.1 6.71.51.51.41.31.21.21.21.11.11.00.90.90.80.60.50.40.30.30.20.20.10.10.10.10.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.2 0.4 0.7 1.8 3.8 6.51.1 1.0 0.9 0.9 0.9 0.8 0.8 0.8 0.8 0.7 0.7 0.6 0.6 0.5 0.4 0.3 0.3 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.2 0.3 0.6 1.4 3.52.3 1.1 0.9 0.8 0.8 0.7 0.7 0.6 0.6 0.6 0.5 0.5 0.5 0.5 0.5 0.4 0.4 0.3 0.3 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.2 0.5 1.1 3.04.7 2.5 1.4 0.8 0.6 0.5 0.5 0.5 0.4 0.5 0.5 0.4 0.4 0.4 0.4 0.4 0.3 0.3 0.3 0.3 0.2 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.2 0.4 0.9 2.22.1 1.9 1.9 1.0 0.8 0.7 0.5 0.4 0.3 0.3 0.3 0.3 0.3 0.3 0.3 0.3 0.3 0.3 0.3 0.3 0.2 0.2 0.2 0.2 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.2 0.4 0.7 1.5 2.2 2.1 0.4 0.4 0.4 0.4 0.5 0.6 0.5 0.3 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.2 0.3 0.5 0.9 1.3 1.0 1.1 0.8 0.6 0.4 0.3 0.2 0.2 0.2 0.2 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.20.30.50.8 0.60.50.60.50.40.30.20.10.10.10.10.10.10.10.10.10.10.10.10.10.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.2 0.2 0.4 0.5 0.3 0.3 0.3 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.20.20.30.30.20.20.10.10.10.10.10.10.10.10.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.60.7 1.0 1.11.0 1.3 1.61.8 2.72.5 3.9 4.53.3 5.1 6.35.4 8.65.3 10.24.5 7.5 8.03.9 5.6 5.73.5 4.3 3.02.1 2.41.2 1.2 0.80.7 0.6 0.40.40.6 0.7 0.8 0.9 1.0 1.1 1.2 1.2 1.1 1.00.8 0.9 1.0 1.2 1.5 1.6 1.8 1.7 1.5 1.4 1.1 1.0 1.1 1.2 1.3 1.4 1.3 1.2 1.1 1.0 0.9 0.9 0.9 1.01.0 1.0 1.1 1.1 1.3 1.7 2.0 2.2 2.5 2.3 2.1 1.8 1.5 1.3 1.3 1.4 1.7 1.8 2.0 1.9 1.7 1.5 1.2 1.1 1.1 1.2 1.3 1.5 1.6 1.5 1.3 1.2 1.1 1.0 1.0 1.0 1.1 1.1 1.1 1.11.21.41.51.61.51.51.72.12.53.13.73.32.62.21.81.41.51.92.12.42.62.42.21.91.61.31.31.61.82.02.22.11.81.61.31.21.21.31.51.61.71.61.4 1.1 0.9 0.7 0.6 0.5 0.4 0.3 0.3 0.3 0.3 0.31.3 1.6 1.9 2.1 2.1 2.1 1.9 2.5 3.4 4.9 6.3 5.4 3.8 2.7 2.0 1.5 1.7 2.2 2.8 3.7 4.5 3.9 2.9 2.3 1.8 1.5 1.6 2.0 2.2 2.6 2.9 2.6 2.3 2.0 1.6 1.4 1.4 1.7 2.0 2.1 2.4 2.1 1.9 1.5 1.2 1.0 0.8 0.6 0.5 0.4 0.4 0.4 0.4 0.51.01.21.62.12.52.73.02.8 2.13.14.97.05.73.82.41.71.41.62.33.34.96.75.73.92.71.91.51.72.43.04.25.14.43.22.51.91.51.62.12.42.93.32.8 2.3 1.9 1.6 1.3 1.1 0.9 0.7 0.6 0.5 0.5 0.6 0.80.9 1.1 1.5 2.0 2.4 3.6 4.8 4.7 3.3 2.1 1.1 1.0 1.1 1.7 3.0 4.9 7.2 5.6 3.6 2.2 1.3 1.5 2.2 3.2 5.0 6.8 5.6 3.7 2.6 1.8 1.7 2.4 3.3 4.7 5.9 4.9 3.4 2.5 2.0 1.7 1.5 1.2 1.0 0.8 0.7 0.7 0.7 0.91.1 1.3 1.7 2.1 3.0 4.9 6.8 5.8 3.92.8 4.8 7.1 5.3 3.4 2.0 1.4 1.4 2.1 3.2 5.1 7.0 5.5 3.5 2.5 2.3 2.3 1.8 1.4 0.7 0.7 0.91.0 1.1 1.2 1.3 1.7 2.3 3.2 4.3 6.1 6.72.9 2.0 2.8 3.1 2.2 1.8 0.8 0.7 0.71.2 1.4 1.5 1.6 1.6 1.5 1.6 2.0 2.4 3.24.7 4.3 2.6 2.01.3 1.7 1.9 2.1 2.1 2.1 1.7 1.5 1.4 1.46.4 5.4 3.0 2.2 1.6 1.11.0 1.3 1.6 2.1 2.6 2.7 3.0 2.7 2.0 0.95.7 6.0 5.1 3.0 2.3 1.6 1.10.9 1.1 1.5 2.0 2.4 3.6 4.8 4.7 3.2 2.03.6 4.2 3.8 2.5 2.0 1.4 1.11.0 1.1 1.3 1.7 2.1 3.0 4.9 6.8 5.8 3.92.1 2.8 2.7 2.1 1.7 1.31.0 1.1 1.2 1.2 1.3 1.7 2.3 3.2 4.4 6.1 6.61.3 2.0 2.1 1.8 1.4 1.11.2 1.4 1.6 1.6 1.6 1.5 1.6 2.0 2.4 3.21.1 1.5 1.5 1.4 1.2 1.01.7 1.9 2.1 2.1 2.1 1.7 1.5 1.4 1.41.2 1.5 1.5 1.4 1.2 1.01.0 1.3 1.6 2.1 2.6 2.7 3.0 2.7 2.0 1.31.7 2.2 2.0 1.7 1.3 1.00.9 1.1 1.5 2.0 2.4 3.6 4.8 4.7 3.2 2.02.7 3.1 2.5 2.0 1.5 1.11.0 1.1 1.3 1.7 2.1 3.0 4.9 5.8 3.94.6 4.5 3.1 2.2 1.7 1.21.0 1.1 1.2 1.2 1.3 1.7 2.3 3.2 4.43.7 2.4 1.31.2 1.4 1.6 1.6 1.6 1.5 1.6 2.0 2.4 3.21.3 1.7 1.9 2.1 2.1 2.1 1.7 1.5 1.4 1.41.0 1.2 1.6 2.1 2.6 2.7 3.0 2.7 2.0 1.3 0.91.1 1.5 2.0 2.4 3.6 4.8 4.7 3.2 2.01.0 1.1 1.7 2.1 3.0 4.9 6.8 5.8 3.91.0 1.1 1.2 1.2 1.3 1.7 2.3 3.2 4.4 6.1 6.61.2 1.4 1.6 1.6 1.6 1.5 1.6 2.4 3.21.2 1.6 1.9 2.1 2.1 2.1 1.7 1.5 1.40.8 1.1 1.5 2.1 2.6 2.7 3.0 2.7 2.0 1.30.7 0.9 1.3 1.9 2.3 3.6 4.8 4.6 3.2 2.00.7 1.0 1.5 2.0 2.9 4.9 6.8 5.8 4.00.7 1.0 1.5 2.1 3.0 4.3 6.10.8 1.0 1.3 1.8 2.2 3.10.9 1.0 1.1 1.2 1.2 1.21.3 1.41.8 2.2 2.01.9 2.3 3.1 2.9 2.11.2 1.7 2.2 3.1 4.8 4.71.3 1.9 2.6 4.1 6.6 6.71.3 1.8 2.4 3.8 5.6 6.01.3 1.7 2.2 3.10.9 1.2 1.5 2.0 2.5 2.5 2.00.9 1.1 1.4 1.6 1.8 1.71.0 1.2 1.4 1.5 1.5 1.31.1 1.4 1.7 1.8 1.7 1.21.0 1.4 1.8 2.1 2.5 2.3 1.51.2 1.6 2.1 2.6 3.6 3.31.3 1.9 2.4 3.6 5.3 5.11.4 2.0 2.6 4.4 6.7 7.21.3 1.9 2.4 3.9 5.2 5.51.0 1.3 1.7 2.2 3.0 3.30.9 1.2 1.5 1.9 2.4 2.31.0 1.1 1.4 1.6 1.7 1.51.0 1.2 1.4 1.5 1.5 1.21.2 1.5 1.8 2.0 1.8 1.21.1 1.4 1.9 2.2 2.7 2.4 1.51.2 1.7 2.2 2.9 4.0 3.61.4 2.0 2.6 4.0 5.8 5.51.4 2.0 2.6 4.5 6.6 7.31.4 1.9 2.4 3.9 4.8 4.91.7 2.2 2.9 3.1 2.81.0 1.2 1.5 1.9 2.31.0 1.2 1.4 1.5 1.6 1.31.1 1.3 1.5 1.6 1.5 1.11.0 1.3 1.6 2.0 2.2 1.8 1.11.1 1.5 2.0 2.4 2.9 2.51.3 1.8 2.3 3.3 4.4 4.01.4 2.1 2.7 4.5 6.2 5.91.3 1.9 2.5 4.6 6.2 6.91.8 2.3 3.7 4.4 4.40.8 1.1 1.6 2.10.7 1.0 1.4 1.90.6 0.9 1.2 1.6 4.3 5.8 6.50.4 0.5 0.7 1.0 1.5 2.4 4.5 6.2 6.3 4.5 2.7 1.7 1.10.3 0.5 0.7 0.9 1.4 2.1 2.8 3.9 5.2 5.3 4.2 2.9 2.1 1.5 1.4 1.7 2.6 4.2 6.10.4 0.5 0.6 0.9 1.2 1.8 2.3 2.7 3.2 3.1 2.8 2.4 2.0 1.6 1.7 2.3 3.2 4.8 6.6 5.9 4.0 2.4 1.4 1.00.9 2.1 2.4 2.7 2.4 2.2 2.0 1.7 1.5 1.7 2.3 2.9 4.2 5.7 5.2 3.9 2.7 1.9 1.5 1.5 1.9 2.9 4.62.0 2.2 2.3 2.0 1.8 1.6 1.4 1.4 1.6 2.0 2.3 2.7 3.3 3.1 2.7 2.4 1.9 1.6 1.9 2.6 3.61.8 1.5 1.3 1.2 1.2 1.4 1.6 1.9 2.2 2.5 2.3 2.3 2.1 1.8 1.7 2.0 2.6 3.4 4.8 6.01.1 1.2 1.3 1.6 1.8 1.9 1.9 1.9 1.8 1.7 2.0 2.3 2.6 3.0 3.41.1 2.0 2.1 2.1 1.9 1.9 2.1 2.2 2.42.7 1.3 0.9 0.8 0.9 1.0 1.9 2.2 2.6 3.2 3.3 2.9 2.4 2.0 1.8 1.78.3 4.8 3.1 1.3 0.9 0.8 0.9 1.1 1.5 2.2 3.1 3.9 4.3 4.7 4.6 3.8 3.0 2.2 1.7 1.38.9 4.9 3.4 1.6 0.9 0.8 0.9 1.2 1.7 2.6 4.0 4.9 6.4 7.4 6.5 5.2 3.8 2.07.0 4.8 3.4 1.7 0.9 0.7 0.8 1.2 1.8 3.1 4.9 6.8 9.1 9.6 6.15.3 4.0 2.6 1.6 0.9 0.6 0.7 1.0 1.6 3.0 3.7 3.73.4 2.8 1.8 1.2 0.7 0.5 0.4 0.51.6 1.21.4 2.41.5 2.6 4.4 5.91.5 2.5 3.9 5.9 9.0 9.23.4 4.3 5.9 7.3 6.03.9 4.3 4.53.0 2.8 2.31.5 1.6 1.40.7 0.8 0.80.5 0.50.6 0.6 0.60.8 1.2 0.92.7 2.0 1.33.4 4.3 2.66.3 5.2 3.29.1 8.3 4.68.6 6.4 4.15.1 6.2 4.52.5 4.4 3.92.1 2.6 2.51.0 1.4 1.50.9 1.0 1.01.1 0.9 0.81.9 1.5 1.02.8 2.1 1.35.3 4.0 2.96.9 5.3 3.89.3 6.6 4.17.4 4.4 2.46.7 4.3 2.4 1.13.7 2.35.7 5.5 5.6 5.6 5.4 5.3 5.5 5.9 6.14.74.24.14.24.24.03.94.04.24.24.14.14.34.54.54.44.44.74.95.04.74.64.64.54.23.45.74.63.83.43.33.33.33.13.03.03.13.13.03.03.13.33.23.13.23.33.53.53.43.23.23.12.92.45.2 4.4 3.7 3.2 2.9 2.8 2.8 2.7 2.6 2.5 2.5 2.5 2.5 2.4 2.4 2.5 2.5 2.5 2.4 2.4 2.6 2.7 2.7 2.6 2.5 2.5 2.4 2.24.5 3.8 3.4 3.1 2.8 2.5 2.4 2.3 2.2 2.1 2.0 2.0 2.0 2.0 1.9 1.9 2.0 2.0 2.0 2.0 2.0 2.1 2.2 2.2 2.2 2.1 2.0 1.8 1.65.4 4.2 3.4 3.0 2.8 2.6 2.3 2.1 2.0 1.9 1.8 1.7 1.6 1.6 1.7 1.6 1.6 1.6 1.6 1.7 1.7 1.7 1.7 1.9 2.0 2.0 2.0 1.9 1.7 1.5 1.25.0 4.1 3.4 2.8 2.4 2.2 2.1 1.9 1.8 1.6 1.4 1.3 1.3 1.2 1.2 1.2 1.2 1.2 1.2 1.3 1.3 1.3 1.4 1.5 1.7 2.0 2.1 2.1 1.9 1.6 1.35.34.33.73.22.82.42.11.91.71.51.41.21.11.0 0.90.90.91.01.01.11.21.41.82.42.72.52.11.65.4 4.2 3.3 2.8 2.6 2.3 2.0 1.8 1.5 1.3 1.2 1.01.1 1.5 2.5 3.7 3.8 3.5 2.95.0 4.1 3.3 2.7 2.3 2.1 1.9 1.7 1.5 1.3 1.02.43.94.75.65.15.44.43.73.22.72.42.01.81.61.41.21.03.85.17.47.85.5 4.3 3.4 2.9 2.6 2.3 2.0 1.8 1.5 1.3 1.1 0.93.04.46.89.95.24.23.42.82.42.11.91.71.51.21.00.81.8 2.9 4.9 6.25.8 4.7 3.9 3.4 2.9 2.5 2.1 1.8 1.6 1.4 1.2 1.01.11.62.74.06.1 4.8 3.8 3.2 2.8 2.5 2.1 1.8 1.5 1.3 1.1 0.90.7 0.8 0.9 1.2 1.66.2 5.0 4.0 3.3 2.8 2.4 2.1 1.8 1.6 1.3 1.0 0.90.80.80.70.70.76.2 4.9 4.1 3.5 3.0 2.5 2.1 1.8 1.6 1.3 1.01.3 1.2 1.0 0.7 0.55.3 4.1 3.5 3.1 2.7 2.3 1.8 1.5 1.2 1.02.2 2.2 1.9 1.4 0.84.9 3.7 3.2 2.8 2.4 2.0 1.6 1.3 1.03.0 3.7 3.6 3.3 2.14.7 3.6 3.0 2.6 2.2 1.8 1.4 1.13.3 4.3 5.3 5.8 4.16.0 4.4 3.4 2.8 2.4 2.0 1.5 1.21.83.24.36.58.85.2 3.9 3.1 2.6 2.1 1.7 1.3 1.01.3 2.2 3.6 5.6 8.34.6 3.4 2.7 2.3 1.9 1.5 1.20.9 1.3 2.1 3.6 5.4 4.54.3 3.2 2.6 2.1 1.7 1.3 1.00.91.01.21.83.12.64.1 3.1 2.5 2.0 1.6 1.2 0.91.3 1.2 1.1 0.9 0.9 1.0 0.9 0.65.3 3.8 2.9 2.4 1.9 1.6 1.22.42.21.71.30.80.50.40.24.7 3.4 2.7 2.2 1.8 1.5 1.12.9 3.7 3.9 3.5 2.8 1.5 0.6 0.3 0.24.3 3.1 2.4 2.0 1.7 1.3 1.0 3.5 4.4 5.4 6.1 5.1 3.1 0.9 0.34.0 3.0 2.3 1.9 1.6 1.2 1.0 1.9 3.2 4.4 6.8 9.7 8.25.5 3.9 2.9 2.3 1.9 1.6 1.2 1.0 1.0 1.4 2.1 3.5 5.7 7.6 6.75.0 3.6 2.8 2.3 1.9 1.6 1.3 0.9 1.1 1.4 2.0 3.5 3.94.5 3.3 2.6 2.2 1.9 1.6 1.3 1.1 1.4 1.3 1.1 1.1 1.1 1.34.1 3.0 2.4 2.1 1.9 1.7 1.6 1.6 1.8 2.8 2.4 1.9 1.4 1.0 0.83.9 3.0 2.4 2.1 2.1 2.2 2.6 3.3 3.8 4.2 4.2 3.6 2.8 1.75.4 3.8 3.0 2.5 2.3 2.4 2.8 3.7 4.6 5.4 6.7 6.4 5.4 3.74.9 3.6 2.8 2.5 2.3 2.5 3.1 4.2 6.1 8.4 10.8 7.94.2 3.1 2.5 2.2 2.2 2.4 3.2 4.6 5.3 5.73.7 2.7 2.2 1.9 1.7 1.8 1.9 2.14.7 3.3 2.4 1.9 1.5 1.3 1.12.9 2.2 1.7 1.34.86.15.75.04.87.2 8.4 10.2 11.4 11.1 10.5 9.8 10.6 11.4 10.7 10.0 9.1 8.8 8.1 7.0 6.1 5.6 4.8 4.3 3.7 3.25.5 9.8 9.6 10.1 10.6 11.3 11.3 10.9 10.9 11.0 11.6 11.5 11.2 11.1 11.3 11.8 11.0 9.9 10.0 10.7 11.3 10.5 9.4 9.4 9.9 10.7 9.9 9.1 7.8 4.76.7 11.6 11.3 11.0 10.9 10.9 10.5 10.4 10.9 10.8 10.7 10.5 10.8 11.4 11.4 11.0 11.1 10.8 10.7 10.5 10.7 10.8 10.5 10.3 10.4 10.9 11.3 11.6 11.5 10.6 7.17.9 11.1 11.5 11.8 11.3 11.2 11.0 10.4 10.2 10.5 10.3 9.9 9.4 10.0 10.6 10.6 9.7 9.3 10.1 10.2 10.1 9.4 9.4 10.0 10.3 10.4 10.2 10.5 11.2 11.6 10.3 7.24.4 9.5 10.2 10.8 11.0 10.2 9.9 10.2 9.4 8.7 8.5 9.0 9.1 8.6 8.6 9.1 9.6 9.7 9.2 9.0 9.5 9.7 9.6 9.0 8.8 9.6 9.7 9.7 9.2 8.7 8.9 8.9 7.9 5.95.9 11.1 11.1 10.8 10.8 10.5 9.9 9.2 8.0 6.9 6.4 6.4 6.4 6.1 6.0 6.4 7.0 7.0 6.6 6.6 7.1 7.7 7.4 7.1 7.2 7.9 8.4 8.3 7.9 7.8 7.7 7.0 6.17.4 10.7 11.2 11.1 10.2 10.2 10.0 9.4 7.4 5.95.4 5.8 5.7 5.4 5.3 5.3 5.2 4.54.0 9.3 9.9 10.5 10.8 9.6 9.2 9.6 9.0 7.4 5.85.6 10.9 10.9 10.5 10.6 10.3 9.5 8.8 7.6 6.57.2 10.4 11.0 10.9 10.1 10.0 9.9 9.2 7.1 5.64.1 9.2 9.8 10.3 10.6 9.5 9.0 9.5 8.8 7.2 5.65.7 10.9 10.9 10.5 10.5 10.2 9.4 8.7 7.5 6.37.3 10.6 11.0 10.9 10.1 10.0 9.9 9.1 7.0 5.64.2 9.4 10.0 10.5 10.7 9.6 9.1 9.5 8.7 7.2 5.56.0 11.2 11.2 10.7 10.7 10.3 9.6 8.7 7.5 6.47.8 11.0 11.4 11.3 10.4 10.2 10.0 9.3 7.1 5.65.1 10.0 10.6 11.0 11.2 9.9 9.4 9.7 9.0 7.36.4 11.9 11.9 11.6 11.5 11.0 10.1 9.1 7.8 6.65.8 11.1 12.2 12.6 12.0 11.6 10.9 9.9 7.6 5.97.9 11.5 12.7 12.0 11.6 11.6 10.2 8.29.8 12.9 13.0 12.4 11.9 10.1 8.011.8 13.2 13.0 12.0 10.7 8.111.7 12.9 12.3 10.9 9.6 6.95.4 11.3 11.9 11.7 10.7 8.9 6.26.7 10.6 11.5 11.2 10.6 8.68.6 11.3 11.2 10.6 10.1 8.010.7 11.5 10.5 9.7 9.2 6.810.6 11.2 10.0 9.2 8.3 6.05.0 10.2 10.8 10.4 9.7 7.96.6 10.0 10.8 10.4 9.8 7.88.6 10.8 10.7 10.0 9.6 7.310.6 11.1 10.0 9.2 8.6 6.210.4 10.9 9.7 8.9 7.9 5.55.3 9.9 10.4 10.2 9.5 7.57.0 9.9 10.5 10.1 9.5 7.59.0 10.7 10.5 9.8 9.3 6.910.8 10.9 9.9 9.0 8.2 5.94.1 10.6 10.8 9.6 8.9 7.6 5.35.7 10.0 10.5 10.1 9.6 7.37.7 10.2 10.7 10.2 9.5 7.39.6 11.2 11.0 10.1 9.2 6.711.7 11.7 10.7 9.3 8.2 5.75.6 12.3 12.1 10.4 8.8 7.37.3 12.4 12.4 10.5 8.4 6.47.3 5.80.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.5111111111111111111111111111222222222222222220.5120.50.50.511111111111222222222222222222222222222222222222211220.20.5111111222222222222222222 Filename: D:\Gateway Interstate\Working Files\AGI\Gateway Interstate 00464771B.AGIThe Lighting Analysis, ezLayout, Energy Analysis and/or Visual Simulation ("Lighting Design") provided byRAB Lighting Inc. ("RAB") represents an anticipated prediction of lighting system performance based upon designparameters and information supplied by others. These design parameters and information provided by others havenot been field verified by RAB and therefore actual measured results may vary from the actual field conditions.RAB recommends that design parameters and other information be field verified to reduce variation.RAB neither warranties, either implied or stated with regard to actual measured light levels or energy consumptionlevels as compared to those illustrated by the Lighting Design. RAB neither warranties, either implied or stated, norrepresents the appropriateness, completeness or suitability of the Lighting Design intent as compliant with anyapplicable regulatory code requirements with the exception of those specifically stated on drawings created andsubmitted by RAB. The Lighting design is issued, in whole or in part, as advisory documents for informational purposesand is not intended for construction nor as being part of a project's construction documentation package.Scale: as notedDate:7/20/2020Filename: Gateway Interstate 00464771B.AGIPrepared For:Rouzer Group7003 West Lake StreetSuite 300Louis Park, MN 55426Tel: 952-737-6320PROJECT # 151888Drawn By: K. Gonzales, LCGateway InterstateLighting LayoutVersion BJob Name:CASE # 00464771Scale: 1 inch= 40 Ft.DRIVE 1DRIVE 2BACK DRIVEPARKINGPARKINGLOADING DOCKRETAINING WALLGRAVELB I T U M I N O U S B I T U M I N O U SB I T U M I N O U SG R A V E L OHEO H E O H EGATEWAY BLVD.GATEW AY BLVD.33-2616135-24125-13125-13135-24125-13125-13125-13135-24135-24135-24135-24133-262885.6886.1908.8908.5908.2889.8902.5901.7880.8897.8889.2889.8890.2889.787.5890.0889.3888.7907.6905.2901.3909.2905.318" RCPE)C12CA34AA5C67BA8A910BC11B12A13C1415BB16C17A1819B20B21BB22A23B2425BA26A2728BB29C3031B32BB33A34A350.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.3 0.4 0.5 0.7 0.8 1.0 0.91.5 3.0 3.5 2.9 2.2 1.8 1.3 1.0 0.9 0.7 0.9 2.8 1.5 0.7 0.3 0.2 0.100.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.4 0.5 0.6 0.7 0.8 0.9 0.50.9 1.8 2.4 2.3 1.9 1.5 1.2 1.0 0.9 0.8 1.1 1.7 0.9 0.5 0.3 0.2 0.100.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.4 0.5 0.6 0.8 0.8 1.1 1.2 0.50.7 1.3 1.7 1.7 1.6 1.3 1.2 1.1 1.0 0.9 1.2 0.9 0.6 0.4 0.2 0.1 0.100.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.4 0.6 0.8 0.9 0.9 2.50.7 1.3 1.5 1.5 1.4 1.3 1.3 1.3 1.2 0.9 0.8 0.5 0.4 0.2 0.2 0.1 0.100.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.4 0.6 0.8 0.9 5.6 3.80.9 1.5 1.8 1.7 1.5 1.4 1.7 1.7 1.5 0.7 0.5 0.4 0.3 0.2 0.1 0.1 0.000.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.2 0.3 0.4 0.6 0.8 1.0 1.6 2.5 1.91.5 2.3 2.6 2.1 1.8 1.7 2.3 2.5 0.7 0.5 0.4 0.3 0.2 0.1 0.1 0.1 0.000.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.2 0.3 0.4 0.5 0.7 0.9 1.1 0.92.9 3.7 3.6 2.5 2.1 2.0 3.7 1.2 0.7 0.5 0.3 0.2 0.2 0.1 0.1 0.0 0.000.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.4 0.6 0.9 0.55.0 5.5 5.0 2.9 2.3 2.3 4.4 1.4 0.7 0.4 0.3 0.2 0.1 0.1 0.1 0.0 0.000.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.3 0.4 1.2 0.52.0 6.5 7.0 5.8 3.3 2.5 2.5 4.7 1.5 0.7 0.4 0.2 0.2 0.1 0.1 0.0 0.0 0.000.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.2 0.3 0.3 0.4 0.5 0.6 2.51.6 4.5 5.1 4.5 2.7 2.1 2.1 4.8 1.7 0.7 0.4 0.2 0.1 0.1 0.1 0.0 0.0 0.000.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.2 0.3 0.3 0.4 0.5 0.6 5.6 3.80.9 2.6 3.2 3.0 2.2 1.8 1.6 3.8 0.8 0.4 0.2 0.1 0.1 0.1 0.0 0.0 0.000.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.2 0.3 0.4 0.5 0.6 0.7 2.4 1.82.8 1.8 2.1 2.4 2.4 1.9 1.5 1.4 2.8 6.8 0.8 0.5 0.3 0.2 0.1 0.1 0.0 0.0 0.000.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.4 0.6 0.7 0.8 1.2 0.75.1 3.1 2.3 2.0 1.8 1.4 1.2 1.1 1.8 4.6 4.6 0.9 0.5 0.3 0.2 0.1 0.1 0.0 0.0 0.000.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.2 0.4 0.5 0.7 0.9 1.1 1.5 0.9 0.55.3 3.7 2.6 1.9 1.4 1.1 0.9 0.8 1.1 2.9 3.1 2.1 1.4 0.8 0.4 0.2 0.1 0.1 0.1 0.0 0.0 0.000.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.4 0.6 0.8 1.1 1.5 1.14.6 3.5 2.4 1.7 1.2 0.9 0.7 0.6 0.7 1.2 1.7 1.4 1.0 0.6 0.4 0.2 0.1 0.1 0.1 0.0 0.0 0.000.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.5 0.7 0.9 1.3 1.8 1.73.8 2.9 2.0 1.4 1.0 0.8 0.6 0.5 0.5 0.7 0.9 0.9 0.7 0.5 0.3 0.2 0.1 0.1 0.1 0.0 0.0 0.000.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.2 0.3 0.5 0.8 1.1 2.53.0 2.3 1.7 1.2 0.9 0.6 0.5 0.4 0.3 0.4 0.5 0.5 0.4 0.3 0.2 0.2 0.1 0.1 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.2 0.4 0.6 0.8 2.62.3 1.8 1.4 1.0 0.7 0.5 0.4 0.3 0.3 0.2 0.3 0.3 0.3 0.2 0.2 0.1 0.1 0.1 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.4 0.6 0.8 4.9 4.61.7 1.4 1.1 0.8 0.6 0.5 0.3 0.3 0.2 0.2 0.2 0.2 0.2 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.2 0.3 0.4 0.6 0.8 2.31.6 1.3 1.1 0.9 0.7 0.5 0.4 0.3 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.2 0.3 0.5 0.7 0.8 1.11.2 1.0 0.8 0.7 0.6 0.4 0.3 0.3 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.4 0.5 0.7 0.9 0.60.9 0.7 0.6 0.5 0.4 0.4 0.3 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.4 0.6 0.8 0.40.8 0.7 0.5 0.5 0.4 0.3 0.3 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.4 0.7 0.9 0.90.9 0.9 0.8 0.8 0.8 0.8 0.8 0.8 0.8 0.9 0.9 0.9 0.6 0.5 0.4 0.4 0.3 0.3 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.2 0.3 0.5 0.8 1.0 1.10.9 0.8 0.7 0.6 0.6 0.6 0.6 0.6 0.6 0.6 0.7 0.7 0.8 1.0 1.2 1.2 0.6 0.4 0.3 0.3 0.3 0.2 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.2 0.3 0.5 0.8 1.1 1.70.8 0.7 0.6 0.5 0.5 0.5 0.4 0.4 0.5 0.5 0.5 0.6 0.7 0.8 1.2 1.9 2.2 0.7 0.4 0.3 0.3 0.2 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.4 0.6 0.9 2.20.7 0.6 0.5 0.5 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.5 0.5 0.7 0.9 1.6 2.9 0.9 0.5 0.3 0.2 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.4 0.6 0.9 6.4 2.10.8 0.7 0.6 0.5 0.4 0.4 0.3 0.3 0.3 0.3 0.3 0.4 0.4 0.5 0.5 0.7 1.0 2.8 1.0 0.4 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.2 0.3 0.5 0.6 0.9 1.1 1.6 3.90.7 0.6 0.5 0.4 0.4 0.3 0.3 0.3 0.3 0.3 0.3 0.3 0.4 0.4 0.5 0.6 0.8 2.4 0.7 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.2 0.3 0.5 0.7 0.9 2.9 2.7 1.90.7 0.6 0.5 0.4 0.4 0.3 0.3 0.3 0.3 0.3 0.3 0.3 0.4 0.4 0.5 0.6 0.6 1.3 0.7 0.3 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.4 0.5 0.7 0.9 0.80.8 0.7 0.6 0.5 0.4 0.3 0.3 0.3 0.3 0.2 0.2 0.3 0.3 0.4 0.4 0.5 0.6 0.7 0.6 0.4 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.4 0.6 0.7 0.50.8 0.6 0.5 0.4 0.4 0.3 0.3 0.3 0.2 0.2 0.2 0.3 0.3 0.3 0.5 0.6 0.9 1.0 0.3 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.4 0.6 0.8 0.80.7 0.6 0.5 0.4 0.4 0.3 0.3 0.3 0.2 0.2 0.2 0.3 0.3 0.3 0.4 0.7 1.1 1.6 0.2 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.5 0.7 0.9 0.80.9 0.7 0.6 0.5 0.4 0.3 0.3 0.3 0.3 0.2 0.2 0.3 0.3 0.3 0.4 0.5 0.7 1.1 0.8 0.3 0.1 0.1 0.1 0.1 0.0 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.2 0.3 0.5 0.8 1.0 1.10.9 0.7 0.6 0.5 0.4 0.3 0.3 0.3 0.3 0.2 0.2 0.3 0.3 0.3 0.4 0.5 0.8 1.3 2.1 0.5 0.2 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.2 0.4 0.6 0.9 1.1 1.60.8 0.6 0.5 0.4 0.3 0.3 0.3 0.3 0.2 0.3 0.3 0.3 0.3 0.4 0.5 0.8 1.4 3.1 0.9 0.3 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.4 0.6 0.9 5.8 1.90.8 0.7 0.5 0.4 0.3 0.3 0.3 0.3 0.3 0.3 0.3 0.3 0.4 0.4 0.5 0.7 1.1 4.4 1.2 0.4 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.4 0.7 0.9 5.51.0 0.7 0.6 0.4 0.4 0.3 0.3 0.3 0.3 0.3 0.3 0.3 0.4 0.4 0.5 0.6 0.8 3.7 0.7 0.4 0.2 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.2 0.3 0.5 0.7 0.9 3.20.8 0.6 0.5 0.4 0.3 0.3 0.3 0.3 0.3 0.3 0.4 0.5 0.5 0.6 0.7 2.1 0.9 0.2 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.2 0.3 0.5 0.7 0.9 1.4 1.40.8 0.6 0.5 0.4 0.3 0.3 0.3 0.3 0.3 0.4 0.5 0.7 1.0 1.0 0.6 0.3 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.4 0.5 0.7 1.4 0.60.7 0.5 0.4 0.4 0.4 0.4 0.4 0.4 0.5 0.6 0.9 1.4 0.2 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.4 0.6 0.8 0.40.9 0.7 0.5 0.4 0.4 0.4 0.4 0.5 0.6 0.8 1.1 2.0 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.4 0.6 0.8 0.80.8 0.6 0.5 0.5 0.4 0.5 0.5 0.7 1.1 1.7 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.5 0.7 0.9 0.80.8 0.6 0.5 0.5 0.5 0.6 0.7 1.0 1.7 0.6 0.2 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.5 0.8 1.0 1.00.8 0.7 0.6 0.6 0.6 0.7 0.9 5.1 1.8 0.7 0.3 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.6 0.8 1.50.8 0.8 0.7 0.7 0.8 0.8 2.9 0.6 0.4 0.2 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.4 0.6 0.8 5.91.0 1.0 1.1 1.1 2.1 1.2 0.7 0.2 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.4 0.6 0.8 1.1 4.71.4 1.7 0.6 0.5 0.4 0.2 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.4 0.5 0.7 3.5 3.6 2.50.6 0.4 0.2 0.2 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.5 0.7 2.6 2.4 1.00.9 0.4 0.2 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.4 2.5 3.1 4.1 4.9 3.8 1.82.9 1.0 0.4 0.2 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.4 2.7 1.8 1.0 0.7 0.6 0.53.8 1.8 0.8 0.4 0.2 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.2 0.32.5 3.8 4.6 2.9 1.22.3 1.1 0.6 0.5 0.3 0.2 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.2 0.31.4 0.8 0.6 0.51.0 0.9 0.7 0.4 0.1 0.2 0.2 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.2 0.3 1.42.7 3.9 3.9 2.0 4.2 9.5 10.7 10.1 0.9 0.7 0.6 0.4 0.3 0.2 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.2 0.4 0.5 1.3 1.86.1 6.6 4.2 2.1 4.1 6.8 7.6 7.3 6.1 5.0 3.7 2.7 2.1 1.6 1.2 1.0 0.7 0.5 0.4 0.3 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.4 0.6 1.4 2.06.3 6.1 4.2 2.8 3.5 4.7 5.3 5.0 4.4 3.7 2.9 2.2 1.7 1.3 1.0 0.8 0.6 0.4 0.3 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.0 0.1 0.1 0.2 0.3 0.4 0.7 1.8 2.9 3.0 2.7 2.2 1.7 2.2 4.5 3.5 2.9 3.0 3.3 3.8 3.5 3.2 2.6 2.2 1.7 1.4 1.1 0.8 0.6 0.5 0.4 0.3 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.0 0.1 0.1 0.2 0.3 0.4 0.8 1.4 3.5 4.4 4.4 3.6 2.7 1.7 1.2 1.1 1.0 1.1 1.2 1.8 1.8 2.5 2.3 2.2 2.3 2.3 2.4 2.4 2.2 1.9 1.6 1.3 1.1 0.9 0.7 0.5 0.4 0.3 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.0 0.1 0.1 0.2 0.3 0.5 0.9 1.9 5.2 6.4 4.5 3.4 1.7 1.1 1.1 1.3 1.6 1.7 2.0 2.0 1.8 1.7 1.7 1.7 1.6 1.6 1.5 1.3 1.2 1.0 0.8 0.7 0.5 0.4 0.3 0.3 0.2 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.4 0.9 2.1 6.71.5 1.5 1.4 1.3 1.2 1.2 1.2 1.1 1.1 1.0 0.9 0.9 0.8 0.6 0.5 0.4 0.3 0.3 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.2 0.4 0.7 1.8 3.8 6.51.1 1.0 0.9 0.9 0.9 0.8 0.8 0.8 0.8 0.7 0.7 0.6 0.6 0.5 0.4 0.3 0.3 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.2 0.3 0.6 1.4 3.52.3 1.1 0.9 0.8 0.8 0.7 0.7 0.6 0.6 0.6 0.5 0.5 0.5 0.5 0.5 0.4 0.4 0.3 0.3 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.00.000.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.2 0.5 1.1 3.04.7 2.5 1.4 0.8 0.6 0.5 0.5 0.5 0.4 0.5 0.5 0.4 0.4 0.4 0.4 0.4 0.3 0.3 0.3 0.3 0.2 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.2 0.4 0.9 2.22.1 1.9 1.9 1.0 0.8 0.7 0.5 0.4 0.3 0.3 0.3 0.3 0.3 0.3 0.3 0.3 0.3 0.3 0.3 0.3 0.2 0.2 0.2 0.2 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.2 0.4 0.7 1.5 2.2 2.1 0.4 0.4 0.4 0.4 0.5 0.6 0.5 0.3 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.2 0.3 0.5 0.9 1.3 1.0 1.1 0.8 0.6 0.4 0.3 0.2 0.2 0.2 0.2 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.2 0.3 0.5 0.8 0.6 0.5 0.6 0.5 0.4 0.3 0.2 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.2 0.2 0.4 0.5 0.3 0.3 0.3 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.2 0.3 0.3 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.000.60.7 1.0 1.11.0 1.3 1.61.8 2.72.5 3.9 4.53.3 5.1 6.35.4 8.65.3 10.24.5 7.5 8.03.9 5.6 5.73.5 4.3 3.02.1 2.41.2 1.2 0.80.7 0.6 0.40.41.31.71.92.12.12.11.71.51.41.41.0 1.2 1.6 2.1 2.6 2.7 3.0 2.7 2.0 1.3 0.91.1 1.5 2.0 2.4 3.6 4.8 4.7 3.2 2.01.0 1.1 1.7 2.1 3.0 4.9 6.8 5.8 3.91.0 1.1 1.2 1.2 1.3 1.7 2.3 3.2 4.4 6.1 6.61.2 1.4 1.6 1.6 1.6 1.5 1.6 2.4 3.21.2 1.6 1.9 2.1 2.1 2.1 1.7 1.5 1.40.8 1.1 1.5 2.1 2.6 2.7 3.0 2.7 2.0 1.30.7 0.9 1.3 1.9 2.3 3.6 4.8 4.6 3.2 2.00.7 1.0 1.5 2.0 2.9 4.9 6.8 5.8 4.00.7 1.0 1.5 2.1 3.0 4.3 6.10.8 1.0 1.3 1.8 2.2 3.10.9 1.0 1.1 1.2 1.2 1.21.3 1.41.8 2.2 2.01.9 2.3 3.1 2.9 2.11.2 1.7 2.2 3.1 4.8 4.71.3 1.9 2.6 4.1 6.6 6.71.3 1.8 2.4 3.8 5.6 6.01.3 1.7 2.2 3.10.9 1.2 1.5 2.0 2.5 2.5 2.00.9 1.1 1.4 1.6 1.8 1.71.0 1.2 1.4 1.5 1.5 1.31.1 1.4 1.7 1.8 1.7 1.21.0 1.4 1.8 2.1 2.5 2.3 1.51.2 1.6 2.1 2.6 3.6 3.31.3 1.9 2.4 3.6 5.3 5.11.4 2.0 2.6 4.4 6.7 7.21.3 1.9 2.4 3.9 5.2 5.51.0 1.3 1.7 2.2 3.0 3.30.9 1.2 1.5 1.9 2.4 2.31.0 1.1 1.4 1.6 1.7 1.51.0 1.2 1.4 1.5 1.5 1.21.2 1.5 1.8 2.0 1.8 1.21.1 1.4 1.9 2.2 2.7 2.4 1.51.2 1.7 2.2 2.9 4.0 3.61.4 2.0 2.6 4.0 5.8 5.51.4 2.0 2.6 4.5 6.6 7.31.4 1.9 2.4 3.9 4.8 4.91.7 2.2 2.9 3.1 2.81.0 1.2 1.5 1.9 2.31.0 1.2 1.4 1.5 1.6 1.31.1 1.3 1.5 1.6 1.5 1.11.0 1.3 1.6 2.0 2.2 1.8 1.11.1 1.5 2.0 2.4 2.9 2.51.3 1.8 2.3 3.3 4.4 4.01.4 2.1 2.7 4.5 6.2 5.91.3 1.9 2.5 4.6 6.2 6.91.8 2.3 3.7 4.4 4.40.8 1.1 1.6 2.10.7 1.0 1.4 1.90.6 0.9 1.2 1.6 4.3 5.8 6.50.4 0.5 0.7 1.0 1.5 2.4 4.5 6.2 6.3 4.5 2.7 1.7 1.10.3 0.5 0.7 0.9 1.4 2.1 2.8 3.9 5.2 5.3 4.2 2.9 2.1 1.5 1.4 1.7 2.6 4.2 6.10.4 0.5 0.6 0.9 1.2 1.8 2.3 2.7 3.2 3.1 2.8 2.4 2.0 1.6 1.7 2.3 3.2 4.8 6.6 5.9 4.0 2.4 1.4 1.00.9 2.1 2.4 2.7 2.4 2.2 2.0 1.7 1.5 1.7 2.3 2.9 4.2 5.7 5.2 3.9 2.7 1.9 1.5 1.5 1.9 2.9 4.62.0 2.2 2.3 2.0 1.8 1.6 1.4 1.4 1.6 2.0 2.3 2.7 3.3 3.1 2.7 2.4 1.9 1.6 1.9 2.6 3.61.8 1.5 1.3 1.2 1.2 1.4 1.6 1.9 2.2 2.5 2.3 2.3 2.1 1.8 1.7 2.0 2.6 3.4 4.8 6.01.1 1.2 1.3 1.6 1.8 1.9 1.9 1.9 1.8 1.7 2.0 2.3 2.6 3.0 3.41.1 2.0 2.1 2.1 1.9 1.9 2.1 2.2 2.42.7 1.3 0.9 0.8 0.9 1.0 1.9 2.2 2.6 3.2 3.3 2.9 2.4 2.0 1.8 1.78.3 4.8 3.1 1.3 0.9 0.8 0.9 1.1 1.5 2.2 3.1 3.9 4.3 4.7 4.6 3.8 3.0 2.2 1.7 1.38.9 4.9 3.4 1.6 0.9 0.8 0.9 1.2 1.7 2.6 4.0 4.9 6.4 7.4 6.5 5.2 3.8 2.07.0 4.8 3.4 1.7 0.9 0.7 0.8 1.2 1.8 3.1 4.9 6.8 9.1 9.6 6.15.3 4.0 2.6 1.6 0.9 0.6 0.7 1.0 1.6 3.0 3.7 3.73.4 2.8 1.8 1.2 0.7 0.5 0.4 0.51.6 1.22.5 4.4 3.92.1 2.6 2.51.0 1.4 1.50.9 1.0 1.01.1 0.9 0.81.9 1.5 1.02.8 2.1 1.35.3 4.0 2.96.9 5.3 3.89.3 6.6 4.17.4 4.4 2.46.7 4.3 2.4 1.13.7 2.35.7 5.5 5.6 5.6 5.4 5.3 5.5 5.9 6.14.74.24.14.24.24.03.94.04.24.24.14.14.34.54.54.44.44.74.95.04.74.64.64.54.23.45.74.63.83.43.33.33.33.13.03.03.13.13.03.03.13.33.23.13.23.33.53.53.43.23.23.12.92.45.2 4.4 3.7 3.2 2.9 2.8 2.8 2.7 2.6 2.5 2.5 2.5 2.5 2.4 2.4 2.5 2.5 2.5 2.4 2.4 2.6 2.7 2.7 2.6 2.5 2.5 2.4 2.24.53.83.43.12.82.52.42.32.22.12.02.02.02.01.91.92.02.02.02.02.02.12.22.22.22.12.01.81.65.44.23.43.02.82.62.32.12.01.91.81.71.61.61.71.61.61.61.61.71.71.71.71.92.02.02.01.91.71.51.25.0 4.1 3.4 2.8 2.4 2.2 2.1 1.9 1.8 1.6 1.4 1.3 1.3 1.2 1.2 1.2 1.2 1.2 1.2 1.3 1.3 1.3 1.4 1.5 1.7 2.0 2.1 2.1 1.9 1.6 1.35.3 4.3 3.7 3.2 2.8 2.4 2.1 1.9 1.7 1.5 1.4 1.2 1.1 1.0 0.9 0.9 0.9 1.0 1.0 1.1 1.2 1.4 1.8 2.4 2.7 2.5 2.1 1.65.4 4.2 3.3 2.8 2.6 2.3 2.0 1.8 1.5 1.3 1.2 1.01.1 1.5 2.5 3.7 3.8 3.5 2.95.0 4.1 3.3 2.7 2.3 2.1 1.9 1.7 1.5 1.3 1.02.43.94.75.65.15.4 4.4 3.7 3.2 2.7 2.4 2.0 1.8 1.6 1.4 1.2 1.03.85.17.47.85.5 4.3 3.4 2.9 2.6 2.3 2.0 1.8 1.5 1.3 1.1 0.93.0 4.4 6.8 9.95.2 4.2 3.4 2.8 2.4 2.1 1.9 1.7 1.5 1.2 1.0 0.81.8 2.9 4.9 6.25.8 4.7 3.9 3.4 2.9 2.5 2.1 1.8 1.6 1.4 1.2 1.01.1 1.6 2.7 4.06.1 4.8 3.8 3.2 2.8 2.5 2.1 1.8 1.5 1.3 1.1 0.90.7 0.8 0.9 1.2 1.66.2 5.0 4.0 3.3 2.8 2.4 2.1 1.8 1.6 1.3 1.0 0.90.8 0.8 0.7 0.7 0.76.2 4.9 4.1 3.5 3.0 2.5 2.1 1.8 1.6 1.3 1.01.3 1.2 1.0 0.7 0.55.3 4.1 3.5 3.1 2.7 2.3 1.8 1.5 1.2 1.02.2 2.2 1.9 1.4 0.84.9 3.7 3.2 2.8 2.4 2.0 1.6 1.3 1.03.0 3.7 3.6 3.3 2.14.7 3.6 3.0 2.6 2.2 1.8 1.4 1.13.3 4.3 5.3 5.8 4.16.0 4.4 3.4 2.8 2.4 2.0 1.5 1.21.8 3.2 4.3 6.5 8.85.2 3.9 3.1 2.6 2.1 1.7 1.3 1.01.3 2.2 3.6 5.6 8.34.6 3.4 2.7 2.3 1.9 1.5 1.20.9 1.3 2.1 3.6 5.4 4.54.3 3.2 2.6 2.1 1.7 1.3 1.00.9 1.0 1.2 1.8 3.1 2.64.1 3.1 2.5 2.0 1.6 1.2 0.91.3 1.2 1.1 0.9 0.9 1.0 0.9 0.65.3 3.8 2.9 2.4 1.9 1.6 1.22.4 2.2 1.7 1.3 0.8 0.5 0.4 0.24.7 3.4 2.7 2.2 1.8 1.5 1.1 2.9 3.7 3.9 3.5 2.8 1.5 0.6 0.3 0.24.3 3.1 2.4 2.0 1.7 1.3 1.0 3.5 4.4 5.4 6.1 5.1 3.1 0.9 0.34.0 3.0 2.3 1.9 1.6 1.2 1.0 1.9 3.2 4.4 6.8 9.7 8.25.5 3.9 2.9 2.3 1.9 1.6 1.2 1.0 1.0 1.4 2.1 3.5 5.7 7.6 6.75.0 3.6 2.8 2.3 1.9 1.6 1.3 0.9 1.1 1.4 2.0 3.5 3.94.5 3.3 2.6 2.2 1.9 1.6 1.3 1.1 1.4 1.3 1.1 1.1 1.1 1.34.1 3.0 2.4 2.1 1.9 1.7 1.6 1.6 1.8 2.8 2.4 1.9 1.4 1.0 0.83.9 3.0 2.4 2.1 2.1 2.2 2.6 3.3 3.8 4.2 4.2 3.6 2.8 1.75.4 3.8 3.0 2.5 2.3 2.4 2.8 3.7 4.6 5.4 6.7 6.4 5.4 3.74.9 3.6 2.8 2.5 2.3 2.5 3.1 4.2 6.1 8.4 10.8 7.94.2 3.1 2.5 2.2 2.2 2.4 3.2 4.6 5.3 5.73.7 2.7 2.2 1.9 1.7 1.8 1.9 2.14.7 3.3 2.4 1.9 1.5 1.3 1.12.9 2.2 1.7 1.34.86.15.75.04.87.2 8.4 10.2 11.4 11.1 10.5 9.8 10.6 11.4 10.7 10.0 9.1 8.8 8.1 7.0 6.1 5.6 4.8 4.3 3.7 3.25.5 9.8 9.6 10.1 10.6 11.3 11.3 10.9 10.9 11.0 11.6 11.5 11.2 11.1 11.3 11.8 11.0 9.9 10.0 10.7 11.3 10.5 9.4 9.4 9.9 10.7 9.9 9.1 7.8 4.76.7 11.6 11.3 11.0 10.9 10.9 10.5 10.4 10.9 10.8 10.7 10.5 10.8 11.4 11.4 11.0 11.1 10.8 10.7 10.5 10.7 10.8 10.5 10.3 10.4 10.9 11.3 11.6 11.5 10.6 7.17.9 11.1 11.5 11.8 11.3 11.2 11.0 10.4 10.2 10.5 10.3 9.9 9.4 10.0 10.6 10.6 9.7 9.3 10.1 10.2 10.1 9.4 9.4 10.0 10.3 10.4 10.2 10.5 11.2 11.6 10.3 7.24.4 9.5 10.2 10.8 11.0 10.2 9.9 10.2 9.4 8.7 8.5 9.0 9.1 8.6 8.6 9.1 9.6 9.7 9.2 9.0 9.5 9.7 9.6 9.0 8.8 9.6 9.7 9.7 9.2 8.7 8.9 8.9 7.9 5.95.9 11.1 11.1 10.8 10.8 10.5 9.9 9.2 8.0 6.9 6.4 6.4 6.4 6.1 6.0 6.4 7.0 7.0 6.6 6.6 7.1 7.7 7.4 7.1 7.2 7.9 8.4 8.3 7.9 7.8 7.7 7.0 6.17.4 10.7 11.2 11.1 10.2 10.2 10.0 9.4 7.4 5.95.4 5.8 5.7 5.4 5.3 5.3 5.2 4.54.0 9.3 9.9 10.5 10.8 9.6 9.2 9.6 9.0 7.4 5.85.6 10.9 10.9 10.5 10.6 10.3 9.5 8.8 7.6 6.57.2 10.4 11.0 10.9 10.1 10.0 9.9 9.2 7.1 5.64.1 9.2 9.8 10.3 10.6 9.5 9.0 9.5 8.8 7.2 5.65.7 10.9 10.9 10.5 10.5 10.2 9.4 8.7 7.5 6.37.3 10.6 11.0 10.9 10.1 10.0 9.9 9.1 7.0 5.64.2 9.4 10.0 10.5 10.7 9.6 9.1 9.5 8.7 7.2 5.56.0 11.2 11.2 10.7 10.7 10.3 9.6 8.7 7.5 6.47.8 11.0 11.4 11.3 10.4 10.2 10.0 9.3 7.1 5.65.1 10.0 10.6 11.0 11.2 9.9 9.4 9.7 9.0 7.36.4 11.9 11.9 11.6 11.5 11.0 10.1 9.1 7.8 6.65.8 11.1 12.2 12.6 12.0 11.6 10.9 9.9 7.6 5.97.9 11.5 12.7 12.0 11.6 11.6 10.2 8.29.8 12.9 13.0 12.4 11.9 10.1 8.011.8 13.2 13.0 12.0 10.7 8.111.7 12.9 12.3 10.9 9.6 6.95.4 11.3 11.9 11.7 10.7 8.9 6.26.7 10.6 11.5 11.2 10.6 8.68.6 11.3 11.2 10.6 10.1 8.010.7 11.5 10.5 9.7 9.2 6.810.6 11.2 10.0 9.2 8.3 6.05.0 10.2 10.8 10.4 9.7 7.96.6 10.0 10.8 10.4 9.8 7.88.6 10.8 10.7 10.0 9.6 7.310.6 11.1 10.0 9.2 8.6 6.210.4 10.9 9.7 8.9 7.9 5.55.3 9.9 10.4 10.2 9.5 7.57.0 9.9 10.5 10.1 9.5 7.59.0 10.7 10.5 9.8 9.3 6.910.8 10.9 9.9 9.0 8.2 5.94.1 10.6 10.8 9.6 8.9 7.6 5.35.7 10.0 10.5 10.1 9.6 7.37.7 10.2 10.7 10.2 9.5 7.39.6 11.2 11.0 10.1 9.2 6.711.7 11.7 10.7 9.3 8.2 5.75.6 12.3 12.1 10.4 8.8 7.37.3 12.4 12.4 10.5 8.4 6.47.3 5.80.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.5111111111111111111222222222222220.5120.511111122222222222222222222120.20.5111111222222222222222222 Filename: D:\Gateway Interstate\Working Files\AGI\Gateway Interstate 00464771B.AGIThe Lighting Analysis, ezLayout, Energy Analysis and/or Visual Simulation ("Lighting Design") provided byRAB Lighting Inc. ("RAB") represents an anticipated prediction of lighting system performance based upon designparameters and information supplied by others. These design parameters and information provided by others havenot been field verified by RAB and therefore actual measured results may vary from the actual field conditions.RAB recommends that design parameters and other information be field verified to reduce variation.RAB neither warranties, either implied or stated with regard to actual measured light levels or energy consumptionlevels as compared to those illustrated by the Lighting Design. RAB neither warranties, either implied or stated, norrepresents the appropriateness, completeness or suitability of the Lighting Design intent as compliant with anyapplicable regulatory code requirements with the exception of those specifically stated on drawings created andsubmitted by RAB. The Lighting design is issued, in whole or in part, as advisory documents for informational purposesand is not intended for construction nor as being part of a project's construction documentation package.Scale: as notedDate:7/20/2020Filename: Gateway Interstate 00464771B.AGIPrepared For:Rouzer Group7003 West Lake StreetSuite 300Louis Park, MN 55426Tel: 952-737-6320PROJECT # 151888Drawn By: K. Gonzales, LCJob Name:Gateway InterstateLighting LayoutVersion BCASE # 00464771Scale: 1 inch= 40 Ft.DRIVE 2BACK DRIVEPARKINGPARKINGPARKINGPARKINGLOADING DOCKRETAINING WALLGRAVELGRAVELB I T U M I N O U S G R A V E L O H E OHE OHEOHEOHEOHEO H EGATEW AY BLVD.35-24135-24135-24133-26135-24125-13125-13135-24125-13135-24135-24135-24135-24133-262885.6886.1893.7885.9893.1892.9892.1892.1908.8880.3880.2897.8889.8890.2889.7889.3888.7887.7883.6879.4879.1879.7882.8899.2902.4904.1903.5900.8898.2896.3899.9907.6909.2893.35 FT. CHAIN LINK FENCEINTERSTATE HIGHW AY 35W A910BC11B12A13C1415BB16C17A1819B20B21BB22A23B2425BA26A2728BB29C3031B32BB33A34A35A3637AC38A39A4041AA42A43A44A45C460.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.10.10.10.10.10.10.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.10.10.10.10.10.10.10.10.10.10.10.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.1 0.1 0.1 0.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.1 0.2 0.2 0.2 0.2 0.2 0.3 0.3 0.3 0.3 0.3 0.3 0.3 0.3 0.3 0.3 0.3 0.3 0.3 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.20.20.20.20.20.20.20.10.10.10.10.10.10.10.10.10.10.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.2 0.2 0.2 0.3 0.3 0.3 0.4 0.4 0.4 0.5 0.5 0.5 0.5 0.5 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.3 0.3 0.3 0.3 0.3 0.3 0.3 0.3 0.30.30.30.30.20.20.20.20.20.20.20.20.10.10.10.10.10.10.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.3 0.4 0.4 0.4 0.5 0.6 0.6 0.7 0.8 0.8 0.7 0.7 0.6 0.6 0.6 0.6 0.6 0.6 0.6 0.6 0.6 0.5 0.5 0.5 0.5 0.5 0.5 0.4 0.4 0.40.40.40.40.40.40.30.30.30.30.30.30.20.20.20.20.10.10.10.10.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.3 0.4 0.5 0.5 0.5 0.6 0.6 0.7 0.8 0.9 1.0 1.0 1.0 0.9 0.9 0.8 0.8 0.8 0.8 0.8 0.9 0.9 0.8 0.8 0.7 0.7 0.6 0.6 0.6 0.7 0.7 0.70.60.60.60.50.50.50.50.50.50.40.40.40.30.30.20.20.10.10.10.10.10.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.2 0.2 0.2 0.3 0.4 0.5 0.6 0.6 0.7 1.1 1.1 1.0 0.9 0.8 0.8 0.8 0.9 0.9 0.9 0.9 0.9 0.8 0.8 0.7 0.7 0.7 0.7 0.7 0.7 0.7 0.6 0.6 0.5 0.4 0.3 0.2 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.3 0.4 0.6 0.7 0.8 0.9 0.9 0.9 1.4 1.0 0.9 0.9 0.9 1.0 0.9 0.9 0.8 0.7 0.5 0.4 0.3 0.3 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.2 0.2 0.2 0.3 0.4 0.5 0.6 0.8 0.91.30.2 0.2 0.2 0.2 0.2 0.2 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.3 0.4 0.5 0.7 0.8 1.00.4 0.5 0.4 0.3 0.2 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.4 0.4 0.5 0.7 0.8 1.0 1.9 2.1 2.20.8 1.1 1.5 1.4 0.8 0.5 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.4 0.5 0.6 0.7 0.8 1.8 1.6 1.73.1 1.8 0.5 0.2 0.1 0.1 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.3 0.4 0.5 0.7 0.8 0.8 1.3 0.8 0.8 1.8 3.3 3.7 2.5 1.3 0.8 0.7 0.7 1.0 1.8 3.5 5.71.5 2.03.1 1.1 0.4 0.2 0.1 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.4 0.5 0.6 0.8 0.9 0.9 1.0 2.51.9 2.1 1.6 0.9 0.6 0.5 0.6 0.8 1.5 3.0 5.0 5.3 3.5 1.9 1.0 2.6 2.8 1.0 1.0 3.8 1.2 0.4 0.1 0.1 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.2 0.2 0.2 0.3 0.4 0.5 0.7 0.8 1.0 5.7 3.80.4 0.4 0.5 0.6 1.1 2.5 4.1 4.3 2.8 1.4 2.7 3.8 3.8 1.6 1.2 0.8 1.1 1.9 3.2 3.5 1.1 0.3 0.1 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.3 0.4 0.5 0.7 0.9 1.0 2.5 1.93.7 1.0 0.8 0.6 0.6 0.7 0.9 1.4 2.6 3.1 1.7 0.6 0.2 0.1 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.4 0.4 0.6 0.7 0.8 1.0 1.6 0.94.8 1.0 0.8 0.6 0.5 0.5 0.5 0.7 1.1 1.9 1.3 0.7 0.3 0.1 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.4 0.5 0.6 0.7 0.8 1.5 0.9 0.53.6 1.0 0.7 0.5 0.4 0.3 0.3 0.4 0.6 0.9 0.9 0.6 0.3 0.1 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.3 0.4 0.5 0.7 0.8 0.8 1.2 0.52.1 0.9 0.7 0.5 0.3 0.3 0.3 0.3 0.4 0.5 0.7 0.6 0.4 0.2 0.1 0.10.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.4 0.5 0.6 0.8 0.9 1.0 2.51.2 0.8 0.6 0.4 0.3 0.2 0.2 0.2 0.3 0.5 0.4 0.3 0.2 0.1 0.10.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.2 0.2 0.2 0.3 0.4 0.5 0.7 0.8 1.0 5.7 3.80.9 0.8 0.6 0.4 0.3 0.2 0.3 0.3 0.5 0.6 0.5 0.4 0.3 0.2 0.1 0.10.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.3 0.4 0.5 0.7 0.9 1.0 2.5 1.90.9 0.7 0.6 0.4 0.3 0.3 0.4 0.7 0.7 0.5 0.3 0.2 0.1 0.1 0.10.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.4 0.4 0.6 0.7 0.8 1.0 1.7 0.91.1 0.7 0.6 0.4 0.3 0.4 0.8 2.3 1.3 0.8 0.5 0.3 0.2 0.1 0.1 0.10.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.4 0.5 0.6 0.7 0.8 0.9 0.50.6 0.7 0.6 0.4 0.3 0.7 2.0 1.5 0.8 0.4 0.3 0.2 0.1 0.1 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.3 0.4 0.5 0.7 0.8 0.8 1.2 0.51.3 1.0 0.8 0.6 0.4 0.4 1.0 6.0 3.0 1.6 0.8 0.4 0.2 0.1 0.1 0.1 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.4 0.5 0.6 0.8 0.9 1.0 5.8 2.52.6 1.0 0.8 0.6 0.5 0.9 3.4 2.8 1.2 0.6 0.3 0.2 0.1 0.1 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.2 0.2 0.2 0.3 0.4 0.5 0.7 0.8 1.0 5.7 3.83.57.16.95.1 2.21.51.10.90.60.71.6 3.51.80.80.40.20.10.10.10.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.3 0.4 0.5 0.7 0.9 1.0 2.5 1.92.7 4.8 5.2 4.1 2.5 2.0 1.4 1.1 0.9 0.7 0.8 2.5 2.6 0.9 0.5 0.3 0.2 0.1 0.1 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.3 0.4 0.5 0.7 0.8 1.0 0.91.5 3.0 3.5 2.9 2.2 1.8 1.3 1.0 0.9 0.7 0.9 2.8 1.5 0.7 0.3 0.2 0.1 0.1 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.4 0.5 0.6 0.7 0.8 0.9 0.50.9 1.8 2.4 2.3 1.9 1.5 1.2 1.0 0.9 0.8 1.1 1.7 0.9 0.5 0.3 0.2 0.1 0.1 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.4 0.5 0.6 0.8 0.8 1.1 1.2 0.50.71.31.71.71.61.31.21.11.00.9 1.20.90.60.40.20.10.10.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.4 0.6 0.8 0.9 0.9 2.50.7 1.3 1.5 1.5 1.4 1.3 1.3 1.3 1.2 0.9 0.8 0.5 0.4 0.2 0.2 0.1 0.1 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.4 0.6 0.8 0.9 5.6 3.80.9 1.5 1.8 1.7 1.5 1.4 1.7 1.7 1.5 0.7 0.5 0.4 0.3 0.2 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.2 0.3 0.4 0.6 0.8 1.0 1.6 2.5 1.91.52.32.62.11.81.72.32.5 0.70.50.40.30.20.10.10.10.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.2 0.3 0.4 0.5 0.7 0.9 1.1 0.92.9 3.7 3.6 2.5 2.1 2.0 3.7 1.2 0.7 0.5 0.3 0.2 0.2 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.4 0.6 0.9 0.55.0 5.5 5.0 2.9 2.3 2.3 4.4 1.4 0.7 0.4 0.3 0.2 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.3 0.4 1.2 0.52.0 6.5 7.0 5.8 3.3 2.5 2.5 4.7 1.5 0.7 0.4 0.2 0.2 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.2 0.3 0.3 0.4 0.5 0.6 2.51.6 4.5 5.1 4.5 2.7 2.1 2.1 4.8 1.7 0.7 0.4 0.2 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.2 0.3 0.3 0.4 0.5 0.6 5.6 3.80.92.63.23.02.21.81.63.8 0.80.40.20.10.10.10.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.2 0.3 0.4 0.5 0.6 0.7 2.4 1.82.81.82.12.42.41.91.51.42.86.8 0.80.50.30.20.10.10.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.4 0.6 0.7 0.8 1.2 0.75.1 3.1 2.3 2.0 1.8 1.4 1.2 1.1 1.8 4.6 4.6 0.9 0.5 0.3 0.2 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.2 0.4 0.5 0.7 0.9 1.1 1.5 0.9 0.55.33.72.61.91.41.10.90.81.12.93.12.11.40.80.40.20.10.10.10.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.4 0.6 0.8 1.1 1.5 1.14.63.52.41.71.20.90.70.60.71.21.71.41.00.60.40.20.10.10.10.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.5 0.7 0.9 1.3 1.8 1.73.82.92.01.41.00.80.60.50.50.70.90.90.70.50.30.20.10.10.10.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.2 0.3 0.5 0.8 1.1 2.53.02.31.71.20.90.60.50.40.30.40.50.50.40.30.20.20.10.10.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.2 0.4 0.6 0.8 2.62.31.81.41.00.70.50.40.30.30.20.30.30.30.20.20.10.10.10.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.4 0.6 0.8 4.9 4.61.71.41.10.80.60.50.30.30.20.20.20.20.20.10.10.10.10.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.2 0.3 0.4 0.6 0.8 2.31.61.31.10.90.70.50.40.30.20.20.10.10.10.10.10.10.10.10.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.2 0.3 0.5 0.7 0.8 1.11.21.00.80.70.60.40.30.30.20.20.10.10.10.10.10.10.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.4 0.5 0.7 0.9 0.60.90.70.60.50.40.40.30.20.20.10.10.10.10.10.10.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.4 0.6 0.8 0.40.80.70.50.50.40.30.30.20.20.10.10.10.10.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.4 0.7 0.9 0.90.9 0.9 0.8 0.8 0.8 0.8 0.8 0.8 0.8 0.9 0.9 0.9 0.6 0.5 0.4 0.4 0.3 0.3 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.1 0.1 0.1 0.1 0.2 0.3 0.5 0.8 1.0 1.10.9 0.8 0.7 0.6 0.6 0.6 0.6 0.6 0.6 0.6 0.7 0.7 0.8 1.0 1.2 1.2 0.6 0.4 0.3 0.3 0.3 0.2 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.1 0.1 0.1 0.2 0.2 0.3 0.5 0.8 1.1 1.70.80.70.60.50.50.50.40.40.50.50.50.60.70.81.21.9 2.20.70.40.30.30.20.20.20.10.10.10.10.10.10.10.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.4 0.6 0.9 2.20.7 0.6 0.5 0.5 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.5 0.5 0.7 0.9 1.6 2.9 0.9 0.5 0.3 0.2 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.1 0.1 0.1 0.2 0.3 0.4 0.6 0.9 6.4 2.10.8 0.7 0.6 0.5 0.4 0.4 0.3 0.3 0.3 0.3 0.3 0.4 0.4 0.5 0.5 0.7 1.0 2.8 1.0 0.4 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.1 0.1 0.1 0.1 0.2 0.3 0.5 0.6 0.9 1.1 1.6 3.90.7 0.6 0.5 0.4 0.4 0.3 0.3 0.3 0.3 0.3 0.3 0.3 0.4 0.4 0.5 0.6 0.8 2.4 0.7 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.1 0.1 0.1 0.2 0.2 0.3 0.5 0.7 0.9 2.9 2.7 1.90.7 0.6 0.5 0.4 0.4 0.3 0.3 0.3 0.3 0.3 0.3 0.3 0.4 0.4 0.5 0.6 0.6 1.3 0.7 0.3 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.1 0.1 0.1 0.2 0.3 0.4 0.5 0.7 0.9 0.80.8 0.7 0.6 0.5 0.4 0.3 0.3 0.3 0.3 0.2 0.2 0.3 0.3 0.4 0.4 0.5 0.6 0.7 0.6 0.4 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.1 0.1 0.1 0.2 0.3 0.4 0.6 0.7 0.50.8 0.6 0.5 0.4 0.4 0.3 0.3 0.3 0.2 0.2 0.2 0.3 0.3 0.3 0.5 0.6 0.9 1.0 0.3 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.1 0.1 0.1 0.2 0.3 0.4 0.6 0.8 0.80.7 0.6 0.5 0.4 0.4 0.3 0.3 0.3 0.2 0.2 0.2 0.3 0.3 0.3 0.4 0.7 1.1 1.6 0.2 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.1 0.1 0.1 0.2 0.3 0.5 0.7 0.9 0.80.9 0.7 0.6 0.5 0.4 0.3 0.3 0.3 0.3 0.2 0.2 0.3 0.3 0.3 0.4 0.5 0.7 1.1 0.8 0.3 0.1 0.1 0.1 0.1 0.0 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.1 0.1 0.1 0.2 0.2 0.3 0.5 0.8 1.0 1.10.9 0.7 0.6 0.5 0.4 0.3 0.3 0.3 0.3 0.2 0.2 0.3 0.3 0.3 0.4 0.5 0.8 1.3 2.1 0.5 0.2 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.1 0.1 0.1 0.2 0.2 0.4 0.6 0.9 1.1 1.60.8 0.6 0.5 0.4 0.3 0.3 0.3 0.3 0.2 0.3 0.3 0.3 0.3 0.4 0.5 0.8 1.4 3.1 0.9 0.3 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.1 0.1 0.1 0.2 0.3 0.4 0.6 0.9 5.8 1.90.8 0.7 0.5 0.4 0.3 0.3 0.3 0.3 0.3 0.3 0.3 0.3 0.4 0.4 0.5 0.7 1.1 4.4 1.2 0.4 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.1 0.1 0.1 0.2 0.3 0.4 0.7 0.9 5.51.0 0.7 0.6 0.4 0.4 0.3 0.3 0.3 0.3 0.3 0.3 0.3 0.4 0.4 0.5 0.6 0.8 3.7 0.7 0.4 0.2 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.1 0.1 0.1 0.2 0.2 0.3 0.5 0.7 0.9 3.20.8 0.6 0.5 0.4 0.3 0.3 0.3 0.3 0.3 0.3 0.4 0.5 0.5 0.6 0.7 2.1 0.9 0.2 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.1 0.1 0.1 0.2 0.2 0.3 0.5 0.7 0.9 1.4 1.40.8 0.6 0.5 0.4 0.3 0.3 0.3 0.3 0.3 0.4 0.5 0.7 1.0 1.0 0.6 0.3 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.1 0.1 0.1 0.2 0.3 0.4 0.5 0.7 1.4 0.60.7 0.5 0.4 0.4 0.4 0.4 0.4 0.4 0.5 0.6 0.9 1.4 0.2 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.1 0.1 0.1 0.2 0.3 0.4 0.6 0.8 0.40.9 0.7 0.5 0.4 0.4 0.4 0.4 0.5 0.6 0.8 1.1 2.0 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.1 0.1 0.1 0.2 0.3 0.4 0.6 0.8 0.80.8 0.6 0.5 0.5 0.4 0.5 0.5 0.7 1.1 1.7 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.1 0.1 0.1 0.2 0.3 0.5 0.7 0.9 0.80.8 0.6 0.5 0.5 0.5 0.6 0.7 1.0 1.7 0.6 0.2 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.1 0.1 0.1 0.2 0.3 0.5 0.8 1.0 1.00.8 0.7 0.6 0.6 0.6 0.7 0.9 5.1 1.8 0.7 0.3 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.1 0.1 0.1 0.2 0.3 0.6 0.8 1.50.8 0.8 0.7 0.7 0.8 0.8 2.9 0.6 0.4 0.2 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.1 0.1 0.1 0.2 0.4 0.6 0.8 5.91.0 1.0 1.1 1.1 2.1 1.2 0.7 0.2 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.60.70.80.91.01.11.21.21.11.00.80.91.01.21.51.61.81.71.51.4 1.11.01.11.21.31.41.31.21.11.00.90.90.91.01.01.0 1.11.11.31.72.02.22.52.32.11.81.51.31.31.41.71.82.01.91.71.51.21.11.11.21.31.51.61.51.31.21.11.01.01.01.11.11.11.11.21.41.51.61.51.51.72.12.53.13.73.32.62.21.81.41.51.92.12.42.62.42.21.91.61.31.31.61.82.02.22.11.81.61.31.21.21.31.51.61.71.61.4 1.1 0.9 0.7 0.6 0.5 0.4 0.3 0.3 0.3 0.3 0.31.3 1.6 1.9 2.1 2.1 2.1 1.9 2.5 3.4 4.9 6.3 5.4 3.8 2.7 2.0 1.5 1.7 2.2 2.8 3.7 4.5 3.9 2.9 2.3 1.8 1.5 1.6 2.0 2.2 2.6 2.9 2.6 2.3 2.0 1.6 1.4 1.4 1.7 2.0 2.1 2.4 2.1 1.9 1.5 1.2 1.0 0.8 0.6 0.5 0.4 0.4 0.4 0.4 0.51.01.21.62.12.52.73.02.8 2.13.14.97.05.73.82.41.71.41.62.33.34.96.75.73.92.71.91.51.72.43.04.25.14.43.22.51.91.51.62.12.42.93.32.8 2.3 1.9 1.6 1.3 1.1 0.9 0.7 0.6 0.5 0.5 0.6 0.80.91.11.52.02.43.64.84.73.32.1 1.11.01.11.73.04.97.25.63.62.2 1.31.52.23.25.06.85.63.72.61.8 1.72.43.34.75.94.93.42.52.01.71.51.21.0 0.8 0.7 0.7 0.7 0.91.1 1.3 1.7 2.1 3.0 4.9 6.8 5.8 3.92.8 4.8 7.1 5.3 3.4 2.0 1.4 1.4 2.1 3.2 5.1 7.0 5.5 3.5 2.5 2.3 2.3 1.8 1.4 0.7 0.7 0.91.0 1.1 1.2 1.3 1.7 2.3 3.2 4.3 6.1 6.72.9 2.0 2.8 3.1 2.2 1.8 0.8 0.7 0.71.2 1.4 1.5 1.6 1.6 1.5 1.6 2.0 2.4 3.24.7 4.3 2.6 2.01.31.71.92.12.12.11.71.51.41.46.4 5.4 3.0 2.2 1.6 1.11.0 1.3 1.6 2.1 2.6 2.7 3.0 2.7 2.0 0.95.7 6.0 5.1 3.0 2.3 1.6 1.10.9 1.1 1.5 2.0 2.4 3.6 4.8 4.7 3.2 2.03.6 4.2 3.8 2.5 2.0 1.4 1.11.0 1.1 1.3 1.7 2.1 3.0 4.9 6.8 5.8 3.92.1 2.8 2.7 2.1 1.7 1.31.0 1.1 1.2 1.2 1.3 1.7 2.3 3.2 4.4 6.1 6.61.3 2.0 2.1 1.8 1.4 1.11.2 1.4 1.6 1.6 1.6 1.5 1.6 2.0 2.4 3.21.1 1.5 1.5 1.4 1.2 1.01.7 1.9 2.1 2.1 2.1 1.7 1.5 1.4 1.41.2 1.5 1.5 1.4 1.2 1.01.0 1.3 1.6 2.1 2.6 2.7 3.0 2.7 2.0 1.31.7 2.2 2.0 1.7 1.3 1.00.9 1.1 1.5 2.0 2.4 3.6 4.8 4.7 3.2 2.02.7 3.1 2.5 2.0 1.5 1.11.0 1.1 1.3 1.7 2.1 3.0 4.9 5.8 3.94.6 4.5 3.1 2.2 1.7 1.21.0 1.1 1.2 1.2 1.3 1.7 2.3 3.2 4.43.7 2.4 1.31.2 1.4 1.6 1.6 1.6 1.5 1.6 2.0 2.4 3.21.3 1.7 1.9 2.1 2.1 2.1 1.7 1.5 1.4 1.41.0 1.2 1.6 2.1 2.6 2.7 3.0 2.7 2.0 1.3 0.91.1 1.5 2.0 2.4 3.6 4.8 4.7 3.2 2.01.0 1.1 1.7 2.1 3.0 4.9 6.8 5.8 3.91.0 1.1 1.2 1.2 1.3 1.7 2.3 3.2 4.4 6.1 6.61.2 1.4 1.6 1.6 1.6 1.5 1.6 2.4 3.21.2 1.6 1.9 2.1 2.1 2.1 1.7 1.5 1.40.8 1.1 1.5 2.1 2.6 2.7 3.0 2.7 2.0 1.30.7 0.9 1.3 1.9 2.3 3.6 4.8 4.6 3.2 2.00.7 1.0 1.5 2.0 2.9 4.9 6.8 5.8 4.00.7 1.0 1.5 2.1 3.0 4.3 6.10.8 1.0 1.3 1.8 2.2 3.10.9 1.0 1.1 1.2 1.2 1.21.3 1.41.8 2.2 2.01.9 2.3 3.1 2.9 2.11.2 1.7 2.2 3.1 4.8 4.71.3 1.9 2.6 4.1 6.6 6.71.3 1.8 2.4 3.8 5.6 6.01.3 1.7 2.2 3.10.9 1.2 1.5 2.0 2.5 2.5 2.00.9 1.1 1.4 1.6 1.8 1.71.0 1.2 1.4 1.5 1.5 1.31.1 1.4 1.7 1.8 1.7 1.21.0 1.4 1.8 2.1 2.5 2.3 1.51.2 1.6 2.1 2.6 3.6 3.31.3 1.9 2.4 3.6 5.3 5.11.4 2.0 2.6 4.4 6.7 7.21.3 1.9 2.4 3.9 5.2 5.51.0 1.3 1.7 2.2 3.0 3.30.9 1.2 1.5 1.9 2.4 2.31.0 1.1 1.4 1.6 1.7 1.51.0 1.2 1.4 1.5 1.5 1.21.2 1.5 1.8 2.0 1.8 1.21.1 1.4 1.9 2.2 2.7 2.4 1.51.2 1.7 2.2 2.9 4.0 3.61.4 2.0 2.6 4.0 5.8 5.51.4 2.0 2.6 4.5 6.6 7.31.4 1.9 2.4 3.9 4.8 4.91.7 2.2 2.9 3.1 2.81.0 1.2 1.5 1.9 2.31.0 1.2 1.4 1.5 1.6 1.31.1 1.3 1.5 1.6 1.5 1.11.0 1.3 1.6 2.0 2.2 1.8 1.11.1 1.5 2.0 2.4 2.9 2.51.3 1.8 2.3 3.3 4.4 4.01.4 2.1 2.7 4.5 6.2 5.91.4 2.41.5 2.6 4.4 5.91.5 2.5 3.9 5.9 9.0 9.23.4 4.3 5.9 7.3 6.03.9 4.3 4.53.0 2.8 2.31.5 1.6 1.40.7 0.8 0.80.5 0.50.6 0.6 0.60.8 1.2 0.92.7 2.0 1.33.4 4.3 2.66.3 5.2 3.29.1 8.3 4.68.6 6.4 4.15.1 6.2 4.52.5 4.4 3.92.1 2.6 2.51.0 1.4 1.50.9 1.0 1.01.1 0.9 0.81.9 1.5 1.02.8 2.1 1.35.3 4.0 2.96.9 5.3 3.89.3 6.6 4.17.4 4.4 2.46.7 4.3 2.4 1.13.7 2.35.7 5.5 5.6 5.6 5.4 5.3 5.5 5.9 6.14.7 4.2 4.1 4.2 4.2 4.0 3.9 4.0 4.2 4.2 4.1 4.1 4.3 4.5 4.5 4.4 4.4 4.7 4.9 5.0 4.7 4.6 4.6 4.5 4.2 3.45.7 4.6 3.8 3.4 3.3 3.3 3.3 3.1 3.0 3.0 3.1 3.1 3.0 3.0 3.1 3.3 3.2 3.1 3.2 3.3 3.5 3.5 3.4 3.2 3.2 3.1 2.9 2.45.2 4.4 3.7 3.2 2.9 2.8 2.8 2.7 2.6 2.5 2.5 2.5 2.5 2.4 2.4 2.5 2.5 2.5 2.4 2.4 2.6 2.7 2.7 2.6 2.5 2.5 2.4 2.24.5 3.8 3.4 3.1 2.8 2.5 2.4 2.3 2.2 2.1 2.0 2.0 2.0 2.0 1.9 1.9 2.0 2.0 2.0 2.0 2.0 2.1 2.2 2.2 2.2 2.1 2.0 1.8 1.65.4 4.2 3.4 3.0 2.8 2.6 2.3 2.1 2.0 1.9 1.8 1.7 1.6 1.6 1.7 1.6 1.6 1.6 1.6 1.7 1.7 1.7 1.7 1.9 2.0 2.0 2.0 1.9 1.7 1.5 1.25.0 4.1 3.4 2.8 2.4 2.2 2.1 1.9 1.8 1.6 1.4 1.3 1.3 1.2 1.2 1.2 1.2 1.2 1.2 1.3 1.3 1.3 1.4 1.5 1.7 2.0 2.1 2.1 1.9 1.6 1.35.3 4.3 3.7 3.2 2.8 2.4 2.1 1.9 1.7 1.5 1.4 1.2 1.1 1.0 0.9 0.9 0.9 1.0 1.0 1.1 1.2 1.4 1.8 2.4 2.7 2.5 2.1 1.65.4 4.2 3.3 2.8 2.6 2.3 2.0 1.8 1.5 1.3 1.2 1.01.1 1.5 2.5 3.7 3.8 3.5 2.95.0 4.1 3.3 2.7 2.3 2.1 1.9 1.7 1.5 1.3 1.02.4 3.9 4.7 5.6 5.15.4 4.4 3.7 3.2 2.7 2.4 2.0 1.8 1.6 1.4 1.2 1.03.8 5.1 7.4 7.85.5 4.3 3.4 2.9 2.6 2.3 2.0 1.8 1.5 1.3 1.1 0.93.0 4.4 6.8 9.95.2 4.2 3.4 2.8 2.4 2.1 1.9 1.7 1.5 1.2 1.0 0.81.8 2.9 4.9 6.25.8 4.7 3.9 3.4 2.9 2.5 2.1 1.8 1.6 1.4 1.2 1.01.1 1.6 2.7 4.06.1 4.8 3.8 3.2 2.8 2.5 2.1 1.8 1.5 1.3 1.1 0.90.7 0.8 0.9 1.2 1.66.2 5.0 4.0 3.3 2.8 2.4 2.1 1.8 1.6 1.3 1.0 0.90.8 0.8 0.7 0.7 0.76.2 4.9 4.1 3.5 3.0 2.5 2.1 1.8 1.6 1.3 1.01.3 1.2 1.0 0.7 0.55.3 4.1 3.5 3.1 2.7 2.3 1.8 1.5 1.2 1.02.2 2.2 1.9 1.4 0.84.9 3.7 3.2 2.8 2.4 2.0 1.6 1.3 1.03.03.73.63.32.14.7 3.6 3.0 2.6 2.2 1.8 1.4 1.13.3 4.3 5.3 5.8 4.16.0 4.4 3.4 2.8 2.4 2.0 1.5 1.21.83.24.36.58.85.2 3.9 3.1 2.6 2.1 1.7 1.3 1.01.3 2.2 3.6 5.6 8.34.6 3.4 2.7 2.3 1.9 1.5 1.20.9 1.3 2.1 3.6 5.4 4.54.3 3.2 2.6 2.1 1.7 1.3 1.00.9 1.0 1.2 1.8 3.1 2.64.1 3.1 2.5 2.0 1.6 1.2 0.91.3 1.2 1.1 0.9 0.9 1.0 0.9 0.65.3 3.8 2.9 2.4 1.9 1.6 1.22.4 2.2 1.7 1.3 0.8 0.5 0.4 0.24.7 3.4 2.7 2.2 1.8 1.5 1.1 2.9 3.7 3.9 3.5 2.8 1.5 0.6 0.3 0.24.3 3.1 2.4 2.0 1.7 1.3 1.0 3.5 4.4 5.4 6.1 5.1 3.1 0.9 0.34.0 3.0 2.3 1.9 1.6 1.2 1.0 1.9 3.2 4.4 6.8 9.7 8.25.5 3.9 2.9 2.3 1.9 1.6 1.2 1.0 1.0 1.4 2.1 3.5 5.7 7.6 6.75.0 3.6 2.8 2.3 1.9 1.6 1.3 0.9 1.1 1.4 2.0 3.5 3.94.8 6.1 5.7 5.0 4.87.2 8.4 10.2 11.4 11.1 10.5 9.8 10.6 11.4 10.7 10.0 9.1 8.8 8.1 7.0 6.1 5.6 4.8 4.3 3.7 3.25.5 9.8 9.6 10.1 10.6 11.3 11.3 10.9 10.9 11.0 11.6 11.5 11.2 11.1 11.3 11.8 11.0 9.9 10.0 10.7 11.3 10.5 9.4 9.4 9.9 10.7 9.9 9.1 7.8 4.76.7 11.6 11.3 11.0 10.9 10.9 10.5 10.4 10.9 10.8 10.7 10.5 10.8 11.4 11.4 11.0 11.1 10.8 10.7 10.5 10.7 10.8 10.5 10.3 10.4 10.9 11.3 11.6 11.5 10.6 7.17.9 11.1 11.5 11.8 11.3 11.2 11.0 10.4 10.2 10.5 10.3 9.9 9.4 10.0 10.6 10.6 9.7 9.3 10.1 10.2 10.1 9.4 9.4 10.0 10.3 10.4 10.2 10.5 11.2 11.6 10.3 7.24.4 9.5 10.2 10.8 11.0 10.2 9.9 10.2 9.4 8.7 8.5 9.0 9.1 8.6 8.6 9.1 9.6 9.7 9.2 9.0 9.5 9.7 9.6 9.0 8.8 9.6 9.7 9.7 9.2 8.7 8.9 8.9 7.9 5.95.9 11.1 11.1 10.8 10.8 10.5 9.9 9.2 8.0 6.9 6.4 6.4 6.4 6.1 6.0 6.4 7.0 7.0 6.6 6.6 7.1 7.7 7.4 7.1 7.2 7.9 8.4 8.3 7.9 7.8 7.7 7.0 6.17.4 10.7 11.2 11.1 10.2 10.2 10.0 9.4 7.4 5.95.4 5.8 5.7 5.4 5.3 5.3 5.2 4.54.0 9.3 9.9 10.5 10.8 9.6 9.2 9.6 9.0 7.4 5.85.6 10.9 10.9 10.5 10.6 10.3 9.5 8.8 7.6 6.57.2 10.4 11.0 10.9 10.1 10.0 9.9 9.2 7.1 5.64.1 9.2 9.8 10.3 10.6 9.5 9.0 9.5 8.8 7.2 5.65.7 10.9 10.9 10.5 10.5 10.2 9.4 8.7 7.5 6.37.3 10.6 11.0 10.9 10.1 10.0 9.9 9.1 7.0 5.64.2 9.4 10.0 10.5 10.7 9.6 9.1 9.5 8.7 7.2 5.56.0 11.2 11.2 10.7 10.7 10.3 9.6 8.7 7.5 6.47.8 11.0 11.4 11.3 10.4 10.2 10.0 9.3 7.1 5.65.1 10.0 10.6 11.0 11.2 9.9 9.4 9.7 9.0 7.36.4 11.9 11.9 11.6 11.5 11.0 10.1 9.1 7.8 6.65.8 11.1 12.2 12.6 12.0 11.6 10.9 9.9 7.6 5.97.9 11.5 12.7 12.0 11.6 11.6 10.2 8.29.8 12.9 13.0 12.4 11.9 10.1 8.011.8 13.2 13.0 12.0 10.7 8.111.7 12.9 12.3 10.9 9.6 6.95.4 11.3 11.9 11.7 10.7 8.9 6.26.7 10.6 11.5 11.2 10.6 8.68.6 11.3 11.2 10.6 10.1 8.010.7 11.5 10.5 9.7 9.2 6.810.6 11.2 10.0 9.2 8.3 6.05.0 10.2 10.8 10.4 9.7 7.96.6 10.0 10.8 10.4 9.8 7.88.6 10.8 10.7 10.0 9.6 7.310.6 11.1 10.0 9.2 8.6 6.210.4 10.9 9.7 8.9 7.9 5.55.3 9.9 10.4 10.2 9.5 7.57.0 9.9 10.5 10.1 9.5 7.59.0 10.7 10.5 9.8 9.3 6.910.8 10.9 9.9 9.0 8.2 5.90.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.5111111111111111111111222222222220.50.511111111222222222222222222222222222211220.20.511111222222222222222 75$)),&,03$&7$1$/<6,6 '5$)7 1(&,: ,*$7(:$<%/9' $5'(1+,//60,11(627$ Prepared for: 6FDQQHOO3URSHUWLHV *URYH/DQH(DVW6XLWH :D\]DWD01 Prepared By: .LPOH\+RUQDQG$VVRFLDWHV,QF 1(XVWLV6WUHHW6XLWH 6W3DXO01 $35,/ Attachment D NEC I-35W & I-694 – Gateway Blvd – Arden Hills Traffic Impact Analysis Ň April 2020 75$)),&,03$&7$1$/<6,6 '5$)7 1(&,: ,*$7(:$<%/9' $5'(1+,//60,11(627$ REPORT CERTIFICATION , KHUHE\ FHUWLI\ WKDW WKLV UHSRUW ZDV SUHSDUHG E\ PH RU XQGHU P\ GLUHFW VXSHUYLVLRQDQGWKDW,DPDGXO\/LFHQVHG3URIHVVLRQDO(QJLQHHUXQGHUWKH ODZVRIWKH6WDWHRI0LQQHVRWD BBBBBBBBBBBBBBBBBBBBBBBBBB$SULO 0RUJDQ+R[VLH3( 'DWH /LFHQVH1R 3 NEC I-35W & I-694 – Gateway Blvd – Arden Hills Traffic Impact Analysis Ň April 2020 7$%/(2)&217(176 ,1752'8&7,21 (;,67,1*52$':$<&21',7,216 Existing Roadways ................................................................................................................................. 4 Existing Traffic Volumes ........................................................................................................................ 5 Background Growth and Committed Traffic........................................................................................... 5 PedestrianS And Bicycles ...................................................................................................................... 5 352326(''(9(/230(17 Site Trip Generation ............................................................................................................................... 6 Site Trip Distribution and Assignment .................................................................................................... 6 &$3$&,7<$1$/<6,6 Existing Year (2020) Conditions ............................................................................................................ 8 Opening Year No-Build (2021) Conditions ............................................................................................ 8 Opening Year Build (2021) Conditions .................................................................................................. 9 Horizon Year No-Build (2040) Conditions ............................................................................................ 11 Horizon Year Build (2040) Conditions ................................................................................................. 11 &21&/86,216$1'5(&200(1'$7,216 $33(1',; $33(1',; $ ([KLELWV % 7XUQLQJ0RYHPHQW&RXQWV & 6LWH/D\RXW([KLELW ' 6LP7UDIILF$QDO\VLV5HVXOWV NEC I-35W & I-694 – Gateway Blvd – Arden Hills Traffic Impact Analysis Ň April 2020 ,1752'8&7,21 6FDQQHOO3URSHUWLHVLVSURSRVLQJDQDSSUR[LPDWHO\VTXDUHIRRWOLJKWLQGXVWULDOEXLOGLQJRQ*DWHZD\ %RXOHYDUGLQ$UGHQ+LOOV01)RUWKHSXUSRVHRIWKLVVWXG\WKHDVVXPHGEUHDNGRZQRIWKHODQGXVHVZLWKLQ WKHEXLOGLQJLQFOXGHVVTXDUHIHHWWRIZDUHKRXVHDQGVTXDUHIHHWRIRIILFH VSDFH7KHVLWHLVFXUUHQWO\XQGHYHORSHGDQGLVDSSUR[LPDWHO\DFUHV([KLELWVKRZVWKHSURSRVHG SURMHFWORFDWLRQ$OOH[KLELWVDUHLQFOXGHGLQ$SSHQGL[$ (;,67,1*52$':$<&21',7,216 7KH SURSRVHG GHYHORSPHQW LV ORFDWHG RQ *DWHZD\ %RXOHYDUG VRXWK RI +LJKZD\ LQ $UGHQ +LOOV 0LQQHVRWD7KHSURSRVHGVLWHLVRQDQXQGHYHORSHGSDUFHORQWKHVRXWKVLGHRI*DWHZD\%RXOHYDUG1RUWK RIWKHVLWHLVLQGXVWULDOODQGXVHV7KHIROORZLQJLQWHUVHFWLRQVZLOOEHLQFOXGHGLQWKHWUDIILFFDSDFLW\DQDO\VLV x+LJKZD\DQG5RXQG/DNH5RDG:HVW$UGHQ0DQRU:D\ x*DWHZD\%RXOHYDUGDQG'ULYHZD\$ x*DWHZD\%RXOHYDUGDQG'ULYHZD\% x*DWHZD\%RXOHYDUGDQG'ULYHZD\& 7KHVWXG\LQWHUVHFWLRQVOLVWHGDERYHDUHVKRZQLQ([KLELW (;,67,1*52$':$<6 $FFHVVWRWKHGHYHORSPHQWZLOOEHRQ*DWHZD\%RXOHYDUG:DUHKRXVHHPSOR\HHVDUHDQWLFLSDWHGWRXVH 'ULYHZD\$DQG'ULYHZD\&WRDFFHVVWKHSDUNLQJDUHD:DUHKRXVHGHOLYHU\WUXFNVDUHDQWLFLSDWHGWRXVH 'ULYHZD\%WRDFFHVVWKHGRFNGRRUV$OOWUDIILFLVDQWLFLSDWHGWRDFFHVVWKHVLWHYLD+LJKZD\5RXQG /DNH5RDG:HVWDQG*DWHZD\%RXOHYDUG)ROORZLQJSURYLGHVDGHWDLOHGGHVFULSWLRQRI+LJKZD\5RXQG /DNH5RDG:HVWDQG*DWHZD\%RXOHYDUG +LJKZD\LVDQHDVWZHVWIRXUODQHGLYLGHG&RXQW\6WDWH$LG+LJKZD\ZLWKWZRODQHVLQHDFK GLUHFWLRQDQGDFHQWHUPHGLDQ+LJKZD\VWDUWVDW2OG+LJKZD\DQGFURVVHV,:DQG86 +LJKZD\ DQG FRQWLQXHV HDVW WR ,( 7KH 0Q'27 )XQFWLRQDO &ODVVLILFDWLRQ 6\VWHP 0DS FODVVLILHV+LJKZD\DVD0LQRU$UWHULDO5RDGZD\7KH0Q'277UDIILF0DSSLQJ$SSOLFDWLRQ UHSRUWVDQDQQXDODYHUDJHGDLO\WUDIILF$$'7RIYHKLFOHVSHUGD\YSGLQRQ+LJKZD\ 7KHSRVWHGVSHHGOLPLWRQ+LJKZD\LVPLOHVSHUKRXUPSK 5RXQG/DNH5RDG:HVWLVDWKUHHODQHQRUWKVRXWKURDGZD\ZLWKRQHODQHLQHDFKGLUHFWLRQDQG DWZRZD\OHIWWXUQODQH5RXQG/DNH5RDG:HVWLVFODVVLILHGDVD/RFDO5RDGDFFRUGLQJWRWKH 0Q'27)XQFWLRQDO&ODVVLILFDWLRQ6\VWHP0DS7KH0Q'277UDIILF0DSSLQJ$SSOLFDWLRQUHSRUWV WKH$$'7RQ5RXQG/DNH5RDG:HVWDVYSGLQ7KHFXUUHQWSRVWHGVSHHGOLPLWRQ 5RXQG/DNH5RDGLVPSK *DWHZD\%RXOHYDUGLVDWZRODQHHDVWZHVWURDGZD\WKDWEHJLQVZKHQ5RXQG/DNH5RDG:HVW HQGV *DWHZD\ %RXOHYDUG LV FODVVLILHG DV D /RFDO 5RDG DFFRUGLQJ WR WKH 0Q'27 )XQFWLRQDO &ODVVLILFDWLRQ6\VWHP0DS7KH0Q'277UDIILF0DSSLQJ$SSOLFDWLRQUHSRUWVWKH$$'7RQ*DWHZD\ %RXOHYDUGDVYSGLQ7KHUHLVQRSRVWHGVSHHGOLPLWRQ*DWHZD\%RXOHYDUGVRWKHVSHHG OLPLWLVPSK ([KLELWSURYLGHVWKHH[LVWLQJLQWHUVHFWLRQJHRPHWU\DQGLQWHUVHFWLRQFRQWUROIRUWKHVWXG\LQWHUVHFWLRQV 5 NEC I-35W & I-694 – Gateway Blvd – Arden Hills Traffic Impact Analysis Ň April 2020 (;,67,1*75$)),&92/80(6 7RDQDO\]HWKHWUDIILFRSHUDWLRQVDWWKHVWXG\LQWHUVHFWLRQZHHNGD\SHDNSHULRGWXUQLQJPRYHPHQWFRXQWV ZHUHFROOHFWHGRQ:HGQHVGD\0DUFK3HDNSHULRGWXUQLQJPRYHPHQWFRXQWVZHUHDOVRFROOHFWHG DWWKHLQWHUVHFWLRQRI*DWHZD\%RXOHYDUGDQG6SDFH&HQWHU'ULYHZD\WRXQGHUVWDQGWKHWUDIILFYROXPHV QHDUWKHSURSRVHGVLWHGULYHZD\V([KLELWSURYLGHVDVXPPDU\RIWKHZHHNGD\$0DQG30SHDNKRXU WXUQLQJWUDIILFYROXPHV7KHWXUQLQJPRYHPHQWFRXQWGDWDLVSURYLGHGLQ$SSHQGL[% 7KHQHWZRUN$0SHDNKRXUZDVGHWHUPLQHGWREH$0WR$0DQGWKHQHWZRUN30SHDNKRXUZDV GHWHUPLQHGWREH30WR307KHLQWHUVHFWLRQRI+LJKZD\DQG5RXQG/DNH5RDG:HVW$UGHQ 0DQRU:D\KDGSHDNKRXUIDFWRUVRIDQGIRUWKH$0DQG30SHDNKRXUVUHVSHFWLYHO\7KHSHDN KRXUIDFWRUIRUWKHLQWHUVHFWLRQRI*DWHZD\%RXOHYDUGDQGWKH6SDFH&HQWHU'ULYHZD\ZDVIRUWKH$0 SHDNKRXUDQGIRUWKH30SHDNKRXU7KLVSHDNKRXUIDFWRUZDVXVHGIRUDOOWKHVLWHGULYHZD\ LQWHUVHFWLRQV *DWHZD\ %RXOHYDUG DQG WKH 6SDFH &HQWHU 'ULYHZD\LQWHUVHFWLRQ LV QRW LQFOXGHG LQ WKH UHSRUWHGFDSDFLW\DQDO\VLV,WLVLQFOXGHGLQWKHH[KLELWVLQ$SSHQGL[$DVWKHWUDIILFFRXQWVFROOHFWHGDWWKLV ORFDWLRQZHUHXVHGDVDUHIHUHQFHIRUWKHVLWHGULYHZD\LQWHUVHFWLRQV %$&.*5281'*52:7+$1'&200,77('75$)),& +LVWRULFDO$$'7GDWDSURYLGHGE\0Q'27¶V,QWHUDFWLYH7UDIILF'DWD$SSOLFDWLRQZDVUHYLHZHGWRGHYHORSD EDFNJURXQGJURZWKUDWHWRGHYHORSIRUHFDVWSHDNKRXUYROXPHVDWWKHVWXG\LQWHUVHFWLRQVIRU2SHQLQJ<HDU DQG+RUL]RQ<HDU7KHSURSRVHGGHYHORSPHQWLVDQWLFLSDWHGWREHFRQVWUXFWHGDQGRSHQE\ 7DEOHSURYLGHVDVXPPDU\RIWKH$$'7LQIRUPDWLRQDQGWKHUHVXOWDQWJURZWKUDWH%DVHGRQWKHKLVWRULF JURZWKUDWHVDDQQXDOJURZWKUDWHZDVDSSOLHGWRWKH([LVWLQJWUDIILFYROXPHVWRGHYHORSWKH 2SHQLQJ<HDU1R%XLOGDQG+RUL]RQ<HDU1R%XLOGWXUQLQJPRYHPHQWYROXPHV Table 1 – Annual Growth Rate Calculation ([KLELWVKRZVWKH2SHQLQJ<HDU1R%XLOGWXUQLQJPRYHPHQWYROXPHVDQG([KLELWVKRZVWKH +RUL]RQ<HDU1R%XLOGWXUQLQJPRYHPHQWYROXPHV 3('(675,$16$1'%,&<&/(6 7KHUHDUHH[LVWLQJVLGHZDONVRQERWKVLGHVRI+LJKZD\DQGRQWKHHDVWVLGHRI5RXQG/DNH5RDG:HVW 7KHUH DUH PDUNHG FURVVZDONV DQG DFFHVVLEOH SHGHVWULDQ SXVKEXWWRQV IRU DOO IRXU FURVVZDONV DW WKH LQWHUVHFWLRQ RI +LJKZD\ DQG 5RXQG /DNH 5RDG :HVW$UGHQ 0DQRU :D\ 7KHUH DUH QR VLGHZDONV DGMDFHQWWRWKHVLWH :LWKLQWKHSURSRVHGVLWHWKHUHLVDPDUNHGFURVVZDONLQWKHSDUNLQJORWDVZHOODVDFFHVVLEOHFXUEUDPSV WRDFFHVVWKHDFFHVVLEOHSDUNLQJRQVLWH Street Segment Most Recent AADT Comparison AADT Annual Growth Rate Volume Year Volume Year Highway 96, East of I-35W in Arden Hills 13,000 2015 14,072 2014 -7.6% Round Lake Road W, South of Highway 96 2,600 2017 2,500 2013 1.0% NEC I-35W & I-694 – Gateway Blvd – Arden Hills Traffic Impact Analysis Ň April 2020 352326(''(9(/230(17 6,7(75,3*(1(5$7,21 7KH WULSJHQHUDWLQJ SRWHQWLDO RI WKH SURSRVHG GHYHORSPHQW ZDV FDOFXODWHG XVLQJ WKH ,QVWLWXWH RI 7UDQVSRUWDWLRQ(QJLQHHUV,7(Trip Generation Manual, Tenth Edition6WDQGDUG,7(WULSUDWHVZHUHXVHG WRGHYHORSWKHWRWDOWULSVJHQHUDWHGE\WKHVLWH 7KHDYHUDJHUDWHIRU,7(/DQG8VH&RGH:DUHKRXVLQJDQG,7(/DQG8VH&RGH*HQHUDO2IILFH %XLOGLQJZHUHXVHGWRFDOFXODWHWKHWULSJHQHUDWLRQSRWHQWLDORIWKHVLWH7DEOHSURYLGHVDVXPPDU\RIWKH QXPEHURIWULSVDQWLFLSDWHGWREHJHQHUDWHGGXULQJWKHZHHNGD\$0DQG30SHDNKRXUV$VVKRZQWKHVLWH LVDQWLFLSDWHGWRJHQHUDWHQHZWULSVGXULQJWKH$0SHDNKRXUHQWHULQJH[LWLQJDQGQHZWULSV GXULQJWKH30SHDNKRXUHQWHULQJH[LWLQJ Table 2 – Site Trip Generation )RUWKLVDQDO\VLVLWZDVDVVXPHGWKDWDOOVLWHWULSVZLOOEHYHKLFOHWULSV7KHUHZDVQRPRGHVSOLWUHGXFWLRQ IRUWULSVYLDWUDQVLWELNHRUZDONLQJ 6,7(75,3',675,%87,21$1'$66,*10(17 7KHVLWHWULSVZHUHGLVWULEXWHGWRWKHDGMDFHQWURDGZD\VEDVHGRQWKHFXUUHQWWUDIILFSDWWHUQVLQWKHDUHDDQG DJHQHUDODVVHVVPHQWRIWKHPDMRUUHJLRQDOURDGZD\VVXUURXQGLQJWKHVWXG\DUHD,QJHQHUDOWKHIROORZLQJ JOREDOWULSGLVWULEXWLRQZDVDVVXPHGIRUWKHGHYHORSPHQW xWRIURPWKHZHVWRQ+LJKZD\ xWRIURPWKHHDVWRQ+LJKZD\ 7KHWULSGLVWULEXWLRQIRUWKHVLWHJHQHUDWHGWUDIILFLVVKRZQLQ([KLELW$IRUWKHSDVVHQJHUYHKLFOHVDQG ([KLELW%IRUWKHKHDY\YHKLFOHV 6LWHDFFHVVLVSURSRVHGWRLQFOXGHWKUHHODQHDFFHVVHVHDFKZLWKRQHLQJUHVVODQHDQGRQH HJUHVVODQH$OOWKUHHRIWKHSURSRVHGVLWHDFFHVVZLOOEHORFDWHGDORQJ*DWHZD\%RXOHYDUG7KHSURSRVHG Land Use Description Intensity AM Peak Hour PM Peak Hour In Out Total In Out Total Warehousing (ITE 150) 212,500 S.F. 28 8 36 11 29 40 General Office Building (ITE 710) 37,500 S.F. 38 6 44 7 36 43 Total Site Generated Trips 66 14 80 18 65 83 Warehouse Heavy Vehicles (20% of Trip Gen per ITE) 6 2 8 2 6 8 Passenger Vehicles 60 12 72 16 59 75 Total Net New Traffic 66 14 80 18 65 83 7 NEC I-35W & I-694 – Gateway Blvd – Arden Hills Traffic Impact Analysis Ň April 2020 VLWHSODQLVLQFOXGHGLQ$SSHQGL[&7KHVLWHWULSVZHUHDVVLJQHGWRWKHVWXG\LQWHUVHFWLRQVDVVKRZQLQ ([KLELW &$3$&,7<$1$/<6,6 $FDSDFLW\DQDO\VLVZDVSHUIRUPHGWRTXDQWLI\WKHGHOD\DQGOHYHORIVHUYLFHDWWKHVWXG\LQWHUVHFWLRQVGXULQJ WKHZHHNGD\$0DQG30SHDNKRXUV7KHFDSDFLW\DQDO\VLVZDVSHUIRUPHGXVLQJ6\QFKUR6LP7UDIILF ([LVWLQJVLJQDOWLPLQJVXVHGLQWKHDQDO\VLVZHUHSURYLGHGE\5DPVH\&RXQW\ 7KHFDSDFLW\RIDQLQWHUVHFWLRQTXDQWLILHVLWVDELOLW\WRDFFRPPRGDWHWUDIILFYROXPHVDQGLVPHDVXUHGLQ DYHUDJHGHOD\SHUYHKLFOH,WLVH[SUHVVHGLQWHUPVRIOHYHORIVHUYLFH/26ZKLFKUDQJHVIURP$WR)ZLWK /26$DVWKHKLJKHVWEHVWWUDIILFIORZDQGOHDVWGHOD\/26(DVVDWXUDWHGRUDWFDSDFLW\FRQGLWLRQVDQG /26)DVWKHORZHVWRYHUVDWXUDWHGFRQGLWLRQV7KH/26JUDGHVVKRZQEHORZZKLFKDUHSURYLGHGLQWKH 7UDQVSRUWDWLRQ5HVHDUFK%RDUG¶V+LJKZD\&DSDFLW\0DQXDO+&0TXDQWLI\DQGFDWHJRUL]HWKHGULYHU¶V GLVFRPIRUWIUXVWUDWLRQIXHOFRQVXPSWLRQDQGWUDYHOWLPHVH[SHULHQFHGDVDUHVXOWRILQWHUVHFWLRQFRQWURO DQGWKHUHVXOWLQJWUDIILFTXHXLQJ$GHWDLOHGGHVFULSWLRQRIHDFK/26UDWLQJFDQEHIRXQGLQ7DEOH7KH UDQJHRIFRQWUROGHOD\IRUHDFKUDWLQJDVGHWDLOHGLQWKH+&0LVDOVRVKRZQLQ7DEOH%HFDXVHVLJQDOL]HG LQWHUVHFWLRQVDUHH[SHFWHGWRFDUU\DODUJHUYROXPHRIYHKLFOHVDQGVWRSSLQJLVUHTXLUHGGXULQJUHGWLPH KLJKHUGHOD\VDUHWROHUDWHGIRUWKHFRUUHVSRQGLQJ/26UDWLQJV Table 3 – Level of Service Information Level of Service Average Control Delay (seconds/vehicle) Description A 0-10 (Unsignalized); 0-10 (Signalized) Minimal control delay; traffic operates at primarily free-flow conditions; unimpeded movement within traffic stream. B >10-15 (Unsignalized); >10-20 (Signalized) Minor control delay at signalized intersections; traffic operates at a fairly unimpeded level with slightly restricted movement within traffic stream. C >15-25 (Unsignalized); >20-35 (Signalized) Moderate control delay; movement within traffic stream more restricted than at LOS B; formation of queues contributes to lower average travel speeds. D >25-35 (Unsignalized); >35-55 (Signalized) Considerable control delay that may be substantially increased by small increases in flow; average travel speeds continue to decrease. E >35-50 (Unsignalized); >55-80 (Signalized) High control delay; average travel speed no more than 33 percent of free flow speed. F >50 (Unsignalized); >80 (Signalized) Extremely high control delay; extensive queuing and high volumes create exceedingly restricted traffic flow. 7UDIILFPRGHOVIRUHDFKVFHQDULRZHUHGHYHORSHGXVLQJ6\QFKUR6LP7UDIILFDQGWKHGHOD\DQGTXHXHLQJ ZHUHHYDOXDWHGIRUHDFKVFHQDULR7KHVFHQDULRVWKDWZHUHDQDO\]HGDUHDVIROORZV x([LVWLQJ<HDU x2SHQLQJ<HDU1R%XLOG x2SHQLQJ<HDU%XLOG x+RUL]RQ<HDU1R%XLOG x+RUL]RQ<HDU%XLOG NEC I-35W & I-694 – Gateway Blvd – Arden Hills Traffic Impact Analysis Ň April 2020 (;,67,1*<($5&21',7,216 7KHWUDIILFYROXPHVVKRZQLQ([KLELWZHUHXVHGLQWKH([LVWLQJ<HDUDQDO\VLV7DEOHVKRZVWKH /26DQGGHOD\IRUWKHVWXG\LQWHUVHFWLRQVXQGHU([LVWLQJFRQGLWLRQVGXULQJWKH$0DQG30SHDN KRXU %DVHGRQWKHDQDO\VLVWKHVWXG\LQWHUVHFWLRQVDUHFXUUHQWO\RSHUDWLQJDWD/26%RUEHWWHUGXULQJWKH$0 SHDNKRXUDQG30SHDNKRXU$GGLWLRQDOO\DOOLQGLYLGXDOPRYHPHQWVRSHUDWHDWD/26'RUEHWWHUH[FHSW IRUWKHQRUWKERXQGOHIWWXUQDQGWKHVRXWKERXQGWKURXJKPRYHPHQWDW+LJKZD\DQG5RXQG/DNH5RDG :$UGHQ0DQRU:D\LQWKH303HDN+RXU7KH6LP7UDIILFUHSRUWVDUHSURYLGHGLQ$SSHQGL[' Table 4 – Existing (2020) Intersection Analysis Intersection Left Through Right Intersection Delay (s/veh) LOS Delay (s/veh) LOS Delay (s/veh) LOS Delay (s/veh) LOS AM Peak Hour Highway 96 and Round Lake Road W/Arden Manor Way Signalized EB 11.7 B 8.4 A 3.2 A 10.4 B WB 10.3 B 8.5 A 2.8 A NB 41.1 D 47.8 D 3.8 A SB 47.6 D 54.6 D 13.9 B PM Peak Hour Highway 96 and Round Lake Road W/Arden Manor Way Signalized EB 14.6 B 7.2 A 2.3 A 14.9 B WB 9.6 A 9.9 A 2.8 A NB 63.0 E 39.0 D 5.4 A SB 52.8 D 62.3 E 16.6 B 23(1,1*<($512%8,/'&21',7,216 $ FDSDFLW\ DQDO\VLV ZDV SHUIRUPHG IRU 2SHQLQJ <HDU 1R%XLOG FRQGLWLRQV LQ RUGHU WR GHYHORS EDVHOLQHRSHUDWLQJFRQGLWLRQVIRUWKHRSHQLQJ\HDU7KHDQDO\VLVZDVSHUIRUPHGXVLQJ6\QFKUR6LP7UDIILF ZLWKH[LVWLQJLQWHUVHFWLRQJHRPHWU\DQGFRQWUROH[LVWLQJSHDNKRXUIDFWRUVDQGVLJQDOWLPLQJLQIRUPDWLRQDQG WKHWUDIILFYROXPHVDUHLQ([KLELW 7KHUHVXOWVRIWKHDQDO\VLVDUHSURYLGHGLQ7DEOHIRUWKHZHHNGD\$0DQG30SHDNKRXUV%DVHGRQWKH 2SHQLQJ<HDU1R%XLOGFDSDFLW\DQDO\VLVWKHVWXG\LQWHUVHFWLRQVDUHDQWLFLSDWHGWRRSHUDWHDW/26 %RUEHWWHULQWKH$0SHDNKRXUDQGLQWKH30SHDNKRXU$GGLWLRQDOO\DOOLQGLYLGXDOPRYHPHQWVDUH DQWLFLSDWHGWRRSHUDWHDWD/26'RUEHWWHUH[FHSWIRUWKHQRUWKERXQGOHIWWXUQDQGVRXWKERXQGWKURXJK PRYHPHQWVDW+LJKZD\DQG5RXQG/DNH5RDG:$UGHQ0DQRU:D\LQWKH303HDN+RXU7KHWZR PRYHPHQWVWKDWDUH/26(DUHWKHVDPHPRYHPHQWVWKDWDUH/26(LQH[LVWLQJFRQGLWLRQV7KH6LP7UDIILF UHSRUWVDUHSURYLGHGLQ$SSHQGL[' 9 NEC I-35W & I-694 – Gateway Blvd – Arden Hills Traffic Impact Analysis Ň April 2020 Table 5 – Opening Year No-Build (2021) Intersection Analysis Intersection Left Through Right Intersection Delay (s/veh) LOS Delay (s/veh) LOS Delay (s/veh) LOS Delay (s/veh) LOS AM Peak Hour Highway 96 and Round Lake Road W/Arden Manor Way Signalized EB 11.0 B 8.6 A 3.4 A 10.4 B WB 11.0 B 8.3 A 2.6 A NB 40.6 D 47.3 D 3.8 A SB 45.7 D 47.0 D 11.9 B PM Peak Hour Highway 96 and Round Lake Road W/Arden Manor Way Signalized EB 14.4 B 7.7 A 2.2 A 14.9 B WB 10.6 B 10.1 B 2.7 A NB 61.7 E 40.0 D 5.3 A SB 52.1 D 64.1 E 16.0 B 23(1,1*<($5%8,/'&21',7,216 2SHQLQJ<HDU%XLOGFRQGLWLRQVZHUHDQDO\]HGWRGHWHUPLQHDQ\WUDIILFLPSDFWVIURPWKHDGGLWLRQRI WKHVLWHWUDIILFWRWKHVWXG\LQWHUVHFWLRQV2SHQLQJ<HDU%XLOGWXUQLQJPRYHPHQWYROXPHVZHUH GHYHORSHGE\DGGLQJWKHVLWHWULSVLQ([KLELWWRWKH2SHQLQJ<HDU1R%XLOGWXUQLQJPRYHPHQW YROXPHVLQ([KLELW7KH2SHQLQJ<HDU%XLOGWXUQLQJPRYHPHQWYROXPHVDUHVKRZQLQ([KLELW %DVHGRQWKH2SHQLQJ<HDU%XLOGFDSDFLW\DQDO\VLVWKHVWXG\LQWHUVHFWLRQVDUHDQWLFLSDWHGWR RSHUDWHDW/26%RUEHWWHULQWKH$0SHDNKRXUDQG/26&RUEHWWHULQWKH30SHDNKRXU$GGLWLRQDOO\DOO LQGLYLGXDOPRYHPHQWVDUHDQWLFLSDWHGWRRSHUDWHDWD/26(RUEHWWHUH[FHSWIRUWKHQRUWKERXQGOHIWWXUQDW +LJKZD\DQG5RXQG/DNH5RDG:$UGHQ0DQRU:D\LQWKH303HDN+RXU7KHUHVXOWVRIWKHDQDO\VLV DUHSURYLGHGLQ7DEOHIRUWKHZHHNGD\$0DQG30SHDNKRXUV7KH6LP7UDIILFUHSRUWVDUHSURYLGHGLQ $SSHQGL[' NEC I-35W & I-694 – Gateway Blvd – Arden Hills Traffic Impact Analysis Ň April 2020 Table 6 – Opening Year Build (2021) Intersection Analysis Intersection Left Through Right Intersection Delay (s/veh) LOS Delay (s/veh) LOS Delay (s/veh) LOS Delay (s/veh) LOS AM Peak Hour Highway 96 and Round Lake Road W/Arden Manor Way Signalized EB 10.9 B 8.8 A 3.8 A 10.6 B WB 11.4 B 8.5 A 2.9 A NB 41.7 D 36.7 D 3.9 A SB 54.3 D 52.5 D 13.4 B Gateway Boulevard and Driveway A North- South Stop Controlled EB - - 0.3 A 0.1 A 0.5 A WB - - 0.1 A - - NB 4.0 A - - - - Gateway Boulevard and Driveway B North- South Stop Controlled EB - - 0.0 A 0.0 A 0.3 A WB - - 0.5 A - - NB 3.6 A - - - - Gateway Boulevard and Driveway C North- South Stop Controlled EB - - 0.0 A 0.1 A 0.5 A WB - - - - - - NB 3.9 A - - - - PM Peak Hour Highway 96 and Round Lake Road W/Arden Manor Way Signalized EB 16.0 B 8.2 A 2.3 A 20.2 C WB 11.1 B 10.3 B 3.0 A NB 96.5 F 43.5 D 11.7 B SB 49.1 D 60.3 E 17.4 B Gateway Boulevard and Driveway A North- South Stop Controlled EB - - 0.1 A 0.0 A 1.4 A WB - - 0.2 A - - NB 4.8 A - - - - Gateway Boulevard and Driveway B North- South Stop Controlled EB - - 0.0 A 0.0 A 0.7 A WB - - 0.5 A - - NB 4.2 A - - - - Gateway Boulevard and Driveway C North- South Stop Controlled EB - - 0.0 A 0.0 A 2.8 A WB - - - - - - NB 4.3 A - - - - 7KHQRUWKERXQGOHIWWXUQLVDQWLFLSDWHGWREH/26)LQWKH2SHQLQJ<HDU%XLOG303HDN$VVXPLQJ RQO\PLQRUWLPLQJDGMXVWPHQWVDUHUHTXLUHGWRLPSURYHRSHUDWLRQVLWLVUHFRPPHQGHGWKDWWKHVLJQDOWLPLQJ DWWKHLQWHUVHFWLRQRI+LJKZD\DQG5RXQG/DNH5RDG:$UGHQ0DQRU:D\EHDGMXVWHG7KH/26LV DQWLFLSDWHGWRLPSURYHRQWKHQRUWKERXQGOHIWE\LQFUHDVLQJWKHQRUWKERXQGOHIWWXUQSKDVHE\VHFRQGV DQGFRQVHTXHQWO\GHFUHDVLQJWKHHDVWERXQGZHVWERXQGSKDVHVE\VHFRQGV7DEOH$VKRZVWKHUHVXOWV RIWKHDQDO\VLVIRUWKH30SHDNKRXU 11 NEC I-35W & I-694 – Gateway Blvd – Arden Hills Traffic Impact Analysis Ň April 2020 Table 6A – Opening Year Build (2021) Intersection Analysis Intersection Left Through Right Intersection Delay (s/veh) LOS Delay (s/veh) LOS Delay (s/veh) LOS Delay (s/veh) LOS PM Peak Hour Highway 96 and Round Lake Road W/Arden Manor Way Signalized EB 16.6 B 10.1 B 2.6 A 15.6 B WB 12.7 B 11.9 B 2.9 A NB 49.6 D 33.1 C 5.6 A SB 45.2 D 55.4 E 14.8 B +25,=21<($512%8,/'&21',7,216 $FDSDFLW\DQDO\VLVZDVSHUIRUPHGIRU+RUL]RQ<HDU1R%XLOGFRQGLWLRQVLQRUGHUWRGHYHORSEDVHOLQH RSHUDWLQJ FRQGLWLRQV IRU WKH KRUL]RQ \HDU 7KH DQDO\VLV ZDV SHUIRUPHG XVLQJ 6\QFKUR6LP7UDIILFZLWK H[LVWLQJLQWHUVHFWLRQJHRPHWU\DQGFRQWUROH[LVWLQJSHDNKRXUIDFWRUVDQGVLJQDOWLPLQJLQIRUPDWLRQDQGWKH WUDIILFYROXPHVLQ([KLELW 7KHUHVXOWVRIWKHDQDO\VLVDUHSURYLGHGLQ7DEOHIRUWKHZHHNGD\$0DQG30SHDNKRXUV%DVHGRQWKH +RUL]RQ<HDU1R%XLOGFDSDFLW\DQDO\VLVWKHVWXG\LQWHUVHFWLRQVDUHDQWLFLSDWHGWRRSHUDWHDW/26 %RUEHWWHULQWKH$0SHDNKRXUDQGLQWKH30SHDNKRXU$GGLWLRQDOO\DOOLQGLYLGXDOPRYHPHQWVDUH DQWLFLSDWHGWRRSHUDWHDWD/26'RUEHWWHUH[FHSWIRUWKHQRUWKERXQGOHIWWXUQDQGVRXWKERXQGWKURXJK PRYHPHQWVDW+LJKZD\DQG5RXQG/DNH5RDG:$UGHQ0DQRU:D\LQWKH303HDN+RXU7KHWZR PRYHPHQWVWKDWDUH/26(DUHWKHVDPHPRYHPHQWVWKDWDUH/26(LQH[LVWLQJFRQGLWLRQV7KH6LP7UDIILF UHSRUWVDUHSURYLGHGLQ$SSHQGL[' Table 7 – Horizon Year No-Build (2040) Intersection Analysis Intersection Left Through Right Intersection Delay (s/veh) LOS Delay (s/veh) LOS Delay (s/veh) LOS Delay (s/veh) LOS AM Peak Hour Highway 96 and Round Lake Road W/Arden Manor Way Signalized EB 12.7 B 9.2 A 3.8 A 10.8 B WB 11.9 B 9.1 A 2.5 A NB 39.2 D 36.8 D 3.9 A SB 50.2 D 49.9 D 13.7 B PM Peak Hour Highway 96 and Round Lake Road W/Arden Manor Way Signalized EB 18.1 B 8.6 A 2.4 A 17.5 B WB 12.7 B 11.0 B 2.9 A NB 77.4 E 38.9 D 9.0 A SB 54.5 D 62.0 E 17.0 B +25,=21<($5%8,/'&21',7,216 7KH+RUL]RQ<HDU%XLOGWUDIILFYROXPHVZHUHGHYHORSHGIURPWKHDGGLWLRQRIWKH+RUL]RQ<HDU1R %XLOGYROXPHVLQ([KLELWDQGWKH6LWH7ULSVLQ([KLELW([KLELWVKRZVWKH+RUL]RQ<HDU%XLOG WXUQLQJPRYHPHQWYROXPHV7KHDQDO\VLVZDVSHUIRUPHGXVLQJ6\QFKUR6LP7UDIILFZLWKH[LVWLQJ LQWHUVHFWLRQJHRPHWU\DQGFRQWUROH[LVWLQJSHDNKRXUIDFWRUVDQGVLJQDOWLPLQJLQIRUPDWLRQ NEC I-35W & I-694 – Gateway Blvd – Arden Hills Traffic Impact Analysis Ň April 2020 7KHUHVXOWVRIWKHDQDO\VLVDUHSURYLGHGLQ7DEOHIRUWKHZHHNGD\$0DQG30SHDNKRXUV%DVHGRQWKH +RUL]RQ<HDU1R%XLOGFDSDFLW\DQDO\VLVWKHVWXG\LQWHUVHFWLRQVDUHDQWLFLSDWHGWRRSHUDWHDW/26 %RUEHWWHULQWKH$0SHDNKRXUDQG/26&RUEHWWHULQWKH30SHDNKRXU7KH6LP7UDIILFUHSRUWVDUH SURYLGHGLQ$SSHQGL[' Table 8 – Horizon Year Build (2040) Intersection Analysis Intersection Left Through Right Intersection Delay (s/veh) LOS Delay (s/veh) LOS Delay (s/veh) LOS Delay (s/veh) LOS AM Peak Hour Highway 96 and Round Lake Road W/Arden Manor Way Signalized EB 14.4 B 9.7 A 4.4 A 11.4 B WB 12.7 B 9.5 A 2.2 A NB 38.8 D 29.2 C 3.9 A SB 52.1 D 50.9 D 15.8 B Gateway Boulevard and Driveway A North- South Stop Controlled EB - - 0.3 A 0.2 A 0.5 A WB - - 0.1 A - - NB 4.1 A - - - - Gateway Boulevard and Driveway B North- South Stop Controlled EB - - 0.0 A 0.0 A 0.3 A WB - - 0.5 A - - NB 3.9 A - - - - Gateway Boulevard and Driveway C North- South Stop Controlled EB - - 0.0 A 0.1 A 0.7 A WB - - - - - - NB 3.9 A - - - - PM Peak Hour Highway 96 and Round Lake Road W/Arden Manor Way Signalized EB 16.5 B 8.0 A 2.4 A 25.9 C WB 11.6 B 11.0 B 3.1 A NB 100+ F 66.8 E 29.6 C SB 47.6 E 73.7 E 18.8 B Gateway Boulevard and Driveway A North- South Stop Controlled EB - - 0.1 A 0.0 A 1.4 A WB - - 0.2 A - - NB 5.0 A - - - - Gateway Boulevard and Driveway B North- South Stop Controlled EB - - 0.2 A 0.1 A 0.7 A WB - - 0.4 A - - NB 4.4 A - - - - Gateway Boulevard and Driveway C North- South Stop Controlled EB - - 0.1 A 0.0 A 2.7 A WB - - - - - - NB 4.2 A - - - - 7KHQRUWKERXQGOHIWWXUQLVDQWLFLSDWHGWREH/26)LQWKH+RUL]RQ<HDU%XLOG303HDN7KHVDPH VLJQDOWLPLQJFKDQJHWKDWLVUHFRPPHQGHGLQWKH2SHQLQJ<HDU%XLOGLVUHFRPPHQGIRUWKH+RUL]RQ <HDU%XLOG7KH/26LVDQWLFLSDWHGWRLPSURYHRQWKHQRUWKERXQGOHIWE\LQFUHDVLQJWKHQRUWKERXQG OHIWWXUQSKDVHE\VHFRQGVDQGFRQVHTXHQWO\GHFUHDVLQJWKHHDVWERXQGZHVWERXQGSKDVHVE\VHFRQGV 7DEOH$VKRZVWKHUHVXOWVRIWKHDQDO\VLVIRUWKH30SHDNKRXU 13 NEC I-35W & I-694 – Gateway Blvd – Arden Hills Traffic Impact Analysis Ň April 2020 Table 8A – Horizon Year Build (2040) Intersection Analysis Intersection Left Through Right Intersection Delay (s/veh) LOS Delay (s/veh) LOS Delay (s/veh) LOS Delay (s/veh) LOS PM Peak Hour Highway 96 and Round Lake Road W/Arden Manor Way Signalized EB 16.9 B 10.6 B 2.6 A 18.0 B WB 13.8 B 13.2 B 2.9 A NB 62.7 E 33.9 C 7.8 A SB 53.6 D 63.1 E 19.0 B &21&/86,216$1'5(&200(1'$7,216 6FDQQHOO3URSHUWLHVLVSURSRVLQJDQDSSUR[LPDWHO\VTXDUHIRRWOLJKWLQGXVWULDOEXLOGLQJ)RUWKH SXUSRVH RI WKLV VWXG\ WKH DVVXPHG EUHDNGRZQ RI WKH XVHV LQFOXGHV VTXDUH IRRW RI ZDUHKRXVHDQGVTXDUHIHHWRIRIILFHVSDFHRQ*DWHZD\%RXOHYDUGLQ$UGHQ+LOOV017KH VLWHLVDQWLFLSDWHGWRJHQHUDWHQHZWULSVGXULQJWKH$0SHDNKRXUHQWHULQJH[LWLQJDQGQHZ WULSVGXULQJWKH30SHDNKRXUHQWHULQJH[LWLQJ 6LWHDFFHVVLVSURSRVHGWRLQFOXGHWKUHHODQHDFFHVVHVHDFKZLWKRQHLQJUHVVODQHDQGRQH HJUHVVODQH7KHSURSRVHGVLWHDFFHVVHVZLOODOOEHORFDWHGDORQJ*DWHZD\%RXOHYDUG $FDSDFLW\DQDO\VLVZDVSHUIRUPHGIRU([LVWLQJ2SHQLQJ<HDU1R%XLOG2SHQLQJ<HDU%XLOG +RUL]RQ<HDU1R%XLOGDQG+RUL]RQ<HDU%XLOG,QDOOILYHVFHQDULRVWKHILYHVWXG\ LQWHUVHFWLRQVDUHDQWLFLSDWHGWRRSHUDWHDW/26&RUEHWWHULQWKH$0DQG30SHDNKRXUV,WLVUHFRPPHQGHG WKDWWKHVLJQDOWLPLQJDWWKHLQWHUVHFWLRQRI+LJKZD\DQG5RXQG/DNH5RDG:$UGHQ0DQRU:D\EH DGMXVWHGWRLQFUHDVHWKHQRUWKERXQGOHIWWXUQSKDVHLQWKH303HDN+RXU:LWKWKLVFKDQJHLWLVDQWLFLSDWHG WKDWDOOLQGLYLGXDOPRYHPHQWVZLOOEH/26'RUEHWWHUH[FHSWIRUWZRPRYHPHQWVWKDWRSHUDWHDW/26(LQ WKH2SHQLQJ<HDU1R%XLOG2SHQLQJ<HDU%XLOG+RUL]RQ<HDU1R%XLOGDQG+RUL]RQ <HDU%XLOG7KHVLJQDOWLPLQJFKDQJHLVWKHRQO\RIIVLWHPLWLJDWLRQWKDWLVUHFRPPHQGHGWRSURYLGH DFFHSWDEOH/26DWWKHVWXG\LQWHUVHFWLRQVZLWKWKHDGGLWLRQRIWKH$UGHQ+LOOV:DUHKRXVHWUDIILF $33(1',; $ ([KLELWV % 7XUQLQJ0RYHPHQW&RXQWV & 6LWH/D\RXW([KLELW ' 6LP7UDIILF$QDO\VLV5HVXOWV 10 694 35W 96 NOT TO SCALE Round Lake Rd WRound Lake Rd WRoRoRouRouounounundundnd ndLLLakLaakeakekekeRdRdRd RdWWOld Hwy 8 NWOld Hwy 8 NWOOOlOld dHwHHwyHwwy wy8 8NWNNWNWSpace Center DrwySpace Center DrwySpSpSpaSpaSpacpacaceacece CceeCeCeCenCenCenteentntententerntertererDrwDrwDrwDrwDrwyrwywywyGatew a y B lv d Gatew a y B lv d GGaateetewewww a y a y B lvlv d v dd EXHIBIT 1 PROJECT SITE LOCATION AND STUDY AREA LEGEND Proposed Site Location Study Intersection Proposed Site Driveways 10 694 35W 96 NOT TO SCALE Round Lake Rd WRound Lake Rd WRoRoRouRouounounundundnd ndLLLakLaakeakekekeRdRdRd RdWWOld Hwy 8 NWOld Hwy 8 NWOOOlOld dHwHHwyHwwy wy8 8NWNNWNWSpace Center DrwySpace Center DrwySpSpSpaSpaSpacpacaceacece CceeCeCeCenCenCenteentntententerntertererDrwDrwDrwDrwDrwyrwywywyGatew a y B lv d Gatew a y B lv d GGaateetewewww a y a y B lvlv d v dd EXHIBIT 2 EXISTING GEOMETRY AND INTERSECTION CONTROL LEGEND Proposed Site Location Study Intersection Proposed Site Driveways Existing Stop Sign Existing Signal 10 694 35W 96 NOT TO SCALE Round Lake Rd WRound Lake Rd WRoRoRouRouounounundundnd ndLLLakLaakeakekekeRdRdRd RdWWOld Hwy 8 NWOld Hwy 8 NWOOOlOld dHwHHwyHwwy wy8 8NWNNWNWSpace Center DrwySpace Center DrwySpSpSpaSpaSpacpacaceacece CceeCeCeCenCenCenteentntententerntertererDrwDrwDrwDrwDrwyrwywywyGatew a y B lv d Gatew a y B lv d GGaateetewewww a y a y B lvlv d v dd EXHIBIT 3 EXISTING (2020) PEAK HOUR TRAFFIC VOLUMES LEGEND Proposed Site Location Study Intersection Proposed Site Driveways AM (PM) Peak Hour Volumes XX (XX)1 (14)8 (5)2 (25)0 (1) 1 (14) 0 (0) 18 (3) 8 (4) 3 (39) 26 (7) 1 (14) 8 (5)53 (37)9 (5) 10 (10)748 (926) 117 (46) 13 (21)53 (97)112 (224)3 (8)22 (41) 379 (685) 242 (82) 10 694 35W 96 NOT TO SCALE Round Lake Rd WRound Lake Rd WRoRoRouRouounounundundnd ndLLLakLaakeakekekeRdRdRd RdWWOld Hwy 8 NWOld Hwy 8 NWOOOlOld dHwHHwyHwwy wy8 8NWNNWNWSpace Center DrwySpace Center DrwySpSpSpaSpaSpacpacaceacece CceeCeCeCenCenCenteentntententerntertererDrwDrwDrwDrwDrwyrwywywyGatew a y B lv d Gatew a y B lv d GGaateetewewww a y a y B lvlv d v dd EXHIBIT 4 OPENING YEAR (2021) NO-BUILD PEAK HOUR TRAFFIC VOLUMES LEGEND Proposed Site Location Study Intersection Proposed Site Driveways AM (PM) Peak Hour Volumes XX (XX)1 (14)2 (25)0 (1) 1 (14) 0 (0) 18 (3) 8 (4) 3 (39) 26 (7) 1 (14) 8 (5)8 (5)53 (37)9 (5) 10 (10)752 (931) 118 (46) 13 (21)53 (97)113 (225)3 (8)22 (41) 381 (688) 243 (82) 10 694 35W 96 NOT TO SCALE Round Lake Rd WRound Lake Rd WRoRoRouRouounounundundnd ndLLLakLaakeakekekeRdRdRd RdWWOld Hwy 8 NWOld Hwy 8 NWOOOlOld dHwHHwyHwwy wy8 8NWNNWNWSpace Center DrwySpace Center DrwySpSpSpaSpaSpacpacaceacece CceeCeCeCenCenCenteentntententerntertererDrwDrwDrwDrwDrwyrwywywyGatew a y B lv d Gatew a y B lv d GGaateetewewww a y a y B lvlv d v dd EXHIBIT 5 HORIZON YEAR (2040) NO-BUILD PEAK HOUR TRAFFIC VOLUMES LEGEND Proposed Site Location Study Intersection Proposed Site Driveways AM (PM) Peak Hour Volumes XX (XX)1 (15)2 (28)0 (1) 1 (15) 0 (0) 20 (3) 9 (4) 3 (43) 29 (8) 1 (15) 9 (6)9 (6)59 (41)10 (6) 11 (11)826 (1,023) 129 (51) 14 (23)59 (107)124 (247)3 (9)24 (45) 419 (757) 267 (91) 10 694 35W 96 NOT TO SCALE Round Lake Rd WRound Lake Rd WRoRoRouRouounounundundnd ndLLLakLaakeakekekeRdRdRd RdWWOld Hwy 8 NWOld Hwy 8 NWOOOlOld dHwHHwyHwwy wy8 8NWNNWNWSpace Center DrwySpace Center DrwySpSpSpaSpaSpacpacaceacece CceeCeCeCenCenCenteentntententerntertererDrwDrwDrwDrwDrwyrwywywyGatew a y B lv d Gatew a y B lv d GGaateetewewww a y a y B lvlv d v dd EXHIBIT 6A PASSENGER VEHICLE SITE TRIP DISTRIBUTION LEGEND Proposed Site Location Study Intersection Proposed Site Driveways %In [%Out] Site Traffic X% [X%] [40%] 40% 35%[40%][35%][65%]65% [40%] 40% [40%] 40%[60%]60%40% 10 694 35W 96 NOT TO SCALE Round Lake Rd WRound Lake Rd WRoRoRouRouounounundundnd ndLLLakLaakeakekekeRdRdRd RdWWOld Hwy 8 NWOld Hwy 8 NWOOOlOld dHwHHwyHwwy wy8 8NWNNWNWSpace Center DrwySpace Center DrwySpSpSpaSpaSpacpacaceacece CceeCeCeCenCenCenteentntententerntertererDrwDrwDrwDrwDrwyrwywywyGatew a y B lv d Gatew a y B lv d GGaateetewewww a y a y B lvlv d v dd EXHIBIT 6B HEAVY VEHICLE SITE TRIP DISTRIBUTION LEGEND Proposed Site Location Study Intersection Proposed Site Driveways %In [%Out] Site Traffic X% [X%] [100%] 100% 35%[100%][35%][65%]65% [100%] 100%100% 10 694 35W 96 NOT TO SCALE Round Lake Rd WRound Lake Rd WRoRoRouRouounounundundnd ndLLLakLaakeakekekeRdRdRd RdWWOld Hwy 8 NWOld Hwy 8 NWOOOlOld dHwHHwyHwwy wy8 8NWNNWNWSpace Center DrwySpace Center DrwySpSpSpaSpaSpacpacaceacece CceeCeCeCenCenCenteentntententerntertererDrwDrwDrwDrwDrwyrwywywyGatew a y B lv d Gatew a y B lv d GGaateetewewww a y a y B lvlv d v dd EXHIBIT 7 SITE TRIP ASSIGNMENT LEGEND Proposed Site Location Study Intersection Proposed Site Driveways AM (PM) Site Traffic XX (XX) 7 (30) 30 (8) 23 (7)5 (23)9 (42)43 (11) 5 (24) 24 (6)2 (6)5 (24)6 (2) 7 (30) 30 (8)7 (35)36 (10) 24 (6) 10 694 35W 96 NOT TO SCALE Round Lake Rd WRound Lake Rd WRoRoRouRouounounundundnd ndLLLakLaakeakekekeRdRdRd RdWWOld Hwy 8 NWOld Hwy 8 NWOOOlOld dHwHHwyHwwy wy8 8NWNNWNWSpace Center DrwySpace Center DrwySpSpSpaSpaSpacpacaceacece CceeCeCeCenCenCenteentntententerntertererDrwDrwDrwDrwDrwyrwywywyGatew a y B lv d Gatew a y B lv d GGaateetewewww a y a y B lvlv d v dd EXHIBIT 8 OPENING YEAR (2021) BUILD PEAK HOUR TRAFFIC VOLUMES LEGEND Proposed Site Location Study Intersection Proposed Site Driveways AM (PM) Peak Hour VolumesXX (XX)53 (37)9 (5) 10 (10)752 (931) 141 (53) 13 (21)58 (120)122 (267)3 (8)22 (41) 381 (688) 286 (93)2 (25)0 (1) 8 (44) 0 (0) 18 (3) 38 (12) 6 (38) 32 (11) ()6 (2)1 (14)8 (5)5 (24)24 (6) 10 (69) 56 (15)7 (35)36 (10) 10 694 35W 96 NOT TO SCALE Round Lake Rd WRound Lake Rd WRoRoRouRouounounundundnd ndLLLakLaakeakekekeRdRdRd RdWWOld Hwy 8 NWOld Hwy 8 NWOOOlOld dHwHHwyHwwy wy8 8NWNNWNWSpace Center DrwySpace Center DrwySpSpSpaSpaSpacpacaceacece CceeCeCeCenCenCenteentntententerntertererDrwDrwDrwDrwDrwyrwywywyGatew a y B lv d Gatew a y B lv d GGaateetewewww a y a y B lvlv d v dd EXHIBIT 9 HORIZON YEAR (2040) BUILD PEAK HOUR TRAFFIC VOLUMES LEGEND Proposed Site Location Study Intersection Proposed Site Driveways AM (PM) Peak Hour Volumes XX (XX)59 (41)10 (6) 11 (11)826 (1,023) 152 (58) 14 (23)64 (130)133 (289)3 (9)24 (45) 419 (757) 310 (102)2 (28)0 (1) 8 (45) 0 (0) 20 (3) 39 (12) 6 (39) 33 (12)2 (6)6 (2)1 (15)9 (6)5 (24)24 (6) 10 (73) 59 (16)7 (35)36 (10) Kimley-Horn : Lisle (IL)1001 Warrenville Road, Suite 350Lisle, Illinois, United States 60532331.481.7332 jack.olsson@kimley-horn.comCount Name: Highway 96 & Round LakeRoad/Arden Manor WaySite Code:Start Date: 03/04/2020Page No: 1Turning Movement DataStart TimeHighway 96 Highway 96 Arden Manor Way Round Lake RoadWestbound Eastbound Southbound NorthboundLeft Thru Right App. Total Left Thru Right App. Total Left Thru Right App. Total Left Thru Right App. Total Int. Total7:00 AM 19 159 0 178 4 63 47 114 2 0 8 10 16 2 7 25 3277:15 AM 21 200 2 223 5 91 65 161 2 2 16 20 29 0 13 42 4467:30 AM 34 178 3 215 7 115 53 175 1 4 17 22 26 2 11 39 4517:45 AM 37 196 5 238 6 87 71 164 4 0 9 13 29 0 16 45 460Hourly Total 111 733 10 854 22 356 236 614 9 6 50 65 100 4 47 151 16848:00 AM 25 174 3 202 4 86 53 143 3 3 11 17 28 1 13 42 4048:15 AM 23 172 2 197 4 96 46 146 0 3 6 9 28 1 16 45 3978:30 AM 13 161 1 175 2 90 42 134 2 0 11 13 26 2 13 41 3638:45 AM 16 143 1 160 5 54 31 90 1 3 11 15 27 1 9 37 302Hourly Total 77 650 7 734 15 326 172 513 6 9 39 54 109 5 51 165 1466*** BREAK *** - - - - - - - - - - - - - - - - -4:00 PM 10 191 9 210 11 147 27 185 1 2 6 9 63 2 33 98 5024:15 PM 14 205 6 225 8 176 19 203 0 2 11 13 41 3 19 63 5044:30 PM 13 260 3 276 11 157 28 196 1 0 9 10 83 2 37 122 6044:45 PM 9 255 9 273 12 180 14 206 3 2 9 14 46 1 16 63 556Hourly Total 46 911 27 984 42 660 88 790 5 6 35 46 233 8 105 346 21665:00 PM 10 206 3 219 10 172 21 203 6 1 8 15 54 2 25 81 5185:15 PM 11 224 3 238 6 161 12 179 1 0 11 12 40 3 16 59 4885:30 PM 12 180 8 200 8 180 17 205 2 2 10 14 27 4 17 48 4675:45 PM 12 127 4 143 10 117 15 142 0 1 6 7 21 0 15 36 328Hourly Total 45 737 18 800 34 630 65 729 9 4 35 48 142 9 73 224 1801Grand Total 279 3031 62 3372 113 1972 561 2646 29 25 159 213 584 26 276 886 7117Approach % 8.3 89.9 1.8 - 4.3 74.5 21.2 - 13.6 11.7 74.6 - 65.9 2.9 31.2 - -Total % 3.9 42.6 0.9 47.4 1.6 27.7 7.9 37.2 0.4 0.4 2.2 3.0 8.2 0.4 3.9 12.4 -Lights 266 2964 56 3286 107 1944 526 2577 24 25 150 199 549 23 262 834 6896% Lights 95.3 97.8 90.3 97.4 94.7 98.6 93.8 97.4 82.8 100.0 94.3 93.4 94.0 88.5 94.9 94.1 96.9Mediums 9 60 6 75 6 24 31 61 5 0 9 14 28 3 14 45 195% Mediums 3.2 2.0 9.7 2.2 5.3 1.2 5.5 2.3 17.2 0.0 5.7 6.6 4.8 11.5 5.1 5.1 2.7Articulated Trucks 4 7 0 11 0 4 4 8 0 0 0 0 7 0 0 7 26% Articulated Trucks 1.4 0.2 0.0 0.3 0.0 0.2 0.7 0.3 0.0 0.0 0.0 0.0 1.2 0.0 0.0 0.8 0.4 Kimley-Horn : Lisle (IL)1001 Warrenville Road, Suite 350Lisle, Illinois, United States 60532331.481.7332 jack.olsson@kimley-horn.comCount Name: Gateway Boulevard & SpaceCenter DrivewaySite Code:Start Date: 03/04/2020Page No: 1Turning Movement DataStart TimeGateway Boulevard Gateway Boulevard Space Center DrivewayWestbound Eastbound SouthboundThru Right App. Total Left Thru App. Total Left Right App. Total Int. Total7:00 AM 0 0 0 2 1 3 0 0 0 37:15 AM 1 0 1 6 1 7 0 0 0 87:30 AM 0 0 0 4 2 6 0 0 0 67:45 AM 0 0 0 6 3 9 0 1 1 10Hourly Total 1 0 1 18 7 25 0 1 1 278:00 AM 0 0 0 2 2 4 0 1 1 58:15 AM 2 0 2 1 1 2 0 0 0 48:30 AM 1 0 1 0 2 2 0 0 0 38:45 AM 1 0 1 0 1 1 0 0 0 2Hourly Total 4 0 4 3 6 9 0 1 1 14*** BREAK *** - - - - - - - - - -4:00 PM 5 0 5 2 3 5 0 14 14 244:15 PM 2 0 2 1 0 1 1 4 5 84:30 PM 6 0 6 0 0 0 0 4 4 104:45 PM 1 0 1 0 1 1 0 3 3 5Hourly Total 14 0 14 3 4 7 1 25 26 475:00 PM 0 0 0 1 1 2 0 0 0 25:15 PM 2 0 2 0 1 1 0 0 0 35:30 PM 0 0 0 1 0 1 0 0 0 15:45 PM 0 0 0 0 0 0 0 0 0 0Hourly Total 2 0 2 2 2 4 0 0 0 6Grand Total 21 0 21 26 19 45 1 27 28 94Approach % 100.0 0.0 - 57.8 42.2 - 3.6 96.4 - -Total % 22.3 0.0 22.3 27.7 20.2 47.9 1.1 28.7 29.8 -Lights 14 0 14 25 13 38 1 26 27 79% Lights 66.7 - 66.7 96.2 68.4 84.4 100.0 96.3 96.4 84.0Mediums 5 0 5 1 5 6 0 1 1 12% Mediums 23.8 - 23.8 3.8 26.3 13.3 0.0 3.7 3.6 12.8Articulated Trucks 2 0 2 0 1 1 0 0 0 3% Articulated Trucks 9.5 - 9.5 0.0 5.3 2.2 0.0 0.0 0.0 3.2 PREPARED FORSITE PLANC400ARDEN HILLSOFFICE-WAREHOUSESCANNELLPROPERTIESARDEN HILLSMNBUILDING DATA SUMMARYAREASPROPOSED PROPERTY1,142,156 SF (26.22 AC)BUILDING AREA250,000 SF (22.9% OF TOTALPROPERTY AREA)PARKINGREQUIRED PARKING363 SPACES @ 4/1,000 SFPROPOSED PARKING363 SPACES @ 4/1,000 RATIOADA STALLS REQ'D / PROVIDED8 STALLS / 8 STALLSPROPERTY SUMMARYARDEN HILLS OFFICE-WAREHOUSETOTAL PROPERTY AREA1,142,156 SF (26.22 AC)LOT #1 22.35 ACLOT #2 3.87 ACPROPOSED IMPERVIOUS AREAX,XXX SF (X.X AC)PROPOSED PERVIOUS AREAX,XXX SF (X.X AC)TOTAL DISTURBED AREA674,892 SF (15.49 AC)ZONING SUMMARYEXISTING ZONINGGATEWAY BUSINESSDISTRICTPROPOSED ZONINGGATEWAY BUSINESSDISTRICTPARKING SETBACKSSIDE/REAR = 20'ROAD = 50'BUILDING SETBACKSFRONT = 50'SIDE = 20'REAR = 20'PROPOSED CURB AND GUTTERPROPERTY LINEPROPOSED FENCESETBACK LINERETAINING WALLPROPOSED STANDARD DUTY ASPHALTPROPOSED CONCRETE PAVEMENTPROPOSED STORMWATER MANAGEMENT AREAPROPOSED CONCRETE SIDEWALKLEGENDPROPOSED HEAVY DUTY ASPHALTThis document, together with the concepts and designs presented herein, as an instrument of service, is intended only for the specific purpose and client for which it was prepared. Reuse of and improper reliance on this document without written authorization and adaptation by Kimley-Horn and Associates, Inc. shall be without liability to Kimley-Horn and Associates, Inc.SHEET NUMBER2020 KIMLEY-HORN AND ASSOCIATES, INC.767 EUSTIS STREET, SUITE 100, ST. PAUL, MN 55114PHONE: 651-645-4197WWW.KIMLEY-HORN.COMK:\TWC_LDEV\Scannell\Arden Hills, MN\3 Design\CAD\PlanSheets\C4-SITE PLAN.dwg March 30, 2020 - 4:03pm©BYREVISIONSNo.DATEPRELIMINARY - NOT FOR CONSTRUCTIONSITE PLAN NOTES1. ALL WORK AND MATERIALS SHALL COMPLY WITH ALL CITY/COUNTY REGULATIONSAND CODES AND O.S.H.A. STANDARDS.2. CONTRACTOR SHALL REFER TO THE ARCHITECTURAL PLANS FOR EXACTLOCATIONS AND DIMENSIONS OF VESTIBULES, SLOPE PAVING, SIDEWALKS, EXITPORCHES, TRUCK DOCKS, PRECISE BUILDING DIMENSIONS AND EXACT BUILDINGUTILITY ENTRANCE LOCATIONS.3. ALL INNER CURBED RADII ARE TO BE 3' AND OUTER CURBED RADII ARE TO BE 10'UNLESS OTHERWISE NOTED. STRIPED RADII ARE TO BE 5'.4. ALL DIMENSIONS AND RADII ARE TO THE FACE OF CURB UNLESS OTHERWISENOTED.5. EXISTING STRUCTURES WITHIN CONSTRUCTION LIMITS ARE TO BE ABANDONED,REMOVED OR RELOCATED AS NECESSARY. ALL COST SHALL BE INCLUDED IN BASEBID.6. CONTRACTOR SHALL BE RESPONSIBLE FOR ALL RELOCATIONS, (UNLESSOTHERWISE NOTED ON PLANS) INCLUDING BUT NOT LIMITED TO, ALL UTILITIES,STORM DRAINAGE, SIGNS, TRAFFIC SIGNALS & POLES, ETC. AS REQUIRED. ALLWORK SHALL BE IN ACCORDANCE WITH GOVERNING AUTHORITIES REQUIREMENTSAND PROJECT SITE WORK SPECIFICATIONS AND SHALL BE APPROVED BY SUCH. ALLCOST SHALL BE INCLUDED IN BASE BID.7. SITE BOUNDARY, TOPOGRAPHY, UTILITY AND ROAD INFORMATION TAKEN FROM ASURVEY BY SUNDE LAND SURVEYING, DATED 03/18/2020.KIMLEY-HORN ASSUMES NO LIABILITY FOR ANY ERRORS, INACCURACIES, OROMISSIONS CONTAINED THEREIN.8. TOTAL LAND AREA IS 26.220 ACRES.9. PYLON / MONUMENT SIGNS SHALL BE CONSTRUCTED BY OTHERS. SIGNS ARESHOWN FOR GRAPHICAL & INFORMATIONAL PURPOSES ONLY. CONTRACTOR TOVERIFY SIZE, LOCATION AND ANY REQUIRED PERMITS NECESSARY FOR THECONSTRUCTION OF THE PYLON / MONUMENT SIGN.10. CONTRACTOR SHALL REFERENCE ARCH / MEP PLANS FOR SITE LIGHTING ANDELECTRICAL PLAN.11. NO PROPOSED LANDSCAPING SUCH AS TREES OR SHRUBS, ABOVE ANDUNDERGROUND STRUCTURES, OR OTHER OBSTRUCTIONS SHALL BE LOCATEDWITHIN EXISTING OR PROPOSED UTILITY EASEMENTS AND RIGHTS OF WAY UNLESSSPECIFICALLY NOTED ON PLANS OTHERWISE.12. REFER TO FINAL PLAT OR ALTA SURVEY FOR EXACT LOT AND PROPERTYBOUNDARY DIMENSIONS.13. ALL AREAS ARE ROUNDED TO THE NEAREST SQUARE FOOT.14. ALL DIMENSIONS ARE ROUNDED TO THE NEAREST TENTH FOOT.15. ALL PARKING STALLS TO BE 9' IN WIDTH AND 18' IN LENGTH UNLESS OTHERWISEINDICATED.16. THERE ARE 1.485 ACRES OF WETLAND IMPACTS.NORTHKEYNOTE LEGENDCONCRETE SIDEWALKB612 CURB & GUTTER (TYP.)MATCH EXISTING EDGE OF PAVEMENT/ CURB & GUTTERACCESSIBLE CURB RAMPACCESSIBLE PARKING SIGNACCESSIBLE PARKINGAREA STRIPED WITH 4" SYSL @ 45° 2' O.C.STANDARD DUTY ASPHALT PAVEMENTLANDSCAPE AREA - SEE LANDSCAPE PLANSHEAVY DUTY ASPHALT PAVEMENTHEAVY DUTY CONCRETE PAVEMENTTIP-OUT GUTTERTRANSITION CURBFLAT CURBCOMMERCIAL DRIVEWAY APRONTRANSFORMER PADEXISTING STREET LIGHT POLE; LOCATION APPROXIMATE -CONTRACTOR TO VERIFY LOCATION IN FIELDREINSTALLED STREET LIGHT POLE ; COORD. W/ CITY OF ARDEN HILLSEXISTING SIGN; LOCATION APPROXIMATE - CONTRACTOR TOVERIFY LOCATION IN FIELDREINSTALLED EXISTING SIGNABCDEFGHIJKLMNOPQRST SimTraffic Performance Report Arden Hills Existing Conditions - AM SimTraffic Report Kimley-Horn March 2020 1: Round Lake Rd W/Arden Manor Way & Highway 96 Performance by movement Movement EBL EBT EBR WBL WBT WBR NBL NBT NBR SBL SBT SBR Denied Delay (hr) 0.0 0.0 0.2 0.1 0.0 0.0 0.1 0.0 0.1 0.0 0.0 0.0 Denied Del/Veh (s) 2.7 0.2 2.8 2.8 0.2 2.7 3.9 0.6 3.9 0.1 0.1 0.1 Total Delay (hr) 0.1 0.9 0.2 0.3 1.8 0.0 1.3 0.0 0.1 0.1 0.1 0.2 Total Del/Veh (s) 11.7 8.4 3.2 10.3 8.5 2.8 41.1 47.8 3.8 47.6 54.6 13.9 1: Round Lake Rd W/Arden Manor Way & Highway 96 Performance by movement Movement All Denied Delay (hr) 0.5 Denied Del/Veh (s) 1.1 Total Delay (hr) 5.1 Total Del/Veh (s) 10.4 2: Driveway 2/Space Center Driveway & Gateway Blvd Performance by movement Movement EBL EBT WBT SBR All Denied Delay (hr) 0.0 0.0 0.0 0.0 0.0 Denied Del/Veh (s) 0.0 0.0 0.0 0.1 0.0 Total Delay (hr) 0.0 0.0 0.0 0.0 0.0 Total Del/Veh (s) 1.7 0.1 0.6 2.6 1.2 3: Driveway 1 & Gateway Blvd Performance by movement Movement EBT WBT All Denied Delay (hr) 0.0 0.0 0.0 Denied Del/Veh (s) 0.1 0.0 0.1 Total Delay (hr) 0.0 0.0 0.0 Total Del/Veh (s) 0.0 0.2 0.0 4: Driveway3 & Gateway Blvd Performance by movement Movement EBT WBT All Denied Delay (hr) 0.0 0.0 0.0 Denied Del/Veh (s) 0.0 0.1 0.0 Total Delay (hr) 0.0 0.0 0.0 Total Del/Veh (s) 0.0 0.8 0.1 5: Driveway 4 & Gateway Blvd Performance by movement Movement EBT All Denied Delay (hr) 0.0 0.0 Denied Del/Veh (s) 0.0 0.0 Total Delay (hr) 0.0 0.0 Total Del/Veh (s) 0.0 0.0 SimTraffic Performance Report Arden Hills Existing Conditions - AM SimTraffic Report Kimley-Horn March 2020 Total Network Performance Denied Delay (hr) 0.5 Denied Del/Veh (s) 1.1 Total Delay (hr) 5.8 Total Del/Veh (s) 11.5 Queuing and Blocking Report Arden Hills Existing Conditions - AM SimTraffic Report Kimley-Horn March 2020 Intersection: 1: Round Lake Rd W/Arden Manor Way & Highway 96 Movement EB EB EB EB WB WB WB WB NB NB NB SB Directions Served LTTRLTTRLTRLTR Maximum Queue (ft) 56 160 122 96 88 176 156 34 182 22 54 119 Average Queue (ft) 14 65 36 34 35 74 48 3 86 2 21 39 95th Queue (ft) 43 133 89 73 71 146 118 17 157 12 45 87 Link Distance (ft) 1092 1092 1402 1402 831 423 Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) 250 250 250 225 250 250 Storage Blk Time (%) Queuing Penalty (veh) Intersection: 2: Driveway 2/Space Center Driveway & Gateway Blvd Movement SB Directions Served LTR Maximum Queue (ft) 29 Average Queue (ft) 2 95th Queue (ft) 16 Link Distance (ft) 428 Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) Storage Blk Time (%) Queuing Penalty (veh) Intersection: 3: Driveway 1 & Gateway Blvd Movement Directions Served Maximum Queue (ft) Average Queue (ft) 95th Queue (ft) Link Distance (ft) Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) Storage Blk Time (%) Queuing Penalty (veh) Queuing and Blocking Report Arden Hills Existing Conditions - AM SimTraffic Report Kimley-Horn March 2020 Intersection: 4: Driveway3 & Gateway Blvd Movement Directions Served Maximum Queue (ft) Average Queue (ft) 95th Queue (ft) Link Distance (ft) Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) Storage Blk Time (%) Queuing Penalty (veh) Intersection: 5: Driveway 4 & Gateway Blvd Movement Directions Served Maximum Queue (ft) Average Queue (ft) 95th Queue (ft) Link Distance (ft) Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) Storage Blk Time (%) Queuing Penalty (veh) Network Summary Network wide Queuing Penalty: 0 SimTraffic Performance Report Arden Hills Existing Conditions - PM SimTraffic Report Kimley-Horn March 2020 1: Round Lake Rd W/Arden Manor Way & Highway 96 Performance by movement Movement EBL EBT EBR WBL WBT WBR NBL NBT NBR SBL SBT SBR Denied Delay (hr) 0.0 0.0 0.1 0.0 0.0 0.0 0.2 0.0 0.1 0.0 0.0 0.0 Denied Del/Veh (s) 2.5 0.2 2.7 2.7 0.2 2.5 3.6 1.0 3.6 0.1 0.2 0.1 Total Delay (hr) 0.2 1.4 0.1 0.1 2.6 0.0 4.1 0.1 0.1 0.1 0.1 0.2 Total Del/Veh (s) 14.6 7.2 2.3 9.6 9.9 2.8 63.0 39.0 5.4 52.8 62.3 16.6 1: Round Lake Rd W/Arden Manor Way & Highway 96 Performance by movement Movement All Denied Delay (hr) 0.6 Denied Del/Veh (s) 0.9 Total Delay (hr) 9.1 Total Del/Veh (s) 14.9 2: Driveway 2/Space Center Driveway & Gateway Blvd Performance by movement Movement EBL EBT WBT SBL SBR All Denied Delay (hr) 0.0 0.0 0.0 0.0 0.0 0.0 Denied Del/Veh (s) 0.0 0.0 0.0 0.1 0.1 0.1 Total Delay (hr) 0.0 0.0 0.0 0.0 0.0 0.0 Total Del/Veh (s) 1.4 0.0 0.3 2.3 2.4 1.4 3: Driveway 1 & Gateway Blvd Performance by movement Movement EBT WBT All Denied Delay (hr) 0.0 0.0 0.0 Denied Del/Veh (s) 0.1 0.0 0.0 Total Delay (hr) 0.0 0.0 0.0 Total Del/Veh (s) 0.0 0.2 0.1 4: Driveway3 & Gateway Blvd Performance by movement Movement EBT WBT All Denied Delay (hr) 0.0 0.0 0.0 Denied Del/Veh (s) 0.0 0.1 0.1 Total Delay (hr) 0.0 0.0 0.0 Total Del/Veh (s) 0.0 0.7 0.5 5: Driveway 4 & Gateway Blvd Performance by movement Movement EBT All Denied Delay (hr) 0.0 0.0 Denied Del/Veh (s) 0.0 0.0 Total Delay (hr) 0.0 0.0 Total Del/Veh (s) 0.0 0.0 SimTraffic Performance Report Arden Hills Existing Conditions - PM SimTraffic Report Kimley-Horn March 2020 Total Network Performance Denied Delay (hr) 0.6 Denied Del/Veh (s) 0.9 Total Delay (hr) 10.2 Total Del/Veh (s) 16.1 Queuing and Blocking Report Arden Hills Existing Conditions - PM SimTraffic Report Kimley-Horn March 2020 Intersection: 1: Round Lake Rd W/Arden Manor Way & Highway 96 Movement EB EB EB EB WB WB WB WB NB NB NB SB Directions Served LTTRLTTRLTRLTR Maximum Queue (ft) 68 183 173 57 52 227 195 27 317 108 74 96 Average Queue (ft) 26 94 60 17 16 103 72 2 178 13 30 31 95th Queue (ft) 57 162 133 45 41 188 160 13 293 118 54 72 Link Distance (ft) 1092 1092 1402 1402 831 423 Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) 250 250 250 225 250 250 Storage Blk Time (%) 0 0 0 5 Queuing Penalty (veh) 0 0 0 5 Intersection: 2: Driveway 2/Space Center Driveway & Gateway Blvd Movement SB Directions Served LTR Maximum Queue (ft) 44 Average Queue (ft) 16 95th Queue (ft) 41 Link Distance (ft) 428 Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) Storage Blk Time (%) Queuing Penalty (veh) Intersection: 3: Driveway 1 & Gateway Blvd Movement Directions Served Maximum Queue (ft) Average Queue (ft) 95th Queue (ft) Link Distance (ft) Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) Storage Blk Time (%) Queuing Penalty (veh) Queuing and Blocking Report Arden Hills Existing Conditions - PM SimTraffic Report Kimley-Horn March 2020 Intersection: 4: Driveway3 & Gateway Blvd Movement Directions Served Maximum Queue (ft) Average Queue (ft) 95th Queue (ft) Link Distance (ft) Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) Storage Blk Time (%) Queuing Penalty (veh) Intersection: 5: Driveway 4 & Gateway Blvd Movement Directions Served Maximum Queue (ft) Average Queue (ft) 95th Queue (ft) Link Distance (ft) Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) Storage Blk Time (%) Queuing Penalty (veh) Network Summary Network wide Queuing Penalty: 5 SimTraffic Performance Report Arden Hills No Build 2021 Conditions - AM SimTraffic Report Kimley-Horn March 2020 1: Round Lake Rd W/Arden Manor Way & Highway 96 Performance by movement Movement EBL EBT EBR WBL WBT WBR NBL NBT NBR SBL SBT SBR Denied Delay (hr) 0.0 0.0 0.2 0.1 0.0 0.0 0.1 0.0 0.1 0.0 0.0 0.0 Denied Del/Veh (s) 2.7 0.2 2.8 2.8 0.2 2.4 3.9 0.4 3.9 0.1 0.1 0.1 Total Delay (hr) 0.1 1.0 0.2 0.4 1.8 0.0 1.3 0.1 0.1 0.1 0.1 0.2 Total Del/Veh (s) 11.0 8.6 3.4 11.0 8.3 2.6 40.6 47.3 3.8 45.7 47.0 11.9 1: Round Lake Rd W/Arden Manor Way & Highway 96 Performance by movement Movement All Denied Delay (hr) 0.5 Denied Del/Veh (s) 1.1 Total Delay (hr) 5.2 Total Del/Veh (s) 10.4 2: Driveway 2/Space Center Driveway & Gateway Blvd Performance by movement Movement EBL EBT WBT SBR All Denied Delay (hr) 0.0 0.0 0.0 0.0 0.0 Denied Del/Veh (s) 0.0 0.0 0.0 0.1 0.0 Total Delay (hr) 0.0 0.0 0.0 0.0 0.0 Total Del/Veh (s) 1.7 0.1 0.6 2.0 1.3 3: Driveway 1 & Gateway Blvd Performance by movement Movement EBT WBT All Denied Delay (hr) 0.0 0.0 0.0 Denied Del/Veh (s) 0.1 0.0 0.1 Total Delay (hr) 0.0 0.0 0.0 Total Del/Veh (s) 0.0 0.1 0.0 4: Driveway3 & Gateway Blvd Performance by movement Movement EBT WBT All Denied Delay (hr) 0.0 0.0 0.0 Denied Del/Veh (s) 0.0 0.1 0.0 Total Delay (hr) 0.0 0.0 0.0 Total Del/Veh (s) 0.0 1.0 0.1 5: Driveway 4 & Gateway Blvd Performance by movement Movement EBT All Denied Delay (hr) 0.0 0.0 Denied Del/Veh (s) 0.0 0.0 Total Delay (hr) 0.0 0.0 Total Del/Veh (s) 0.0 0.0 SimTraffic Performance Report Arden Hills No Build 2021 Conditions - AM SimTraffic Report Kimley-Horn March 2020 Total Network Performance Denied Delay (hr) 0.5 Denied Del/Veh (s) 1.1 Total Delay (hr) 5.9 Total Del/Veh (s) 11.6 Queuing and Blocking Report Arden Hills No Build 2021 Conditions - AM SimTraffic Report Kimley-Horn March 2020 Intersection: 1: Round Lake Rd W/Arden Manor Way & Highway 96 Movement EB EB EB EB WB WB WB WB NB NB NB SB Directions Served LTTRLTTRLTRLTR Maximum Queue (ft) 45 157 130 109 95 178 149 38 187 26 53 118 Average Queue (ft) 13 70 38 40 36 76 49 2 85 3 21 37 95th Queue (ft) 40 137 96 83 74 150 118 15 154 18 45 84 Link Distance (ft) 1092 1092 1402 1402 831 423 Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) 250 250 250 225 250 250 Storage Blk Time (%) 0 Queuing Penalty (veh) 0 Intersection: 2: Driveway 2/Space Center Driveway & Gateway Blvd Movement SB Directions Served LTR Maximum Queue (ft) 22 Average Queue (ft) 2 95th Queue (ft) 13 Link Distance (ft) 428 Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) Storage Blk Time (%) Queuing Penalty (veh) Intersection: 3: Driveway 1 & Gateway Blvd Movement Directions Served Maximum Queue (ft) Average Queue (ft) 95th Queue (ft) Link Distance (ft) Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) Storage Blk Time (%) Queuing Penalty (veh) Queuing and Blocking Report Arden Hills No Build 2021 Conditions - AM SimTraffic Report Kimley-Horn March 2020 Intersection: 4: Driveway3 & Gateway Blvd Movement Directions Served Maximum Queue (ft) Average Queue (ft) 95th Queue (ft) Link Distance (ft) Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) Storage Blk Time (%) Queuing Penalty (veh) Intersection: 5: Driveway 4 & Gateway Blvd Movement Directions Served Maximum Queue (ft) Average Queue (ft) 95th Queue (ft) Link Distance (ft) Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) Storage Blk Time (%) Queuing Penalty (veh) Network Summary Network wide Queuing Penalty: 0 SimTraffic Performance Report Arden Hills No Build 2021 Conditions - PM SimTraffic Report Kimley-Horn March 2020 1: Round Lake Rd W/Arden Manor Way & Highway 96 Performance by movement Movement EBL EBT EBR WBL WBT WBR NBL NBT NBR SBL SBT SBR Denied Delay (hr) 0.0 0.0 0.1 0.0 0.0 0.0 0.2 0.0 0.1 0.0 0.0 0.0 Denied Del/Veh (s) 2.6 0.2 2.7 2.7 0.2 2.7 3.6 0.8 3.6 0.2 0.2 0.1 Total Delay (hr) 0.2 1.5 0.1 0.1 2.6 0.0 4.1 0.1 0.1 0.2 0.1 0.2 Total Del/Veh (s) 14.4 7.7 2.2 10.6 10.1 2.7 61.7 40.0 5.3 52.1 64.1 16.0 1: Round Lake Rd W/Arden Manor Way & Highway 96 Performance by movement Movement All Denied Delay (hr) 0.6 Denied Del/Veh (s) 0.9 Total Delay (hr) 9.2 Total Del/Veh (s) 14.9 2: Driveway 2/Space Center Driveway & Gateway Blvd Performance by movement Movement EBL EBT WBT SBL SBR All Denied Delay (hr) 0.0 0.0 0.0 0.0 0.0 0.0 Denied Del/Veh (s) 0.0 0.0 0.0 0.1 0.1 0.1 Total Delay (hr) 0.0 0.0 0.0 0.0 0.0 0.0 Total Del/Veh (s) 1.8 0.0 0.2 3.5 2.4 1.5 3: Driveway 1 & Gateway Blvd Performance by movement Movement EBT WBT All Denied Delay (hr) 0.0 0.0 0.0 Denied Del/Veh (s) 0.1 0.0 0.0 Total Delay (hr) 0.0 0.0 0.0 Total Del/Veh (s) 0.0 0.2 0.1 4: Driveway3 & Gateway Blvd Performance by movement Movement EBT WBT All Denied Delay (hr) 0.0 0.0 0.0 Denied Del/Veh (s) 0.0 0.1 0.1 Total Delay (hr) 0.0 0.0 0.0 Total Del/Veh (s) 0.1 0.7 0.5 5: Driveway 4 & Gateway Blvd Performance by movement Movement EBT All Denied Delay (hr) 0.0 0.0 Denied Del/Veh (s) 0.0 0.0 Total Delay (hr) 0.0 0.0 Total Del/Veh (s) 0.0 0.0 SimTraffic Performance Report Arden Hills No Build 2021 Conditions - PM SimTraffic Report Kimley-Horn March 2020 Total Network Performance Denied Delay (hr) 0.6 Denied Del/Veh (s) 0.9 Total Delay (hr) 10.3 Total Del/Veh (s) 16.2 Queuing and Blocking Report Arden Hills No Build 2021 Conditions - PM SimTraffic Report Kimley-Horn March 2020 Intersection: 1: Round Lake Rd W/Arden Manor Way & Highway 96 Movement EB EB EB EB WB WB WB WB NB NB NB SB Directions Served LTTRLTTRLTRLTR Maximum Queue (ft) 67 193 188 52 54 208 180 26 338 137 72 106 Average Queue (ft) 25 99 63 15 17 105 74 3 179 9 30 32 95th Queue (ft) 56 171 141 42 41 187 155 14 299 81 55 73 Link Distance (ft) 1092 1092 1402 1402 831 423 Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) 250 250 250 225 250 250 Storage Blk Time (%) 0 0 5 Queuing Penalty (veh) 0 0 6 Intersection: 2: Driveway 2/Space Center Driveway & Gateway Blvd Movement SB Directions Served LTR Maximum Queue (ft) 54 Average Queue (ft) 16 95th Queue (ft) 44 Link Distance (ft) 428 Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) Storage Blk Time (%) Queuing Penalty (veh) Intersection: 3: Driveway 1 & Gateway Blvd Movement Directions Served Maximum Queue (ft) Average Queue (ft) 95th Queue (ft) Link Distance (ft) Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) Storage Blk Time (%) Queuing Penalty (veh) Queuing and Blocking Report Arden Hills No Build 2021 Conditions - PM SimTraffic Report Kimley-Horn March 2020 Intersection: 4: Driveway3 & Gateway Blvd Movement Directions Served Maximum Queue (ft) Average Queue (ft) 95th Queue (ft) Link Distance (ft) Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) Storage Blk Time (%) Queuing Penalty (veh) Intersection: 5: Driveway 4 & Gateway Blvd Movement Directions Served Maximum Queue (ft) Average Queue (ft) 95th Queue (ft) Link Distance (ft) Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) Storage Blk Time (%) Queuing Penalty (veh) Network Summary Network wide Queuing Penalty: 6 SimTraffic Performance Report Arden Hills Build 2021 Conditions - AM SimTraffic Report Kimley-Horn March 2020 1: Round Lake Rd W/Arden Manor Way & Highway 96 Performance by movement Movement EBL EBT EBR WBL WBT WBR NBL NBT NBR SBL SBT SBR Denied Delay (hr) 0.0 0.0 0.2 0.1 0.0 0.0 0.1 0.0 0.1 0.0 0.0 0.0 Denied Del/Veh (s) 2.5 0.2 2.8 2.7 0.2 2.7 3.9 0.4 3.8 0.1 0.2 0.2 Total Delay (hr) 0.1 1.0 0.3 0.4 1.8 0.0 1.4 0.0 0.1 0.1 0.1 0.2 Total Del/Veh (s) 10.9 8.8 3.8 11.4 8.5 2.9 41.7 36.7 3.9 54.3 52.5 13.4 1: Round Lake Rd W/Arden Manor Way & Highway 96 Performance by movement Movement All Denied Delay (hr) 0.6 Denied Del/Veh (s) 1.2 Total Delay (hr) 5.6 Total Del/Veh (s) 10.6 2: Gateway Blvd & Space Center Driveway Performance by movement Movement EBL EBT WBT SBR All Denied Delay (hr) 0.0 0.0 0.0 0.0 0.0 Denied Del/Veh (s) 0.0 0.0 0.0 0.1 0.0 Total Delay (hr) 0.0 0.0 0.0 0.0 0.0 Total Del/Veh (s) 1.8 0.2 0.2 2.4 0.7 3: Driveway A & Gateway Blvd Performance by movement Movement EBT EBR WBT NBL All Denied Delay (hr) 0.0 0.0 0.0 0.0 0.0 Denied Del/Veh (s) 0.1 0.1 0.0 0.1 0.1 Total Delay (hr) 0.0 0.0 0.0 0.0 0.0 Total Del/Veh (s) 0.3 0.1 0.1 4.0 0.5 4: Driveway B & Gateway Blvd Performance by movement Movement EBT EBR WBT NBL All Denied Delay (hr) 0.0 0.0 0.0 0.0 0.0 Denied Del/Veh (s) 0.0 0.0 0.0 0.1 0.0 Total Delay (hr) 0.0 0.0 0.0 0.0 0.0 Total Del/Veh (s) 0.0 0.0 0.5 3.6 0.3 5: Driveway C & Gateway Blvd Performance by movement Movement EBT EBR NBL All Denied Delay (hr) 0.0 0.0 0.0 0.0 Denied Del/Veh (s) 0.0 0.0 0.1 0.0 Total Delay (hr) 0.0 0.0 0.0 0.0 Total Del/Veh (s) 0.0 0.1 3.9 0.5 SimTraffic Performance Report Arden Hills Build 2021 Conditions - AM SimTraffic Report Kimley-Horn March 2020 Total Network Performance Denied Delay (hr) 0.6 Denied Del/Veh (s) 1.1 Total Delay (hr) 6.3 Total Del/Veh (s) 11.4 Queuing and Blocking Report Arden Hills Build 2021 Conditions - AM SimTraffic Report Kimley-Horn March 2020 Intersection: 1: Round Lake Rd W/Arden Manor Way & Highway 96 Movement EB EB EB EB WB WB WB WB NB NB NB SB Directions Served LTTRLTTRLTRLTR Maximum Queue (ft) 56 152 126 112 105 167 141 26 182 23 53 114 Average Queue (ft) 14 70 40 46 43 74 51 2 89 2 22 36 95th Queue (ft) 43 129 95 88 82 139 113 11 157 15 46 82 Link Distance (ft) 1092 1092 1402 1402 831 423 Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) 250 250 250 225 250 250 Storage Blk Time (%) Queuing Penalty (veh) Intersection: 2: Gateway Blvd & Space Center Driveway Movement EB SB Directions Served LT LR Maximum Queue (ft) 3 29 Average Queue (ft) 0 2 95th Queue (ft) 3 13 Link Distance (ft) 339 429 Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) Storage Blk Time (%) Queuing Penalty (veh) Intersection: 3: Driveway A & Gateway Blvd Movement NB Directions Served LR Maximum Queue (ft) 29 Average Queue (ft) 6 95th Queue (ft) 25 Link Distance (ft) 493 Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) Storage Blk Time (%) Queuing Penalty (veh) Queuing and Blocking Report Arden Hills Build 2021 Conditions - AM SimTraffic Report Kimley-Horn March 2020 Intersection: 4: Driveway B & Gateway Blvd Movement NB Directions Served LR Maximum Queue (ft) 32 Average Queue (ft) 2 95th Queue (ft) 17 Link Distance (ft) 472 Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) Storage Blk Time (%) Queuing Penalty (veh) Intersection: 5: Driveway C & Gateway Blvd Movement NB Directions Served LT Maximum Queue (ft) 31 Average Queue (ft) 4 95th Queue (ft) 20 Link Distance (ft) 380 Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) Storage Blk Time (%) Queuing Penalty (veh) Network Summary Network wide Queuing Penalty: 0 SimTraffic Performance Report Arden Hills Build 2021 Conditions - AM SimTraffic Report Kimley-Horn March 2020 1: Round Lake Rd W/Arden Manor Way & Highway 96 Performance by movement Movement EBL EBT EBR WBL WBT WBR NBL NBT NBR SBL SBT SBR Denied Delay (hr) 0.0 0.0 0.2 0.1 0.0 0.0 0.1 0.0 0.1 0.0 0.0 0.0 Denied Del/Veh (s) 2.5 0.2 2.8 2.7 0.2 2.7 3.9 0.4 3.8 0.1 0.2 0.2 Total Delay (hr) 0.1 1.0 0.3 0.4 1.8 0.0 1.4 0.0 0.1 0.1 0.1 0.2 Total Del/Veh (s) 10.9 8.8 3.8 11.4 8.5 2.9 41.7 36.7 3.9 54.3 52.5 13.4 1: Round Lake Rd W/Arden Manor Way & Highway 96 Performance by movement Movement All Denied Delay (hr) 0.6 Denied Del/Veh (s) 1.2 Total Delay (hr) 5.6 Total Del/Veh (s) 10.6 2: Gateway Blvd & Space Center Driveway Performance by movement Movement EBL EBT WBT SBR All Denied Delay (hr) 0.0 0.0 0.0 0.0 0.0 Denied Del/Veh (s) 0.0 0.0 0.0 0.1 0.0 Total Delay (hr) 0.0 0.0 0.0 0.0 0.0 Total Del/Veh (s) 1.8 0.2 0.2 2.4 0.7 3: Driveway A & Gateway Blvd Performance by movement Movement EBT EBR WBT NBL All Denied Delay (hr) 0.0 0.0 0.0 0.0 0.0 Denied Del/Veh (s) 0.1 0.1 0.0 0.1 0.1 Total Delay (hr) 0.0 0.0 0.0 0.0 0.0 Total Del/Veh (s) 0.3 0.1 0.1 4.0 0.5 4: Driveway B & Gateway Blvd Performance by movement Movement EBT EBR WBT NBL All Denied Delay (hr) 0.0 0.0 0.0 0.0 0.0 Denied Del/Veh (s) 0.0 0.0 0.0 0.1 0.0 Total Delay (hr) 0.0 0.0 0.0 0.0 0.0 Total Del/Veh (s) 0.0 0.0 0.5 3.6 0.3 5: Driveway C & Gateway Blvd Performance by movement Movement EBT EBR NBL All Denied Delay (hr) 0.0 0.0 0.0 0.0 Denied Del/Veh (s) 0.0 0.0 0.1 0.0 Total Delay (hr) 0.0 0.0 0.0 0.0 Total Del/Veh (s) 0.0 0.1 3.9 0.5 SimTraffic Performance Report Arden Hills Build 2021 Conditions - AM SimTraffic Report Kimley-Horn March 2020 Total Network Performance Denied Delay (hr) 0.6 Denied Del/Veh (s) 1.1 Total Delay (hr) 6.3 Total Del/Veh (s) 11.4 Queuing and Blocking Report Arden Hills Build 2021 Conditions - AM SimTraffic Report Kimley-Horn March 2020 Intersection: 1: Round Lake Rd W/Arden Manor Way & Highway 96 Movement EB EB EB EB WB WB WB WB NB NB NB SB Directions Served LTTRLTTRLTRLTR Maximum Queue (ft) 56 152 126 112 105 167 141 26 182 23 53 114 Average Queue (ft) 14 70 40 46 43 74 51 2 89 2 22 36 95th Queue (ft) 43 129 95 88 82 139 113 11 157 15 46 82 Link Distance (ft) 1092 1092 1402 1402 831 423 Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) 250 250 250 225 250 250 Storage Blk Time (%) Queuing Penalty (veh) Intersection: 2: Gateway Blvd & Space Center Driveway Movement EB SB Directions Served LT LR Maximum Queue (ft) 3 29 Average Queue (ft) 0 2 95th Queue (ft) 3 14 Link Distance (ft) 339 429 Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) Storage Blk Time (%) Queuing Penalty (veh) Intersection: 3: Driveway A & Gateway Blvd Movement NB Directions Served LR Maximum Queue (ft) 29 Average Queue (ft) 6 95th Queue (ft) 25 Link Distance (ft) 493 Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) Storage Blk Time (%) Queuing Penalty (veh) Queuing and Blocking Report Arden Hills Build 2021 Conditions - AM SimTraffic Report Kimley-Horn March 2020 Intersection: 4: Driveway B & Gateway Blvd Movement NB Directions Served LR Maximum Queue (ft) 32 Average Queue (ft) 2 95th Queue (ft) 17 Link Distance (ft) 472 Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) Storage Blk Time (%) Queuing Penalty (veh) Intersection: 5: Driveway C & Gateway Blvd Movement NB Directions Served LT Maximum Queue (ft) 31 Average Queue (ft) 4 95th Queue (ft) 20 Link Distance (ft) 380 Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) Storage Blk Time (%) Queuing Penalty (veh) Network Summary Network wide Queuing Penalty: 0 SimTraffic Performance Report Arden Hills Build 2021 Conditions - PM SimTraffic Report Kimley-Horn March 2020 1: Round Lake Rd W/Arden Manor Way & Highway 96 Performance by movement Movement EBL EBT EBR WBL WBT WBR NBL NBT NBR SBL SBT SBR Denied Delay (hr) 0.0 0.0 0.1 0.0 0.1 0.0 0.3 0.0 0.1 0.0 0.0 0.0 Denied Del/Veh (s) 2.6 0.2 2.6 2.7 0.2 2.4 3.6 1.1 3.6 0.1 0.1 0.1 Total Delay (hr) 0.2 1.6 0.1 0.2 2.7 0.0 7.4 0.1 0.4 0.1 0.1 0.2 Total Del/Veh (s) 16.0 8.2 2.3 11.1 10.3 3.0 96.5 43.5 11.7 49.1 60.3 17.4 1: Round Lake Rd W/Arden Manor Way & Highway 96 Performance by movement Movement All Denied Delay (hr) 0.6 Denied Del/Veh (s) 1.0 Total Delay (hr) 13.1 Total Del/Veh (s) 20.2 2: Gateway Blvd & Space Center Driveway Performance by movement Movement EBL EBT WBT SBL SBR All Denied Delay (hr) 0.0 0.0 0.0 0.0 0.0 0.0 Denied Del/Veh (s) 0.0 0.0 0.0 0.1 0.0 Total Delay (hr) 0.0 0.0 0.0 0.0 0.0 0.0 Total Del/Veh (s) 1.9 0.0 0.2 2.6 1.0 3: Driveway A & Gateway Blvd Performance by movement Movement EBT EBR WBT NBL All Denied Delay (hr) 0.0 0.0 0.0 0.0 0.0 Denied Del/Veh (s) 0.2 0.1 0.0 0.1 0.1 Total Delay (hr) 0.0 0.0 0.0 0.0 0.1 Total Del/Veh (s) 0.1 0.0 0.2 4.8 1.4 4: Driveway B & Gateway Blvd Performance by movement Movement EBT EBR WBT NBL All Denied Delay (hr) 0.0 0.0 0.0 0.0 0.0 Denied Del/Veh (s) 0.0 0.0 0.0 0.1 0.0 Total Delay (hr) 0.0 0.0 0.0 0.0 0.0 Total Del/Veh (s) 0.0 0.0 0.5 4.2 0.7 5: Driveway C & Gateway Blvd Performance by movement Movement EBT EBR NBL All Denied Delay (hr) 0.0 0.0 0.0 0.0 Denied Del/Veh (s) 0.0 0.0 0.1 0.1 Total Delay (hr) 0.0 0.0 0.0 0.0 Total Del/Veh (s) 0.0 0.0 4.3 2.8 SimTraffic Performance Report Arden Hills Build 2021 Conditions - PM SimTraffic Report Kimley-Horn March 2020 Total Network Performance Denied Delay (hr) 0.6 Denied Del/Veh (s) 0.9 Total Delay (hr) 14.4 Total Del/Veh (s) 20.9 Queuing and Blocking Report Arden Hills Build 2021 Conditions - PM SimTraffic Report Kimley-Horn March 2020 Intersection: 1: Round Lake Rd W/Arden Manor Way & Highway 96 Movement EB EB EB EB WB WB WB WB NB NB NB SB Directions Served LTTRLTTRLTRLTR Maximum Queue (ft) 77 210 171 56 62 232 221 25 399 502 191 90 Average Queue (ft) 27 103 71 19 21 101 79 2 242 98 44 28 95th Queue (ft) 60 180 151 48 48 188 172 13 409 447 127 66 Link Distance (ft) 1092 1092 1402 1402 831 423 Upstream Blk Time (%)0 Queuing Penalty (veh)0 Storage Bay Dist (ft) 250 250 250 225 250 250 Storage Blk Time (%) 0 0 0 25 0 Queuing Penalty (veh) 0 0 0 32 0 Intersection: 2: Gateway Blvd & Space Center Driveway Movement EB SB Directions Served LT LR Maximum Queue (ft) 3 56 Average Queue (ft) 0 18 95th Queue (ft) 3 46 Link Distance (ft) 339 429 Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) Storage Blk Time (%) Queuing Penalty (veh) Intersection: 3: Driveway A & Gateway Blvd Movement NB Directions Served LR Maximum Queue (ft) 49 Average Queue (ft) 20 95th Queue (ft) 45 Link Distance (ft) 493 Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) Storage Blk Time (%) Queuing Penalty (veh) Queuing and Blocking Report Arden Hills Build 2021 Conditions - PM SimTraffic Report Kimley-Horn March 2020 Intersection: 4: Driveway B & Gateway Blvd Movement NB Directions Served LR Maximum Queue (ft) 49 Average Queue (ft) 5 95th Queue (ft) 26 Link Distance (ft) 474 Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) Storage Blk Time (%) Queuing Penalty (veh) Intersection: 5: Driveway C & Gateway Blvd Movement NB Directions Served LT Maximum Queue (ft) 45 Average Queue (ft) 16 95th Queue (ft) 43 Link Distance (ft) 382 Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) Storage Blk Time (%) Queuing Penalty (veh) Network Summary Network wide Queuing Penalty: 33 SimTraffic Performance Report Arden Hills Build 2021 IMP Conditions - PM SimTraffic Report Kimley-Horn March 2020 1: Round Lake Rd W/Arden Manor Way & Highway 96 Performance by movement Movement EBL EBT EBR WBL WBT WBR NBL NBT NBR SBL SBT SBR Denied Delay (hr) 0.0 0.0 0.1 0.0 0.1 0.0 0.3 0.0 0.1 0.0 0.0 0.0 Denied Del/Veh (s) 2.6 0.2 2.5 2.6 0.2 2.6 3.6 1.0 3.6 0.1 0.1 0.1 Total Delay (hr) 0.2 1.9 0.1 0.2 3.1 0.0 3.9 0.1 0.2 0.1 0.1 0.2 Total Del/Veh (s) 16.6 10.1 2.6 12.7 11.9 2.9 49.6 33.1 5.6 45.2 55.4 14.8 1: Round Lake Rd W/Arden Manor Way & Highway 96 Performance by movement Movement All Denied Delay (hr) 0.6 Denied Del/Veh (s) 1.0 Total Delay (hr) 10.0 Total Del/Veh (s) 15.6 2: Gateway Blvd & Space Center Driveway Performance by movement Movement EBL EBT WBT SBL SBR All Denied Delay (hr) 0.0 0.0 0.0 0.0 0.0 0.0 Denied Del/Veh (s) 0.0 0.0 0.0 0.1 0.1 0.0 Total Delay (hr) 0.0 0.0 0.0 0.0 0.0 0.0 Total Del/Veh (s) 2.1 0.1 0.2 3.9 2.7 1.1 3: Driveway A & Gateway Blvd Performance by movement Movement EBT EBR WBT NBL All Denied Delay (hr) 0.0 0.0 0.0 0.0 0.0 Denied Del/Veh (s) 0.1 0.1 0.0 0.1 0.1 Total Delay (hr) 0.0 0.0 0.0 0.0 0.1 Total Del/Veh (s) 0.1 0.0 0.2 4.8 1.4 4: Driveway B & Gateway Blvd Performance by movement Movement EBT EBR WBT NBL All Denied Delay (hr) 0.0 0.0 0.0 0.0 0.0 Denied Del/Veh (s) 0.0 0.0 0.0 0.1 0.0 Total Delay (hr) 0.0 0.0 0.0 0.0 0.0 Total Del/Veh (s) 0.1 0.0 0.4 4.3 0.7 5: Driveway C & Gateway Blvd Performance by movement Movement EBT EBR NBL All Denied Delay (hr) 0.0 0.0 0.0 0.0 Denied Del/Veh (s) 0.0 0.0 0.1 0.1 Total Delay (hr) 0.0 0.0 0.0 0.0 Total Del/Veh (s) 0.0 0.0 4.3 2.9 SimTraffic Performance Report Arden Hills Build 2021 IMP Conditions - PM SimTraffic Report Kimley-Horn March 2020 Total Network Performance Denied Delay (hr) 0.6 Denied Del/Veh (s) 1.0 Total Delay (hr) 11.3 Total Del/Veh (s) 16.6 Queuing and Blocking Report Arden Hills Build 2021 IMP Conditions - PM SimTraffic Report Kimley-Horn March 2020 Intersection: 1: Round Lake Rd W/Arden Manor Way & Highway 96 Movement EB EB EB EB WB WB WB WB NB NB NB SB Directions Served LTTRLTTRLTRLTR Maximum Queue (ft) 62 237 216 58 57 236 208 27 346 116 99 88 Average Queue (ft) 26 115 84 19 21 112 87 3 188 10 36 29 95th Queue (ft) 57 202 176 47 46 200 180 15 296 76 70 68 Link Distance (ft) 1092 1092 1402 1402 831 423 Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) 250 250 250 225 250 250 Storage Blk Time (%) 0 0 0 0 4 0 Queuing Penalty (veh) 0 0 0 0 6 0 Intersection: 2: Gateway Blvd & Space Center Driveway Movement EB SB Directions Served LT LR Maximum Queue (ft) 12 55 Average Queue (ft) 0 18 95th Queue (ft) 7 45 Link Distance (ft) 339 429 Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) Storage Blk Time (%) Queuing Penalty (veh) Intersection: 3: Driveway A & Gateway Blvd Movement NB Directions Served LR Maximum Queue (ft) 38 Average Queue (ft) 19 95th Queue (ft) 43 Link Distance (ft) 493 Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) Storage Blk Time (%) Queuing Penalty (veh) Queuing and Blocking Report Arden Hills Build 2021 IMP Conditions - PM SimTraffic Report Kimley-Horn March 2020 Intersection: 4: Driveway B & Gateway Blvd Movement NB Directions Served LR Maximum Queue (ft) 45 Average Queue (ft) 5 95th Queue (ft) 27 Link Distance (ft) 472 Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) Storage Blk Time (%) Queuing Penalty (veh) Intersection: 5: Driveway C & Gateway Blvd Movement NB Directions Served LT Maximum Queue (ft) 38 Average Queue (ft) 15 95th Queue (ft) 41 Link Distance (ft) 381 Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) Storage Blk Time (%) Queuing Penalty (veh) Network Summary Network wide Queuing Penalty: 6 SimTraffic Performance Report Arden Hills No Build 2040 Conditions - AM SimTraffic Report Kimley-Horn March 2020 1: Round Lake Rd W/Arden Manor Way & Highway 96 Performance by movement Movement EBL EBT EBR WBL WBT WBR NBL NBT NBR SBL SBT SBR Denied Delay (hr) 0.0 0.0 0.2 0.1 0.1 0.0 0.1 0.0 0.1 0.0 0.0 0.0 Denied Del/Veh (s) 2.5 0.2 2.8 2.7 0.2 2.9 3.9 0.5 3.9 0.2 0.1 0.2 Total Delay (hr) 0.1 1.1 0.3 0.4 2.1 0.0 1.3 0.0 0.1 0.1 0.1 0.2 Total Del/Veh (s) 12.7 9.2 3.8 11.9 9.1 2.5 39.2 36.8 3.9 50.2 49.9 13.7 1: Round Lake Rd W/Arden Manor Way & Highway 96 Performance by movement Movement All Denied Delay (hr) 0.6 Denied Del/Veh (s) 1.1 Total Delay (hr) 5.9 Total Del/Veh (s) 10.8 2: Driveway 2/Space Center Driveway & Gateway Blvd Performance by movement Movement EBL EBT WBT SBR All Denied Delay (hr) 0.0 0.0 0.0 0.0 0.0 Denied Del/Veh (s) 0.0 0.0 0.0 0.1 0.0 Total Delay (hr) 0.0 0.0 0.0 0.0 0.0 Total Del/Veh (s) 1.6 0.1 0.3 2.5 1.2 3: Driveway 1 & Gateway Blvd Performance by movement Movement EBT WBT All Denied Delay (hr) 0.0 0.0 0.0 Denied Del/Veh (s) 0.1 0.0 0.1 Total Delay (hr) 0.0 0.0 0.0 Total Del/Veh (s) 0.0 0.2 0.0 4: Driveway3 & Gateway Blvd Performance by movement Movement EBT WBT All Denied Delay (hr) 0.0 0.0 0.0 Denied Del/Veh (s) 0.0 0.1 0.0 Total Delay (hr) 0.0 0.0 0.0 Total Del/Veh (s) 0.0 0.6 0.1 5: Driveway 4 & Gateway Blvd Performance by movement Movement EBT All Denied Delay (hr) 0.0 0.0 Denied Del/Veh (s) 0.0 0.0 Total Delay (hr) 0.0 0.0 Total Del/Veh (s) 0.0 0.0 SimTraffic Performance Report Arden Hills No Build 2040 Conditions - AM SimTraffic Report Kimley-Horn March 2020 Total Network Performance Denied Delay (hr) 0.6 Denied Del/Veh (s) 1.1 Total Delay (hr) 6.7 Total Del/Veh (s) 12.0 Queuing and Blocking Report Arden Hills No Build 2040 Conditions - AM SimTraffic Report Kimley-Horn March 2020 Intersection: 1: Round Lake Rd W/Arden Manor Way & Highway 96 Movement EB EB EB EB WB WB WB WB NB NB NB SB Directions Served LTTRLTTRLTRLTR Maximum Queue (ft) 61 159 142 103 121 189 172 36 203 24 53 118 Average Queue (ft) 16 74 43 44 43 84 59 3 88 2 22 40 95th Queue (ft) 45 136 101 83 88 162 133 16 164 14 44 86 Link Distance (ft) 1092 1092 1402 1402 831 423 Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) 250 250 250 225 250 250 Storage Blk Time (%) 0 0 Queuing Penalty (veh) 0 0 Intersection: 2: Driveway 2/Space Center Driveway & Gateway Blvd Movement SB Directions Served LTR Maximum Queue (ft) 29 Average Queue (ft) 2 95th Queue (ft) 15 Link Distance (ft) 428 Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) Storage Blk Time (%) Queuing Penalty (veh) Intersection: 3: Driveway 1 & Gateway Blvd Movement Directions Served Maximum Queue (ft) Average Queue (ft) 95th Queue (ft) Link Distance (ft) Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) Storage Blk Time (%) Queuing Penalty (veh) Queuing and Blocking Report Arden Hills No Build 2040 Conditions - AM SimTraffic Report Kimley-Horn March 2020 Intersection: 4: Driveway3 & Gateway Blvd Movement Directions Served Maximum Queue (ft) Average Queue (ft) 95th Queue (ft) Link Distance (ft) Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) Storage Blk Time (%) Queuing Penalty (veh) Intersection: 5: Driveway 4 & Gateway Blvd Movement Directions Served Maximum Queue (ft) Average Queue (ft) 95th Queue (ft) Link Distance (ft) Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) Storage Blk Time (%) Queuing Penalty (veh) Network Summary Network wide Queuing Penalty: 0 SimTraffic Performance Report Arden Hills No Build 2040 Conditions - PM SimTraffic Report Kimley-Horn March 2020 1: Round Lake Rd W/Arden Manor Way & Highway 96 Performance by movement Movement EBL EBT EBR WBL WBT WBR NBL NBT NBR SBL SBT SBR Denied Delay (hr) 0.0 0.0 0.1 0.0 0.1 0.0 0.3 0.0 0.1 0.0 0.0 0.0 Denied Del/Veh (s) 2.5 0.2 2.4 2.6 0.2 2.5 3.6 0.9 3.7 0.2 0.2 0.2 Total Delay (hr) 0.2 1.8 0.1 0.2 3.2 0.0 5.6 0.1 0.3 0.2 0.1 0.2 Total Del/Veh (s) 18.1 8.6 2.4 12.7 11.0 2.9 77.4 38.9 9.0 54.5 62.0 17.0 1: Round Lake Rd W/Arden Manor Way & Highway 96 Performance by movement Movement All Denied Delay (hr) 0.6 Denied Del/Veh (s) 0.9 Total Delay (hr) 11.9 Total Del/Veh (s) 17.5 2: Driveway 2/Space Center Driveway & Gateway Blvd Performance by movement Movement EBL EBT WBT SBL SBR All Denied Delay (hr) 0.0 0.0 0.0 0.0 0.0 0.0 Denied Del/Veh (s) 0.0 0.0 0.0 0.1 0.1 0.1 Total Delay (hr) 0.0 0.0 0.0 0.0 0.0 0.0 Total Del/Veh (s) 1.6 0.0 0.2 4.6 2.6 1.7 3: Driveway 1 & Gateway Blvd Performance by movement Movement EBT WBT All Denied Delay (hr) 0.0 0.0 0.0 Denied Del/Veh (s) 0.1 0.0 0.0 Total Delay (hr) 0.0 0.0 0.0 Total Del/Veh (s) 0.0 0.2 0.2 4: Driveway3 & Gateway Blvd Performance by movement Movement EBT WBT All Denied Delay (hr) 0.0 0.0 0.0 Denied Del/Veh (s) 0.0 0.1 0.1 Total Delay (hr) 0.0 0.0 0.0 Total Del/Veh (s) 0.1 0.7 0.5 5: Driveway 4 & Gateway Blvd Performance by movement Movement EBT All Denied Delay (hr) 0.0 0.0 Denied Del/Veh (s) 0.0 0.0 Total Delay (hr) 0.0 0.0 Total Del/Veh (s) 0.0 0.0 SimTraffic Performance Report Arden Hills No Build 2040 Conditions - PM SimTraffic Report Kimley-Horn March 2020 Total Network Performance Denied Delay (hr) 0.6 Denied Del/Veh (s) 0.9 Total Delay (hr) 13.2 Total Del/Veh (s) 18.8 Queuing and Blocking Report Arden Hills No Build 2040 Conditions - PM SimTraffic Report Kimley-Horn March 2020 Intersection: 1: Round Lake Rd W/Arden Manor Way & Highway 96 Movement EB EB EB EB WB WB WB WB NB NB NB SB Directions Served LTTRLTTRLTRLTR Maximum Queue (ft) 82 214 190 61 74 234 215 30 375 356 77 100 Average Queue (ft) 31 109 80 19 21 115 88 3 209 39 32 35 95th Queue (ft) 66 187 165 48 51 198 180 17 346 279 61 77 Link Distance (ft) 1092 1092 1402 1402 831 423 Upstream Blk Time (%)0 Queuing Penalty (veh)0 Storage Bay Dist (ft) 250 250 250 225 250 250 Storage Blk Time (%) 0 0 0 12 Queuing Penalty (veh) 0 0 0 14 Intersection: 2: Driveway 2/Space Center Driveway & Gateway Blvd Movement SB Directions Served LTR Maximum Queue (ft) 48 Average Queue (ft) 18 95th Queue (ft) 45 Link Distance (ft) 428 Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) Storage Blk Time (%) Queuing Penalty (veh) Intersection: 3: Driveway 1 & Gateway Blvd Movement Directions Served Maximum Queue (ft) Average Queue (ft) 95th Queue (ft) Link Distance (ft) Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) Storage Blk Time (%) Queuing Penalty (veh) Queuing and Blocking Report Arden Hills No Build 2040 Conditions - PM SimTraffic Report Kimley-Horn March 2020 Intersection: 4: Driveway3 & Gateway Blvd Movement Directions Served Maximum Queue (ft) Average Queue (ft) 95th Queue (ft) Link Distance (ft) Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) Storage Blk Time (%) Queuing Penalty (veh) Intersection: 5: Driveway 4 & Gateway Blvd Movement Directions Served Maximum Queue (ft) Average Queue (ft) 95th Queue (ft) Link Distance (ft) Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) Storage Blk Time (%) Queuing Penalty (veh) Network Summary Network wide Queuing Penalty: 14 SimTraffic Performance Report Arden Hills Build 2040 Conditions - AM SimTraffic Report Kimley-Horn March 2020 1: Round Lake Rd W/Arden Manor Way & Highway 96 Performance by movement Movement EBL EBT EBR WBL WBT WBR NBL NBT NBR SBL SBT SBR Denied Delay (hr) 0.0 0.0 0.2 0.1 0.1 0.0 0.1 0.0 0.1 0.0 0.0 0.0 Denied Del/Veh (s) 2.7 0.3 2.7 2.7 0.2 2.5 3.8 0.4 3.8 0.1 0.1 0.1 Total Delay (hr) 0.1 1.2 0.4 0.5 2.2 0.0 1.4 0.0 0.1 0.1 0.2 0.2 Total Del/Veh (s) 14.4 9.7 4.4 12.7 9.5 2.2 38.8 29.2 3.9 52.1 50.9 15.8 1: Round Lake Rd W/Arden Manor Way & Highway 96 Performance by movement Movement All Denied Delay (hr) 0.7 Denied Del/Veh (s) 1.2 Total Delay (hr) 6.4 Total Del/Veh (s) 11.4 2: Gateway Blvd & Space Center Driveway Performance by movement Movement EBL EBT WBT SBR All Denied Delay (hr) 0.0 0.0 0.0 0.0 0.0 Denied Del/Veh (s) 0.0 0.0 0.0 0.1 0.0 Total Delay (hr) 0.0 0.0 0.0 0.0 0.0 Total Del/Veh (s) 1.9 0.2 0.1 2.6 0.8 3: Driveway A & Gateway Blvd Performance by movement Movement EBT EBR WBT NBL All Denied Delay (hr) 0.0 0.0 0.0 0.0 0.0 Denied Del/Veh (s) 0.2 0.1 0.0 0.1 0.1 Total Delay (hr) 0.0 0.0 0.0 0.0 0.0 Total Del/Veh (s) 0.3 0.2 0.1 4.1 0.5 4: Driveway B & Gateway Blvd Performance by movement Movement EBT EBR WBT NBL All Denied Delay (hr) 0.0 0.0 0.0 0.0 0.0 Denied Del/Veh (s) 0.0 0.0 0.0 0.1 0.0 Total Delay (hr) 0.0 0.0 0.0 0.0 0.0 Total Del/Veh (s) 0.0 0.0 0.5 3.9 0.3 5: Driveway C & Gateway Blvd Performance by movement Movement EBT EBR NBL All Denied Delay (hr) 0.0 0.0 0.0 0.0 Denied Del/Veh (s) 0.0 0.0 0.1 0.0 Total Delay (hr) 0.0 0.0 0.0 0.0 Total Del/Veh (s) 0.0 0.1 3.9 0.7 SimTraffic Performance Report Arden Hills Build 2040 Conditions - AM SimTraffic Report Kimley-Horn March 2020 Total Network Performance Denied Delay (hr) 0.7 Denied Del/Veh (s) 1.1 Total Delay (hr) 7.3 Total Del/Veh (s) 12.2 Queuing and Blocking Report Arden Hills Build 2040 Conditions - AM SimTraffic Report Kimley-Horn March 2020 Intersection: 1: Round Lake Rd W/Arden Manor Way & Highway 96 Movement EB EB EB EB WB WB WB WB NB NB NB SB Directions Served LTTRLTTRLTRLTR Maximum Queue (ft) 59 164 132 127 117 199 170 25 184 27 57 127 Average Queue (ft) 17 78 45 52 45 85 65 2 93 3 24 43 95th Queue (ft) 49 141 106 98 88 161 138 14 166 15 48 94 Link Distance (ft) 1092 1092 1402 1402 831 423 Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) 250 250 250 225 250 250 Storage Blk Time (%) 0 0 Queuing Penalty (veh) 0 0 Intersection: 2: Gateway Blvd & Space Center Driveway Movement EB SB Directions Served LT LR Maximum Queue (ft) 13 22 Average Queue (ft) 0 2 95th Queue (ft) 8 14 Link Distance (ft) 339 429 Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) Storage Blk Time (%) Queuing Penalty (veh) Intersection: 3: Driveway A & Gateway Blvd Movement NB Directions Served LR Maximum Queue (ft) 29 Average Queue (ft) 6 95th Queue (ft) 24 Link Distance (ft) 493 Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) Storage Blk Time (%) Queuing Penalty (veh) Queuing and Blocking Report Arden Hills Build 2040 Conditions - AM SimTraffic Report Kimley-Horn March 2020 Intersection: 4: Driveway B & Gateway Blvd Movement NB Directions Served LR Maximum Queue (ft) 36 Average Queue (ft) 2 95th Queue (ft) 14 Link Distance (ft) 472 Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) Storage Blk Time (%) Queuing Penalty (veh) Intersection: 5: Driveway C & Gateway Blvd Movement NB Directions Served LT Maximum Queue (ft) 31 Average Queue (ft) 6 95th Queue (ft) 25 Link Distance (ft) 380 Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) Storage Blk Time (%) Queuing Penalty (veh) Network Summary Network wide Queuing Penalty: 0 SimTraffic Performance Report Arden Hills Build 2040 Conditions - PM SimTraffic Report Kimley-Horn March 2020 1: Round Lake Rd W/Arden Manor Way & Highway 96 Performance by movement Movement EBL EBT EBR WBL WBT WBR NBL NBT NBR SBL SBT SBR Denied Delay (hr) 0.0 0.0 0.1 0.0 0.1 0.0 0.5 0.0 0.2 0.0 0.0 0.0 Denied Del/Veh (s) 2.6 0.2 2.4 2.5 0.2 2.5 6.2 8.7 6.1 0.1 0.1 0.1 Total Delay (hr) 0.2 1.7 0.1 0.2 3.2 0.0 11.1 0.2 1.1 0.1 0.1 0.2 Total Del/Veh (s) 16.5 8.0 2.4 11.6 11.0 3.1 134.0 66.8 29.6 47.6 73.7 18.8 1: Round Lake Rd W/Arden Manor Way & Highway 96 Performance by movement Movement All Denied Delay (hr) 1.0 Denied Del/Veh (s) 1.4 Total Delay (hr) 18.2 Total Del/Veh (s) 25.9 2: Gateway Blvd & Space Center Driveway Performance by movement Movement EBL EBT WBT SBL SBR All Denied Delay (hr) 0.0 0.0 0.0 0.0 0.0 0.0 Denied Del/Veh (s) 0.0 0.0 0.0 0.1 0.1 0.0 Total Delay (hr) 0.0 0.0 0.0 0.0 0.0 0.0 Total Del/Veh (s) 1.3 0.0 0.2 6.3 2.7 1.1 3: Driveway A & Gateway Blvd Performance by movement Movement EBT EBR WBT NBL All Denied Delay (hr) 0.0 0.0 0.0 0.0 0.0 Denied Del/Veh (s) 0.1 0.1 0.0 0.1 0.1 Total Delay (hr) 0.0 0.0 0.0 0.0 0.1 Total Del/Veh (s) 0.1 0.0 0.2 5.0 1.4 4: Driveway B & Gateway Blvd Performance by movement Movement EBT EBR WBT NBL All Denied Delay (hr) 0.0 0.0 0.0 0.0 0.0 Denied Del/Veh (s) 0.0 0.0 0.0 0.1 0.0 Total Delay (hr) 0.0 0.0 0.0 0.0 0.0 Total Del/Veh (s) 0.2 0.1 0.4 4.4 0.7 5: Driveway C & Gateway Blvd Performance by movement Movement EBT EBR NBL All Denied Delay (hr) 0.0 0.0 0.0 0.0 Denied Del/Veh (s) 0.0 0.0 0.1 0.1 Total Delay (hr) 0.0 0.0 0.0 0.0 Total Del/Veh (s) 0.1 0.0 4.2 2.7 SimTraffic Performance Report Arden Hills Build 2040 Conditions - PM SimTraffic Report Kimley-Horn March 2020 Total Network Performance Denied Delay (hr) 1.0 Denied Del/Veh (s) 1.4 Total Delay (hr) 19.7 Total Del/Veh (s) 26.4 Queuing and Blocking Report Arden Hills Build 2040 Conditions - PM SimTraffic Report Kimley-Horn March 2020 Intersection: 1: Round Lake Rd W/Arden Manor Way & Highway 96 Movement EB EB EB EB WB WB WB WB NB NB NB SB Directions Served LTTRLTTRLTRLTR Maximum Queue (ft) 81 208 184 64 64 248 227 34 399 675 229 109 Average Queue (ft) 28 106 73 21 22 117 89 4 294 229 53 34 95th Queue (ft) 62 180 155 49 50 210 188 18 457 760 154 79 Link Distance (ft) 1092 1092 1402 1402 831 423 Upstream Blk Time (%)5 Queuing Penalty (veh)0 Storage Bay Dist (ft) 250 250 250 225 250 250 Storage Blk Time (%) 0 0 42 0 Queuing Penalty (veh) 0 0 60 0 Intersection: 2: Gateway Blvd & Space Center Driveway Movement EB SB Directions Served LT LR Maximum Queue (ft) 3 52 Average Queue (ft) 0 18 95th Queue (ft) 3 45 Link Distance (ft) 339 429 Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) Storage Blk Time (%) Queuing Penalty (veh) Intersection: 3: Driveway A & Gateway Blvd Movement NB Directions Served LR Maximum Queue (ft) 46 Average Queue (ft) 17 95th Queue (ft) 42 Link Distance (ft) 493 Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) Storage Blk Time (%) Queuing Penalty (veh) Queuing and Blocking Report Arden Hills Build 2040 Conditions - PM SimTraffic Report Kimley-Horn March 2020 Intersection: 4: Driveway B & Gateway Blvd Movement NB Directions Served LR Maximum Queue (ft) 42 Average Queue (ft) 5 95th Queue (ft) 25 Link Distance (ft) 474 Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) Storage Blk Time (%) Queuing Penalty (veh) Intersection: 5: Driveway C & Gateway Blvd Movement NB Directions Served LT Maximum Queue (ft) 38 Average Queue (ft) 16 95th Queue (ft) 42 Link Distance (ft) 381 Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) Storage Blk Time (%) Queuing Penalty (veh) Network Summary Network wide Queuing Penalty: 60 SimTraffic Performance Report Arden Hills Build 2040 IMP Conditions - PM SimTraffic Report Kimley-Horn March 2020 1: Round Lake Rd W/Arden Manor Way & Highway 96 Performance by movement Movement EBL EBT EBR WBL WBT WBR NBL NBT NBR SBL SBT SBR Denied Delay (hr) 0.0 0.0 0.1 0.0 0.1 0.0 0.3 0.0 0.1 0.0 0.0 0.0 Denied Del/Veh (s) 2.5 0.2 2.3 2.6 0.2 2.5 3.6 0.8 3.5 0.2 0.2 0.1 Total Delay (hr) 0.2 2.3 0.1 0.2 3.8 0.0 5.3 0.1 0.3 0.1 0.1 0.2 Total Del/Veh (s) 16.9 10.6 2.6 13.8 13.2 2.9 62.7 33.9 7.8 53.6 63.1 19.0 1: Round Lake Rd W/Arden Manor Way & Highway 96 Performance by movement Movement All Denied Delay (hr) 0.7 Denied Del/Veh (s) 1.0 Total Delay (hr) 12.7 Total Del/Veh (s) 18.0 2: Gateway Blvd & Space Center Driveway Performance by movement Movement EBL EBT WBT SBL SBR All Denied Delay (hr) 0.0 0.0 0.0 0.0 0.0 0.0 Denied Del/Veh (s) 0.0 0.0 0.0 0.1 0.1 0.0 Total Delay (hr) 0.0 0.0 0.0 0.0 0.0 0.0 Total Del/Veh (s) 1.5 0.1 0.1 4.7 2.8 1.0 3: Driveway A & Gateway Blvd Performance by movement Movement EBT EBR WBT NBL All Denied Delay (hr) 0.0 0.0 0.0 0.0 0.0 Denied Del/Veh (s) 0.2 0.1 0.0 0.1 0.1 Total Delay (hr) 0.0 0.0 0.0 0.0 0.0 Total Del/Veh (s) 0.2 0.0 0.2 4.7 1.4 4: Driveway B & Gateway Blvd Performance by movement Movement EBT EBR WBT NBL All Denied Delay (hr) 0.0 0.0 0.0 0.0 0.0 Denied Del/Veh (s) 0.0 0.0 0.1 0.1 0.0 Total Delay (hr) 0.0 0.0 0.0 0.0 0.0 Total Del/Veh (s) 0.1 0.0 0.4 4.4 0.7 5: Driveway C & Gateway Blvd Performance by movement Movement EBT EBR NBL All Denied Delay (hr) 0.0 0.0 0.0 0.0 Denied Del/Veh (s) 0.0 0.0 0.1 0.1 Total Delay (hr) 0.0 0.0 0.0 0.0 Total Del/Veh (s) 0.0 0.0 4.2 2.9 SimTraffic Performance Report Arden Hills Build 2040 IMP Conditions - PM SimTraffic Report Kimley-Horn March 2020 Total Network Performance Denied Delay (hr) 0.7 Denied Del/Veh (s) 0.9 Total Delay (hr) 14.3 Total Del/Veh (s) 19.1 Queuing and Blocking Report Arden Hills Build 2040 IMP Conditions - PM SimTraffic Report Kimley-Horn March 2020 Intersection: 1: Round Lake Rd W/Arden Manor Way & Highway 96 Movement EB EB EB EB WB WB WB WB NB NB NB SB Directions Served LTTRLTTRLTRLTR Maximum Queue (ft) 81 257 228 57 61 247 241 28 385 439 169 125 Average Queue (ft) 29 123 95 22 22 131 107 3 214 52 44 37 95th Queue (ft) 64 206 185 47 49 225 214 17 373 290 117 87 Link Distance (ft) 1092 1092 1402 1402 831 423 Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) 250 250 250 225 250 250 Storage Blk Time (%) 0 0 0 0 14 Queuing Penalty (veh) 0 0 0 0 19 Intersection: 2: Gateway Blvd & Space Center Driveway Movement SB Directions Served LR Maximum Queue (ft) 56 Average Queue (ft) 18 95th Queue (ft) 46 Link Distance (ft) 429 Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) Storage Blk Time (%) Queuing Penalty (veh) Intersection: 3: Driveway A & Gateway Blvd Movement NB Directions Served LR Maximum Queue (ft) 43 Average Queue (ft) 18 95th Queue (ft) 42 Link Distance (ft) 493 Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) Storage Blk Time (%) Queuing Penalty (veh) Queuing and Blocking Report Arden Hills Build 2040 IMP Conditions - PM SimTraffic Report Kimley-Horn March 2020 Intersection: 4: Driveway B & Gateway Blvd Movement NB Directions Served LR Maximum Queue (ft) 36 Average Queue (ft) 5 95th Queue (ft) 23 Link Distance (ft) 473 Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) Storage Blk Time (%) Queuing Penalty (veh) Intersection: 5: Driveway C & Gateway Blvd Movement NB Directions Served LT Maximum Queue (ft) 43 Average Queue (ft) 16 95th Queue (ft) 42 Link Distance (ft) 381 Upstream Blk Time (%) Queuing Penalty (veh) Storage Bay Dist (ft) Storage Blk Time (%) Queuing Penalty (veh) Network Summary Network wide Queuing Penalty: 20 MEMORANDUM City of Arden Hills Planning Commission Meeting for September 9, 2020 P:\Planning\Planning Cases\2020\20-010 4200 Round Lake Road PP PUD\PC Packets Page 1 of 13 Requested Action Dan Salzer of Scannell Properties (“Applicant”) has submitted an application for a Planned Unit Development, Conditional Use Permit, Site Plan, and Preliminary and Final Plat for a project located at 4200 Road Lake Road (“Subject Property”). The Applicant is proposing to construct a 250,000 square foot office and warehouse facility on the existing vacant land. The Applicant is also requesting to subdivide the subject parcel into two (2) lots of record. The Subject Property is zoned GB, Gateway Business District and is guided as Light Industrial & Office on the Land Use Plan. Background The Subject Property is currently owned by North American Land Company, LLC, a holding company related to Roberts Management Group. The Subject Property comprises two (2) parcels totaling approximately 26.08 acres located south of the cul-de-sac on Gateway Boulevard and north of Interstate 694 and east of 35W. There was a previously existing building located onsite that was removed in 2006. The Subject Property has had a few development proposals in the past. However, none of the projects have come to fruition. The Subject Property has since been vacant with wetlands located adjacent to Interstates (“35W and 694”). The Applicant is proposing to construct a 250,000 square foot office and warehouse facility on the site. The site is highly visible from 694 and 35W. Separate access points to the site will be provided via Gateway Boulevard for employee parking and deliveries. The Applicant’s proposal includes office space, warehousing, and ground level unloading access with 38 dock doors located on the north side of the building. The site proposal includes at-grade office parking lots located on the south side of the building. DATE:September 9, 2020 PC Agenda Item 3.C TO:Planning Commission FROM:Mike Mrosla – Community Development Manager/City Planner SUBECT: Planning Case # 20-010 –Public Hearing Required Applicant:Dan Salzer of Scannell Properties Property Location: 4200 Round Lake Road Request:Master Planned Unit Development, Conditional Use Permit, Site Plan and Preliminary/Final Plat $WWDFKPHQW( ____________________________________________________________________________________________ City of Arden Hills Planning Commission Meeting for September 9, 2020 P:\Planning\Planning Cases\2020\20-010 4200 Round Lake Road PP/FP/CUP/PUD\PC Packets Page 2 of 13 Plan Evaluation 1. Chapter 11, Subdivisions Preliminary and Final Plat A plat is required to create new parcels of land or to adjust the boundary between two parcels. A Preliminary Plat is a map, drawing or chart indicating the proposed layout of the subdivision. The purpose is to provide graphic information indicating the proposed property boundaries, easements, land use, streets, utilities, drainage, and other information required to evaluate a proposed development. A Final Plat is the final map, drawing or chart indicating the final layout for City approval. The Final Plat includes the detailed survey description for each lot in the plat plus notes and dedication, recording and approval statements. The Final Plat is the “recorded document” submitted to the county register and must conform to all state laws. A. Lots The Applicant is proposing to re-plat the Subject Property. As shown in the image below, the existing land from Lot 2 adjacent to Gateway Boulevard is proposed to transferto Lot 1 the Subject Property. Proposed Lots Total Acres Use Lot 1 21.94 Development Parcel Lot 2 3.87 Access drive serving Lot 1 and future development on Lot 2 B. Easements and Right of Way The Subject Parcel requires several easements as part of this proposal. The Subject Property is encumbered by existing sightline easements with Clear Channel for two (2) billboards and an overhead power line easement. In addition, the site has existing wetlands located adjacent to 35W and 694 that require drainage and utility easements be placed over the wetlands. ____________________________________________________________________________________________ City of Arden Hills Planning Commission Meeting for September 9, 2020 P:\Planning\Planning Cases\2020\20-010 4200 Round Lake Road PP/FP/CUP/PUD\PC Packets Page 3 of 13 The subdivision ordinance requires streets serving commercial and industrial areas to have a right of way (ROW) width of70 feet. As part of the platting process the Applicant is required to dedicate approximately .41 acres or approximately 17,860 square feet of ROW along Gateway Boulevard to the City. This dedication of ROW impacted parking lot setbacks. The GB zoning district requires a 50 foot setback from public streets. The applicant was requesting a 30 foot parking lot setback from Gateway Boulevard and due to the required ROW dedication the Applicant is now requesting a 20 foot setback to the parking area on the north side of the subject parcel. However, serval properties along Round Lake Road and Gateway Boulevard have similar or greater reduction in parking lot setbacks. C. Park Dedication City Code 1130.08 requires that all subdivisions dedicate land to the City for a public use as a condition of approval for the development. In commercial or industrial subdivisions where a land dedication is required, seven and a half (7.5) percent of the gross area of the subdivision shall be used to determine the parkland dedication. For the 21.94 acre development proposed, a 1.64 acre park dedication would be required. A cash contribution in lieu of land dedication may be required at the discretion of the City. The cash contribution fee shall be seven and a half (7.5) percent of the fair market value of the unimproved land. Cash contributions for land dedication or park improvements are to be calculated at the time of the Final Plat approval. The City may require the payment prior to the release of the Final Plat or at a later time under terms agreed upon in the development agreement. Park dedication for Lot 2 will be determined at the time of development. D. Required Improvements All other required improvements, including sewer, water, utilities, and driveway connections to Gateway Boulevard will be constructed in accordance with the City’s Subdivision Code. As a condition of approval, engineering staff shall review and approve final utility and grading plans prior to the issuance of a grading and erosion permit. ____________________________________________________________________________________________ City of Arden Hills Planning Commission Meeting for September 9, 2020 P:\Planning\Planning Cases\2020\20-010 4200 Round Lake Road PP/FP/CUP/PUD\PC Packets Page 4 of 13 2. Planned Unit Development (PUD) Process A Planned Unit Development (PUD) District promotes the development of land in a unified manner by treating the entire development as a single entity and relaxing the strict application of standard zoning and subdivision requirements, in exchange for a project that better forwards the goals and purpose of the City's Comprehensive Plan. In granting a PUD request, the City may prescribe appropriate conditions and safeguards, which should bring the project in conformity with the purposes of the City Code. The purpose of the PUD process is to achieve a higher quality and better project than would otherwise be possible if the strict application of the zoning and subdivision requirements were met. While PUDs may be allowed in any district, they are required for some types of development in certain districts. 3. Comprehensive Plan The Arden Hills 2040 Comprehensive Plan Land Use Chapter lists implementation strategies for the Developable Gateway Business Properties. It states that the City should “determine the highest and best use for the vacant properties on the south end of Gateway Blvd along I-694 and rezone the properties accordingly.” As previously stated the property is guided on the 2040 Land Use Plan as Light Industrial and Office use. Light Industrial and Office (I/O) uses are areas designated for a broad range of light industrial uses such as warehousing with manufacturing. This land use may also include offices. According to the 2040 Comprehensive Plan, the expected share of uses within this area are 50 percent to 100 percent Light Industrial or up to 100 percent Office. 4. Conditional Use Permit A Conditional Use Permit is required for a warehousing use within the GB District. City Code Section 1355.04 Subd. 3 of the Arden Hills Zoning Code lists the criteria for evaluating a Conditional Use Permit. The Planning Commission and City Council should consider the effect of the proposed use upon the health, safety, convenience and general welfare of the owners and occupants of the surrounding land and the community, in general, including but not limited to the following factors: 1. Existing and anticipated traffic and parking conditions; 2. Noise, glare, odors, vibration, smoke, dust, air pollution, heat, liquid or solid waste, and other nuisance characteristics; 3. Drainage; 4. Population density; 5. Visual and land use compatibility with uses and structures on surrounding land; 6. Adjoining land values; 7. Park dedications where applicable; 8. Orderly development of the neighborhood and the City within the general purpose and intent of the Zoning Code and the Comprehensive Development Plan for the City. 5. Chapter 13, Zoning Code Review A. District Provisions 1320.13- Flexibility requested According to City Code Section 1320.13, office uses cannot occupy less than 25 percent of a project's total floor area and not more than 50 percent. In addition, warehousing and wholesaling ____________________________________________________________________________________________ City of Arden Hills Planning Commission Meeting for September 9, 2020 P:\Planning\Planning Cases\2020\20-010 4200 Round Lake Road PP/FP/CUP/PUD\PC Packets Page 5 of 13 uses shall not exceed 75 percent of the building in which it is located. While the final tenants are unknown at this time, the Applicant is anticipating to attract a wide variety of light industrial tenants with uses including office, manufacturing, research and development, and/or warehousing. The Applicant is requesting flexibility to increase this requirement for warehousing and wholesaling to 85 percent and the remaining 15 percent dedicated to non-warehouse uses such as a combination of uses including-but-not-limited-to office, manufacturing, production, R&D, lab and/or showroom. B. Lot Area – Flexibility Requested The proposed Lot 1 is 21.94 acres and Lot 2 is 3.87 acres in size. The Zoning Code requires a minimum lot size of 5 acres in the GB District. Proposed Lot 2 does not meet this requirement. Lot 2 is highly impacted by numerous encumbrances as shown below. It is important to note the developable area of Lot 2 does not change no matter the platted lot size due to the site constraints. C. Lot Dimensions - Flexibility Requested The City Code requires parcels within the GB District to have a street frontage of at least 100 feet and a lot depth of at least 130 feet. Lot frontage is measured at the minimum front yard setback, which allows buildings to be constructed on a radius, such as on a cul-de-sac or curve. Lot 1 has over 1,400 feet of street frontage along Gateway Boulevard and the minimum lot depth of 326.61 feet. Lot 2 is an existing non-conforming lot with a minimum street frontage width of 50 feet instead of the required 100 feet. The submitted plans are showing a 40 foot street frontage width, the reduction is due to 10 feet being dedicated to the City as ROW as required by the Subdivision code. D.Building Setbacks – Meets Requirements Building setbacks in the GB District are 50 feet for the front yard, 20 feet for the side yard with a minimum of 40 feet total for both side yards, and 20 feet for the rear yard. Proposed building is unique as it has frontage on two streets (I-694, I-35W and Gateway Boulevard). In addition, the Subject Parcel is located on the corner of Round Lake Road and Gateway Boulevard. City Code defines the front yard for corner lots as the shortest street lot line shall be the front lot line. The shortest street lot line is located adjacent to Gateway Boulevard. The proposed building has a minimum front yard setback of 74.8 feet from Gateway Boulevard. Proposed building has a minimum side yard setback from Lot 2 of approximately 32.5 feet and has secondary side yard setback to Lot 2 of 127.9 feet for a total of 160.4 feet. The minimum rear setback is 94.4 feet. ____________________________________________________________________________________________ City of Arden Hills Planning Commission Meeting for September 9, 2020 P:\Planning\Planning Cases\2020\20-010 4200 Round Lake Road PP/FP/CUP/PUD\PC Packets Page 6 of 13 E. Parking Setbacks - Flexibility Requested The GB district requires a 50 foot setback for parking areas from public streets and ROW. The applicant was requesting a 30 foot parking lot setback from Gateway Boulevard ROW and due to the required ROW dedication the Applicant is now requesting a 20 foot setback to the parking area on the north side of the subject parcel. According to the Site Plan the proposed parking areas are located approximately 50 feet from the back of curb of Gateway Boulevard. However, several properties along Round Lake Road and Gateway Boulevard have similar or greater reduction in parking lot setbacks. F. Building Height – Flexibility Requested Section 1305.04 of the City Code defines building height as “the vertical distance from the average elevation of the grade along a face of a building to the highest point of the roof surface of flat roofs, the deck line of mansard roofs, or the average height between the eaves and the highest ridge of gable, hip, or gambrel roofs.” These measurements are illustrated in the drawing below. Maximum height in the GB district is 35 feet. The Applicant is proposing a facility with maximum interior clear height of 32 feet. As it directly relates to the interior clear height, the proposed maximum building height measured from the finished floor elevation is 40 feet. However, special requirements for the GB district state that in order to accomplish the intensity and scale of development consistent with the defined purpose of the GB District, multi-story buildings will be encouraged. 6. General District Provisions A. Parking and Site Operations – Meets Requirements The proposed Site Plan shows three (3) accesses onto Gateway Boulevard. The proposed access can be classified as employee and loading driveway accesses. The employee accesses shown on the next page are 24 feet wide and the loading driveway access is 35.6 feet wide. The loading access will provide access to the 38 dock doors located on the north side of the building. The eastern employee access is located on Lot 2. This proposed access will be a shared access driveway for both Lot 1 and Lot 2 when it develops. This will require a cross access and maintenance agreement between the two parcels which will be further addressed in the Development Agreement related to the Project. ____________________________________________________________________________________________ City of Arden Hills Planning Commission Meeting for September 9, 2020 P:\Planning\Planning Cases\2020\20-010 4200 Round Lake Road PP/FP/CUP/PUD\PC Packets Page 7 of 13 The Zoning Code has access/driveway width standards for streets classified as minor and collector streets. However, Gateway Boulevard is classified as neither a minor or collector roadway and instead it is identified as a municipal state aid street. The Public Works Director/City Engineer has reviewed the proposed accesses and determined they are sufficiently sized for the proposed use. The Applicant has provided a semi-trailer turning exhibit showing that the vehicles can access and maneuver appropriately in the proposed loading area. The Applicant is proposing that building would be a maximum of 85 percent warehouse and a minimum of 15 percent office. Per City Code, Business & Professional Office uses must provide one (1) parking space for each 250 sq. ft. of gross floor area. The proposed office floor area is 37,500 square feet and that would require 150 parking stalls. Other Business and Industry uses would need to provide one (1) for each employee on shift plus one (1) for each vehicle used in conducting the business or one (1) for each 1,000 sq. ft. of floor area, whichever is greater. The Applicant is proposing a floor area of 212,500 square feet and would require 212 parking stalls. The Site Plan depicts 364 parking spaces and the proposed uses require 362 stalls. In the event additional parking is required to meet the demands of the future tenant the Applicant is proposing 230 proof of parking stalls located in the northwest sections of the site as shown below. This would bring the total parking onsite to 593 parking stalls. If the proof of parking stalls are needed the Applicant will need to construct an underground retention area in the same area to replace the existing stormwater pond. ____________________________________________________________________________________________ City of Arden Hills Planning Commission Meeting for September 9, 2020 P:\Planning\Planning Cases\2020\20-010 4200 Round Lake Road PP/FP/CUP/PUD\PC Packets Page 8 of 13 B. Planting Islands – Meets Requirements The Applicant is proposing a parking area located on the north side of the proposed building. The parking field has a large landscaping island in the middle. In front of proposed building is a single parking lot in that wraps around the west side of the proposed building. There will not be multiple rows or large expanses of parking as there will be multiple landscaped bump outs breaking up the parking field. The perennial and shrub planting beds will separate the building from the parking areas. The loading field will have a stormwater retention pond in the middle. The pond will be seeded with appropriate seed mix for ponds and additional landscaping. C. Lighting – Meets Requirements The Applicant has submitted a lighting plan that identifies pole heights and lumen levels at the property lines. Other than wash or architectural lighting, attached security lighting shall be shoebox style and downward directed with flush lenses. The Applicant is proposing to use LED lighting to illuminate the parking areas. As a condition of approval, all lighting shall be downward directed shoebox style with flush lenses. D. Screening – Meets Requirements Screening for fences, walls, landscaping, and berms including materials with construction details that shall match or complement the construction of the principle building. The Site Plan submitted by the Applicant depicts significant landscaping along Gateway Boulevard which will assist in screening the loading area and docks from the view of the public. The Applicant is stating that landscaping will achieve 60 percent opacity at year round at maturity. Rooftop mechanical equipment is to be screened so as to completely obscure the equipment for view. Any future outdoor trash and waste storage facilities would need to be screened per City Code. E. Trees along Street Frontage – Meets Requirements A minimum of one tree shall be provided along the right of way for every 50 feet of public street frontage. The proposed frontage on Gateway Boulevard is 1,484 feet and requires 30 trees. The Applicant is proposing to plant 71 trees along the right of way adjacent to Gateway Boulevard area. F. Minimum Caliper Inches – Flexibility Requested Tree mitigation is not required as the current site has no trees deemed significant per City Code. The Zoning Code requires that a minimum number of caliper inches of trees be provided based on the gross square footage of the building on the property. A single story building in excess of thirty (30) feet in height shall be considered a two-story building for the purposes of determining gross square footage. The proposed building would be considered a two-stories, and includes 499,552 gross square feet. This requires a minimum of 1,561 caliper inches or 624 two (2) caliper trees. The proposed site is limited to where trees can be planted onsite due the wetlands and overhead power lines. In response the Applicant is proposing 310 caliper inches or 110 trees. G. Tree Selection – Meets Requirements The proposed landscape plan includes a variety of tree species, including maples, oaks and evergreens, ranging in size from two and half (2.5) to six (6) caliper inches. This is consistent with ordinance requirements. The Applicant is proposing to plant six (6) to twelve (12) foot tall evergreens. H. Landscaped Area and Perennials and Shrubberies – Flexibility Requested ____________________________________________________________________________________________ City of Arden Hills Planning Commission Meeting for September 9, 2020 P:\Planning\Planning Cases\2020\20-010 4200 Round Lake Road PP/FP/CUP/PUD\PC Packets Page 9 of 13 Zoning Code requires 35 percent of the site to be landscaped or 339,674 square feet. The landscaping plan shows that the total landscaped area provided on the site is 652,668 square feet. The Zoning Code requires a minimum of 10 percent of the total landscaped area to be covered with perennials and/or shrubbery. The total landscaped area on the site is 652,668 square feet, resulting in the need for a minimum of 65,266 square feet of perennial and shrubbery cover. The Applicant is proposing 2,888 square feet perennial and shrub planting beds. However, the Applicant is proposing to use over 170,000 square feet of Mesic Prairie seed mix onsite. Mesic Prairie is a prairie plant community dominated by native grasses such as big bluestem, switchgrasses and including abundant wildflowers. I. Drainage Wetlands and Flood Plain – Section 1325.05 Subd. 2 – Meets Requirements The City Code requires stormwater management be provided to meet water quantity, infiltration, and water quality requirements. The submitted plans identifies the construction of three (3) stormwater ponds. The first pond is located in the middle of the loading area. The other two (2) ponds are located adjacent to 694 and 35W. Prior to the issuance of a land disturbance permit, the Applicant shall submit an operation and maintenance plan for the long-term care of all onsite stormwater facilities. J. Floor Area Ratio (FAR) – Meets Requirements The ratio obtained by dividing the sum of a building's floor area by the amount of lot area. Under the current Zoning Code, the maximum FAR for a two-story building is .4 in this GB district. The proposed FAR is .26. K. Aesthetics - Flexibility Requested The GB district requires materials and colors selected for any individual building shall be compatible with other buildings in the GB District. The Applicant is proposing to use a color palette similar to the existing buildings on Gateway Boulevard. ____________________________________________________________________________________________ City of Arden Hills Planning Commission Meeting for September 9, 2020 P:\Planning\Planning Cases\2020\20-010 4200 Round Lake Road PP/FP/CUP/PUD\PC Packets Page 10 of 13 In addition, the GB district requires the exterior materials be a mixture of brick, stone, glass or any combination thereof, except trim and accessories may be metal. The Applicant is requesting flexibility in exterior building materials is requested to better complement the surrounding architecture found on Round Lake Road and Gateway Boulevard. The Applicant is requesting to utilize a combination of painted pre-cast, glass, architectural metal panels with concealed fasteners, and thin brick veneer. L. Traffic Study A traffic study was required and was completed by Kimley-Horn and Associates. The anticipated trip generation during AM peak is 80 vehicles in and out of the site. The 80 vehicles includes eight (8) warehouse related vehicles and 72 passenger vehicles. The PM peak is 83 vehicles in and out of the site. The 80 vehicles includes eight (8) warehouse related vehicles and 75 passenger vehicles. The proposed trip generation is fairly low based on the proposed use of 85 percent warehouse and 15 percent office space. The traffic study only had one recommended improvement. The recommendation requests Ramsey County to add five (5) seconds to the signal timing for Round Lake Road and Hwy 96 to allow for more northbound left turns during the PM peak hour. Suggested Findings of Fact Staff offers the following findings of fact for consideration: 1. The Applicant has submitted an application for a Planned Unit Development, Conditional Use Permit and Preliminary/Final Plat at the Subject Property 4200 Round Lake Road. 2. The Applicant is proposing a 250,000 square foot office and warehouse facility on the Subject Property. 3. The Applicant has submitted a preliminary and final plat to plat two (2) properties. 4. Flexibility through the PUD process has been requested in the following areas: district provisions, lot area, lot dimensions, parking setbacks, building height, minimum caliper inches, aesthetics, perennials and shrubberies. 5. The proposed development plan meets or exceeds the minimum requirements of the City Code in the following areas: building setbacks, landscape coverage, parking, planting islands, street trees, tree selection, floor area ratio, drainage wetlands and flood plain tree selection, lighting, screening. 6. Where the plan is not in conformance with the City Code, flexibility has been requested by the Applicant and/or conditions have been placed on an approval that would mitigate the nonconformity. 7. A traffic study has been completed for the proposed use and suggests that Ramsey County to add five (5) seconds to the signal timing for Round Lake Road and Hwy 96 to allow for more northbound left turns during the PM peak hour. 8. Existing public facilities and shall be able to absorb the additional demand for public services needed for the proposed use. 9. The Subject Property is located with the Gateway Business (“GB”) District and is guided as Light Industrial & Office on the 2040 Land Use Plan. 10. The proposed Preliminary Plat and Final Plat are consistent with the Arden Hills Zoning Map and the 2040 Comprehensive Plan. 11. The application is not anticipated to create a negative impact on the immediate area or the community as a whole. ____________________________________________________________________________________________ City of Arden Hills Planning Commission Meeting for September 9, 2020 P:\Planning\Planning Cases\2020\20-010 4200 Round Lake Road PP/FP/CUP/PUD\PC Packets Page 11 of 13 Options and Motion Language Staff has provided the following options and motion language for this case. 1. Recommend Approval with Conditions: Motion to recommend approval of Planning Case 20- 010 for a Planned Unit Development, Conditional Use Permit and Preliminary Plat/Final Plat at 4200 Round Lake Road, based on the findings of fact and submitted plans, subject to the following conditions: 1. The project shall be completed in accordance with the plans submitted and as amended by the conditions of approval. Any significant changes to the plans, as determined by the City Planner, shall require review and approval by the City Council. 2. The Preliminary Plat approval shall expire six months from the date of the City Council approval unless the Final Plat has recorded with Ramsey County or a time extension granted by the City Council. 3. The Applicant shall record the Final Plat with Ramsey County and a copy shall be provided to the City within sixty (90) days of the City’s approval. 4. The Applicant shall be financially responsible for all applicable water and sanitary charges. Rates applied shall be those in effect at the time of Final Plat approval and shall be memorialized in the Development Agreement. 5. A Development Agreement shall be prepared by the City Attorney and subject to City Council approval. The Development Agreement shall be fully executed prior to release of a building permit. 6. The Applicant shall submit a park dedication fee that shall be seven and a half (7.5) percent of the fair market value of the unimproved land and subject to the approval of the City Council. The park dedication fee shall be submitted prior to the release of the Final Plat. 7. Survey monuments shall be placed and installed at all block corners, angle points, points of curves in streets, and at intermediate points as shown on the Final Plat. Pipes or steel rods shall be placed at the corners of each lot. 8. The final plat shall provide dedication of a 60-ft wide right of way for Gateway Boulevard on Lot 2, Block 1 overlying the area currently encumbered by existing drainage and utility easement. 9. Prior to the issuance of a grading and erosion permit, planning staff shall approve in writing the final landscaping plan. 10. Prior to the issuance of a grading and erosion permit, engineering staff shall approve in writing the final location of the loading driveway access to align with adjacent commercial driveway or provide adequate offset distance. 11. A cross easement access and maintenance agreement for the proposed share access on Lot 2 shall be submitted and memorialized in the Development Agreement. 12. Site Plan approval shall be required for the construction of the proof of parking area. 13. All light poles, including base, shall be a maximum of 25 feet in height and shall be shoebox style, downward directed, with high-pressure sodium lamps or LED and flush lenses. Other than wash or architectural lighting, attached security lighting shall be shoebox style, downward directed with flush lenses. If complaints are received the lighting adjacent to residential uses shall utilize house shields as directed by the City. ____________________________________________________________________________________________ City of Arden Hills Planning Commission Meeting for September 9, 2020 P:\Planning\Planning Cases\2020\20-010 4200 Round Lake Road PP/FP/CUP/PUD\PC Packets Page 12 of 13 In addition, any lighting under canopies (building entries) shall be recessed and use a flush lens. 14. A right of way permit shall be required for work performed within the City right of way. 15. A grading as-built and utility as-built plan shall be provided to the City upon completion of grading and utility work. 16. No exterior storage shall be permitted. 17. This approval does not include signs. A separate sign permit is required for all proposed signage. All signage shall meet the requirements of Sign District 6. 18. Prior to the issuance of a building permit, a landscape financial security of $50,000.00 dollars shall be submitted. Landscape financial security is held for two full growing seasons. 19. All rooftop or ground mounted mechanical equipment shall be hidden from view with the same materials used on the building in accordance with City Code requirements. 20. All fencing and retaining wall materials shall be complementary to the building materials and shall be approved in writing by the Planning Division prior to issuance of a building permit. Retaining walls greater than four (4) feet in height shall be engineered and detailed calculations shall be submitted to the City. 21. Prior to City Council consideration, the Applicant shall submit a materials board to be approved in writing by staff. 22. A Grading and Erosion permit shall be obtained from the City’s Engineering Department prior to commencing any grading, land disturbance or utility activities. The Developer shall be responsible for obtaining any permits necessary from other agencies, including but not limited to, MPCA, Rice Creek Watershed District, and Ramsey County, MNDOT prior to the start of any site activities. 23. The Applicant shall be responsible for protecting the proposed on-site storm sewer infrastructure and components and any existing storm sewer from exposure to any and all stormwater runoff, sediments and debris during all construction activities. Temporary stormwater facilities shall be installed to protect the quality aspect of the proposed and existing stormwater facilities prior to and during construction activities. Maintenance of any and all temporary stormwater facilities shall be the responsibility of the Applicant. 24. Prior to the issuance of the Grading and Erosion permit, the Engineering Department shall review and approve final grading and utility plans in writing. Plans shall be amended to include detail drawings for connection to the sanitary sewer system in Gateway Boulevard, restoration of utility cuts within public streets, and inclusion of City details 3401, 3402, 3408, and 4000. 25. Any future trash enclosures shall utilize wooden gates and be constructed on three sides using the same materials and patterns used on the building. Locations shall be approved by the Planning Department. 26. The Applicant shall provide an executed copy of the City’s standard stormwater maintenance and easement agreement prior to approval of the Development Agreement. 27. All disturbed boulevards shall be restored with sod. 28. All areas of the site, where practical, shall be sodded or seeded and maintained. The property owner shall mow and maintain all site boulevards to the curb line of the public streets. ____________________________________________________________________________________________ City of Arden Hills Planning Commission Meeting for September 9, 2020 P:\Planning\Planning Cases\2020\20-010 4200 Round Lake Road PP/FP/CUP/PUD\PC Packets Page 13 of 13 29. Overnight trailer parking is prohibited onsite other than along the dock wall within the concrete dock apron. 30. The Applicant shall work with Ramsey County to add five (5) seconds to the signal timing for Round Lake Road and Hwy 96 to allow for more northbound left turns during the PM peak hour prior to the issuance of a certificate of occupancy. 31. Warehousing and wholesaling shall not exceed 85 percent of the floor area tenant. The remaining 15 percent of floor area shall be non-warehouse uses such as a combination of uses including-but-not-limited-to office, manufacturing, production, research and development, lab and/or showroom per tenant. 2. Recommend Approval without Conditions: Motion to recommend approval of Planning Case 20-010 for a Planned Unit Development, Conditional Use Permit and Preliminary Plat/Final Plat at 4200 Round Lake Road, based on the findings of fact and submitted plans in the report to the Planning Commission. 3. Recommend Denial: Motion to recommend denial of Planning Case 20-010 for a Planned Unit Development, Conditional Use Permit and Preliminary Plat/Final Plat at 4200 Round Lake Road based on the following findings of fact: the Planning Commission should identify findings to deny should specifically reference the reasons for denial and why those reasons cannot be mitigated. 4. Table: Motion to table Planning Case 20-010 for a Planned Unit Development, Conditional Use Permit and Preliminary Plat/Final Plat at 4200 Round Lake Road for the following reasons: the Planning Commission should identify a specific reason and/or information request should be included with a motion to table. Notice and Public Comments Notice was published in the Pioneer Press on August 29, 2020. Staff has not received and comments. Deadline for Agency Actions The City of Arden Hills received the completed application for this request on August 29, 2020. Pursuant to Minnesota State Statute, the City must act on this request by October28, 2020 (60 days), unless the City provides the Petitioner with written reasons for an additional 60 day review period. The City may, with the consent of the Applicant, extend the review period beyond the initial 120 days. Attachments A. Application B. Location Map C. 11x17 Plans Approved: CITY OF ARDEN HILLS, MINNESOTA PLANNING COMMISSION WEDNESDAY, SEPTEMBER 9, 2020 6:30 P.M. - ARDEN HILLS CITY HALL CALL TO ORDER/ROLL CALL Pursuant to due call and notice thereof, Chair Nick Gehrig called to order the regular Planning Commission meeting at 6:30 p.m. Due to the COVID-19 pandemic this meeting was held virtually. ROLL CALL Present were: Chair Nick Gehrig, Commissioners Marcie Jefferys, Steven Jones, Subbaya Subramanian, Paul Vijums, Kurtis Weber, and Jonathan Wicklund. Absent: Commissioners James Lambeth and Clayton Zimmerman. Also present were: Community Development Manager/City Planner Mike Mrosla, Associate Planner Joe Hartmann, and Councilmember Steve Scott. APPROVAL OF AGENDA – SEPTEMBER 9, 2020 Chair Gehrig stated the agenda will stand as published. APPROVAL OF MINUTES August 5, 2020 – Planning Commission Regular Meeting Chair Gehrig requested all references to himself be changed to Vice Chair Jones within the minutes. Commissioner Jones moved, seconded by Commissioner Jefferys, to approve the August 5, 2020, Planning Commission Regular Meeting as amended. A roll call vote was taken. The motion carried unanimously (7-0). PLANNING CASES A. Planning Case 20-014; 1434 County Road E – Variance Request – No Public Hearing Required Attachment F ARDEN HILLS PLANNING COMMISSION – September 9, 2020 2 Associate Planner Hartmann stated the Applicant is requesting a Variance to expand the current 528 square foot garage on the Subject Property into a 1,100 square foot garage. The maximum size of a garage allowed by right is 728 square feet. The existing garage meets the front and rear yard setbacks which are forty (40) and thirty (30) feet from the front and rear property lines, respectively, but the garage is only three (3) feet from the side yard setback where a ten (10) foot side yard setback is required for an accessory structure in the R-1 district. Due to the size of the request and the current garage’s legal nonconforming side yard setback (refer to Planning Case 00-004 for the previously approved three (3) foot setback variance), the Applicant requires a variance approval for the expansion of the garage. Associate Planner Hartmann reported the Applicant is proposing to expand the accessory structure in order to gain more storage space for their vehicles. According to the Applicant’s narrative submitted as a part of their application, when the sidewalk was installed within the easement facing County Road E, they lost driveway space that they had been using for the storage of vehicles. Expanding the garage will allow them to store their vehicles on the property safely. The Applicant has also indicated to staff that they intend to widen the driveway with permeable pavers and seek a future expansion of the house so that the increased size of the garage will not appear out of character with the property or the neighborhood. No permits have been pulled for these projects yet, and while they would require separate building plan review, these projects would not require a variance. Associate Planner Hartmann reviewed the surrounding area, the Plan Evaluation and provided the Findings of Fact for review: 1. City Staff received a land use application for a request to build a bigger garage for a single family dwelling at the Subject Property 1434 County Road E. 2. A garage for a single-family detached dwelling is a permitted use in the R-1 Single Family Residential District. 3. The Subject Property is a legal nonconforming lot due to the lot not meeting the minimum width requirement for the R-1 District. 4. The Subject Property is non-conforming with the R-1 District’s standards for minimum lot length requirements. 5. The proposed development of the Subject Property would conform to all other requirements and standards of the R-1 district. 6. The Subject Property was previously granted a side yard setback variance of three (3) feet for a garage under Planning Case 00- 004. 7. The proposed structure would not exceed the three (3) foot variance distance previously approved. 8. A variance may be granted if enforcement of a provision in the zoning ordinance would cause the landowner practical difficulties. 9. Variances are only permitted when they are in harmony with the general purposes and intent of the ordinance. Associate Planner Hartmann stated staff recommends approval of Planning Case 20-014 for a Variance at 1434 County Road E, based on the findings of fact and the submitted plans, as amended by the conditions below: 1. A Building Permit shall be issued prior to commencement of construction. ARDEN HILLS PLANNING COMMISSION – September 9, 2020 3 2. The exterior materials of the proposed addition shall be consistent or complementary in color, texture and quality with those visible on the existing structure. 3. The roof of the proposed addition shall be integrated into, and consistent with, the existing roof of the structure and materials. 4. The Subject Property shall be limited to one (1) accessory structure. 5. The proposed building shall conform to all other standards and regulations in the City Code. 6. The proposed garage shall not exceed 1,100 square feet total. Associate Planner Hartmann reviewed the options available to the Planning Commission on this matter: 1. Recommend Approval with Conditions 2. Recommend Approval as Submitted 3. Recommend Denial 4. Table Chair Gehrig opened the floor to Commissioner comments. Commissioner Jefferys stated she appreciated the explanation from the applicant for the detached garage. She asked if the garage would more than double in size. Associate Planner Hartmann reported the garage would go from 528 square feet to 1100 square feet. Commissioner Jefferys indicated this would be a large garage for the neighborhood. She questioned if the neighborhood had any other four-car garages. Associate Planner Hartmann commented the neighboring property at 1426 County Road E had received a variance for a 3” side yard setback. He explained a site plan review was completed in 2019 at 4101 Gail Circle where an additional 703 square feet of garage space was requested. Commissioner Subramanian asked if the applicant would be installing another driveway for this garage. Associate Planner Hartmann stated staff had spoken with Ramsey County regarding this matter and noted a second driveway would not be allowed. He noted the applicant could expand the existing driveway but noted this would require a separate permit. Keith ___________, 1434 County Road E, explained the purpose of the garage expansion was to allow him to store all four of his vehicles indoors, especially during the winter months. Commissioner Jones questioned if the roofline of the old garage would be perpendicular to the new garage. Associate Planner Hartmann stated this was correct. ARDEN HILLS PLANNING COMMISSION – September 9, 2020 4 Commissioner Jones inquired if the proposed garage was a mirror image to the neighbor’s garage. Mr. ______________ commented he was asking for a garage that would mirror his neighbor’s garage. Commissioner Jones asked if there would be a problem with water runoff from the garage. Mr. ______________ discussed how the water ran off from his property to the rear into a creek. Commissioner Jones inquired if the permeable/non-permeable surface requirements were being met for this lot. Associate Planner Hartmann reported these requirements were being met for this zoning district given the fact this was a large R-1 lot. Commissioner Vijums questioned how many cars could be parked on the driveway. Mr. _______________ stated he could currently park four cars in the driveway. He noted he used to be able to park six cars in his driveway. Further discussion ensued regarding the visibility of the garage on the property. Commissioner Vijums commented what the applicant lost in sidewalk space to doesn’t equal what the applicant was asking for. He indicated the Commission would have to consider if the garage size was excessive even though it mimics the neighbor’s garage. Commissioner Weber stated there was a bit of conflicting information in the packet. He noted applicant had hoped to widen the driveway, which wasn’t going to happen anymore. He asked if the applicant planned to install a rear garage door. Associate Planner Hartmann commented according to the applicant’s plans there would be no rear garage door. Commissioner Weber questioned if the applicant would be allowed to complete mechanical work from the garage. Associate Planner Hartmann stated this would not be allowed. Community Development Manager/City Planner Mrosla explained this was a prohibited home occupation. Commissioner Wicklund asked what the dimensions were for the current garage. Associate Planner Hartmann reported the garage was 22 feet by 24 feet in size. Commissioner Wicklund inquired if the existing garage would be demolished. ARDEN HILLS PLANNING COMMISSION – September 9, 2020 5 Mr. ______________ stated the existing garage would remain in place and the additional square feet would be added (22 feet by 50 feet). Commissioner Wicklund questioned if City Code allowed for two accessory structures totaling 1,456 square feet. Associate Planner Hartmann reported this was the case. Commissioner Wicklund explained the applicant currently has 528 square feet of garage space and the applicant is asking for 1,100 additional square feet or 1,628 total square feet. He noted current City Code only allows for 1,456 square feet. Chair Gehrig thanked Commissioner Wicklund for the clarification. Community Development Manager/City Planner Mrosla stated this information was news to staff. He reported staff had the understanding the existing garage would be demolished. He noted the overall size that was allowed per City Code was 1,456 square feet. He explained the proposal before the Commission does not meet this requirement. Chair Gehrig suggested the Commission table action on this item to allow staff and the applicant to clarify some of the project details and that this matter be reviewed by the Commission in October. Commissioner Jones supported the matter being tabled. He stated he would like to see calculations regarding permeable surfaces with the garage addition and how much was taken by the City for the sidewalk. He commented he would also like to understand more about the neighbor’s garage and variance. He indicated he could support a garage the same size as the neighbor’s, but not exceeding this garage size. Community Development Manager/City Planner Mrosla reported the neighboring garage was roughly 1,000 square feet. He clarified that there was no “taking” of property for the sidewalk as the sidewalk was located within Ramsey County right-of-way. Commissioner Jefferys stated she supported this matter being tabled and she would like to understand how the applicant would be using a six car garage. Commissioner Vijums also supported this Planning Case being tabled. He encouraged the applicant to stick within the City’s zoning requirements for the garage. Chair Gehrig moved and Commissioner Jones seconded a motion to table action on Planning Case 20-014 a Variance for the property at 1434 County Road E to allow staff to clarify the structure size, to better understand the permeable surface area on the lot, as well as investigating other structures in the City that have exceeded the maximum allowable square footage of 1,456 square feet. A roll call vote was taken. The motion carried unanimously (7-0). B. Planning Case 20-018; 3246 New Brighton Road (Ecko Estates) Final Plat Request – No Public Hearing Required ARDEN HILLS PLANNING COMMISSION – September 9, 2020 6 Community Development Manager/City Planner Mrosla stated the Subject Property at 3246 New Brighton Road is approximately 3.12 acres in size and is comprised of the decommissioned Lake Johanna Fire Station No. 1 building, a detached garage, and parking areas. The two (2) existing structures are located along New Brighton Road but the topography slopes down significantly to a pond located on the easterly half of the property. It’s located in the R-2 Single and Two Family Residential District and is guided Very Low Density Residential in the Land Use Plan. Community Development Manager/City Planner Mrosla explained at their June 22, 2020 Regular Meeting, the City Council reviewed a Variance and Preliminary Plat request for the Subject Property. The Applicant submitted a Land Use application to subdivide the Subject Property into four single family lots with a reduced minimum lot width of 81.75 feet. However, the zoning ordinance requires a minimum of 85 feet in the R-2 district. The Council voted in the affirmative to approve the Variance and Preliminary Plat request during its June 22, 2020 meeting. During the previous approval process the Applicant elected not to apply for a Final Plat request simultaneously in case the project did not get approval from the City Council. Community Development Manager/City Planner Mrosla further discussed the Overview of the Request and provided the Findings of Fact for review: 1. City Staff received a land use application for a request for Final Plat at the Subject Property 3246 New Brighton Road. 2. The Subject Property at 3246 New Brighton Road is located in the R-2 – Single and Two Family Residential Zoning District and is guided as very low density on the Land Use plan. 3. The Subject Property is currently comprised of the former Lake Johanna Fire Station 1 building, a detached garage, and parking areas. 4. The City Council approved the Preliminary Plat and Variance for the Subject Property at their June 22, 2020 meeting. 5. The Applicant has requested a Final Plat to finalize the subdivision of the Subject Property into four (4) single-family residential lots. 6. The adjacent properties to the north, east, west and south are zoned R-2 District and are guided for Low Density Residential uses in the Arden Hills 2040 Comprehensive Plan 7. A single-family detached dwelling is a permitted use for the lots in the R-2 district where the Subject Property is located. 8. The proposed Final Plat meets the Subdivision Design requirements included in Section 1130 of the City Code. 9. The proposed development requires public use dedication, as required in Section 1130.08 of the City Code. Community Development Manager/City Planner Mrosla stated staff recommends approval of Planning Case 20-018 for a Final Plat at 3246 New Brighton Road, based on the findings of fact and the submitted plans, as amended by the conditions below: 1. All conditions of the Preliminary Plat approval shall remain in full force and effect. 2. Prior to the release of the Final Plat for recording, the Applicant shall enter into a Development Agreement. ARDEN HILLS PLANNING COMMISSION – September 9, 2020 7 3. All permanent easements and rights-of-way (ROW) necessary for existing street and utility improvements shall be granted to the City at no cost or paid for by the Developer. 4. The Developer shall be financially responsible for 100 percent of all storm sewer, sanitary sewer and water main area and connection charges applicable to the property. These charges are identified in a preliminary report prepared for the project and shall be in the Development Agreement. 5. Final Plat approval shall expire six months from the date of the City Council approval unless the Final Plat has recorded with Ramsey County or a time extension granted by the City Council. Community Development Manager/City Planner Mrosla reviewed the options available to the Planning Commission on this matter: 1. Recommend Approval with Conditions 2. Recommend Approval as Submitted 3. Recommend Denial 4. Table Chair Gehrig opened the floor to Commissioner comments. Commissioner Jones stated he was heartbroken to see the fire station going away, but noted he supported the proposed project. Commissioner Wicklund asked if Condition 3 was standard practice for the City. Community Development Manager/City Planner Mrosla recommended the “or” be changed to “and” in Condition 3. Commissioner Jones moved and Commissioner Subramanian seconded a motion to recommend approval of Planning Case 20-018 for a Final Plat at 3246 New Brighton Road based on the findings of fact and the submitted plans, as amended by the five (5) conditions as amended in the September 9, 2020, report to the Planning Commission. A roll call vote was taken. The motion carried unanimously (7-0). C. Planning Case 20-010; 4200 Round Lake Road – Planned Unit Development Request, Site Plan Review, Conditional Use Permit, Preliminary and Final Plat – Public Hearing Community Development Manager/City Planner Mrosla stated the Subject Property is currently owned by North American Land Company, LLC, a holding company related to Roberts Management Group. The Subject Property comprises two (2) parcels totaling approximately 26.08 acres located south of the cul-de-sac on Gateway Boulevard and north of Interstate 694 and east of 35W. There was a previously existing building located onsite that was removed in 2006. The Subject Property has had a few development proposals in the past. However, none of the projects have come to fruition. The Subject Property has since been vacant with wetlands located adjacent to Interstates (“35W and 694”). ARDEN HILLS PLANNING COMMISSION – September 9, 2020 8 Community Development Manager/City Planner Mrosla indicated the Applicant is proposing to construct a 250,000 square foot office and warehouse facility on the site. The site is highly visible from 694 and 35W. Separate access points to the site will be provided via Gateway Boulevard for employee parking and deliveries. The Applicant’s proposal includes office space, warehousing, and ground level unloading access with 38 dock doors located on the north side of the building. The site proposal includes at-grade office parking lots located on the south side of the building. Community Development Manager/City Planner Mrosla reviewed the surrounding area, the Plan Evaluation and provided the Findings of Fact for review: 1. The Applicant has submitted an application for a Planned Unit Development, Conditional Use Permit and Preliminary/Final Plat at the Subject Property 4200 Round Lake Road. 2. The Applicant is proposing a 250,000 square foot office and warehouse facility on the Subject Property. 3. The Applicant has submitted a preliminary and final plat to plat two (2) properties. 4. Flexibility through the PUD process has been requested in the following areas: district provisions, lot area, lot dimensions, parking setbacks, building height, minimum caliper inches, aesthetics, perennials and shrubberies. 5. The proposed development plan meets or exceeds the minimum requirements of the City Code in the following areas: building setbacks, landscape coverage, parking, planting islands, street trees, tree selection, floor area ratio, drainage wetlands and flood plain tree selection, lighting, screening. 6. Where the plan is not in conformance with the City Code, flexibility has been requested by the Applicant and/or conditions have been placed on an approval that would mitigate the nonconformity. 7. A traffic study has been completed for the proposed use and suggests that Ramsey County to add five (5) seconds to the signal timing for Round Lake Road and Hwy 96 to allow for more northbound left turns during the PM peak hour. 8. Existing public facilities and shall be able to absorb the additional demand for public services needed for the proposed use. 9. The Subject Property is located with the Gateway Business (“GB”) District and is guided as Light Industrial & Office on the 2040 Land Use Plan. 10. The proposed Preliminary Plat and Final Plat are consistent with the Arden Hills Zoning Map and the 2040 Comprehensive Plan. 11. The application is not anticipated to create a negative impact on the immediate area or the community as a whole. Community Development Manager/City Planner Mrosla stated staff recommends approval of Planning Case 20- 010 for a Planned Unit Development, Conditional Use Permit and Preliminary Plat/Final Plat at 4200 Round Lake Road, based on the findings of fact and submitted plans, subject to the following conditions: 1. The project shall be completed in accordance with the plans submitted and as amended by the conditions of approval. Any significant changes to the plans, as determined by the City Planner, shall require review and approval by the City Council. ARDEN HILLS PLANNING COMMISSION – September 9, 2020 9 2. The Preliminary Plat approval shall expire six months from the date of the City Council approval unless the Final Plat has recorded with Ramsey County or a time extension granted by the City Council. 3. The Applicant shall record the Final Plat with Ramsey County and a copy shall be provided to the City within sixty (60) days of the City’s approval. 4. The Applicant shall be financially responsible for all applicable water and sanitary charges. Rates applied shall be those in effect at the time of Final Plat approval and shall be memorialized in the Development Agreement. 5. A Development Agreement shall be prepared by the City Attorney and subject to City Council approval. The Development Agreement shall be fully executed prior to release of a building permit. 6. The Applicant shall submit a park dedication fee that shall be seven and a half (7.5) percent of the fair market value of the unimproved land and subject to the approval of the City Council. The park dedication fee shall be submitted prior to the release of the Final Plat. 7. Survey monuments shall be placed and installed at all block corners, angle points, points of curves in streets, and at intermediate points as shown on the Final Plat. Pipes or steel rods shall be placed at the corners of each lot. 8. The final plat shall provide dedication of a 60-ft wide right of way for Gateway Boulevard on Lot 2, Block 1 overlying the area currently encumbered by existing drainage and utility easement. 9. Prior to the issuance of a grading and erosion permit, planning staff shall approve in writing the final landscaping plan. 10. Prior to the issuance of a grading and erosion permit, engineering staff shall approve in writing the final location of the loading driveway access to align with adjacent commercial driveway or provide adequate offset distance. 11. A cross easement access and maintenance agreement for the proposed share access on Lot 2 shall be submitted and memorialized in the Development Agreement. 12. Site Plan approval shall be required for the construction of the proof of parking area. 13. All light poles, including base, shall be a maximum of 25 feet in height and shall be shoebox style, downward directed, with high-pressure sodium lamps or LED and flush lenses. Other than wash or architectural lighting, attached security lighting shall be shoebox style, downward directed with flush lenses. If complaints are received the lighting adjacent to residential uses shall utilize house shields as directed by the City. In addition, any lighting under canopies (building entries) shall be recessed and use a flush lens. 14. A right of way permit shall be required for work performed within the City right of way. 15. A grading as-built and utility as-built plan shall be provided to the City upon completion of grading and utility work. 16. No exterior storage shall be permitted. 17. This approval does not include signs. A separate sign permit is required for all proposed signage. All signage shall meet the requirements of Sign District 6. 18. Prior to the issuance of a building permit, a landscape financial security of $50,000.00 dollars shall be submitted. Landscape financial security is held for two full growing seasons. 19. All rooftop or ground mounted mechanical equipment shall be hidden from view with the same materials used on the building in accordance with City Code requirements. ARDEN HILLS PLANNING COMMISSION – September 9, 2020 10 20. All fencing and retaining wall materials shall be complementary to the building materials and shall be approved in writing by the Planning Division prior to issuance of a building permit. Retaining walls greater than four (4) feet in height shall be engineered and detailed calculations shall be submitted to the City. 21. Prior to City Council consideration, the Applicant shall submit a materials board to be approved in writing by staff. 22. A Grading and Erosion permit shall be obtained from the City’s Engineering Department prior to commencing any grading, land disturbance or utility activities. The Developer shall be responsible for obtaining any permits necessary from other agencies, including but not limited to, MPCA, Rice Creek Watershed District, and Ramsey County, MNDOT prior to the start of any site activities. 23. The Applicant shall be responsible for protecting the proposed on-site storm sewer infrastructure and components and any existing storm sewer from exposure to any and all stormwater runoff, sediments and debris during all construction activities. Temporary stormwater facilities shall be installed to protect the quality aspect of the proposed and existing stormwater facilities prior to and during construction activities. Maintenance of any and all temporary stormwater facilities shall be the responsibility of the Applicant. 24. Prior to the issuance of the Grading and Erosion permit, the Engineering Department shall review and approve final grading and utility plans in writing. Plans shall be amended to include detail drawings for connection to the sanitary sewer system in Gateway Boulevard, restoration of utility cuts within public streets, and inclusion of City details 3401, 3402, 3408, and 4000. 25. Any future trash enclosures shall utilize wooden gates and be constructed on three sides using the same materials and patterns used on the building. Locations shall be approved by the Planning Department. 26. The Applicant shall provide an executed copy of the City’s standard stormwater maintenance and easement agreement prior to approval of the Development Agreement. 27. All disturbed boulevards shall be restored with sod. 28. All areas of the site, where practical, shall be sodded or seeded and maintained. The property owner shall mow and maintain all site boulevards to the curb line of the public streets. 29. Overnight trailer parking is prohibited onsite other than along the dock wall within the concrete dock apron. 30. The Applicant shall work with Ramsey County to add five (5) seconds to the signal timing for Round Lake Road and Hwy 96 to allow for more northbound left turns during the PM peak hour prior to the issuance of a certificate of occupancy. 31. Warehousing and wholesaling shall not exceed 85 percent of the floor area tenant. The remaining 15 percent of floor area shall be non-warehouse uses such as a combination of uses including-but-not-limited-to office, manufacturing, production, research and development, lab and/or showroom per tenant. Community Development Manager/City Planner Mrosla reviewed the options available to the Planning Commission on this matter: 1. Recommend Approval with Conditions 2. Recommend Approval as Submitted 3. Recommend Denial 4. Table ARDEN HILLS PLANNING COMMISSION – September 9, 2020 11 Chair Gehrig opened the floor to Commissioner comments. Commissioner Jefferys stated this was a complex and detailed proposal. She requested staff provide the Commission with a brief history on this property. Community Development Manager/City Planner Mrosla commented he was unaware of the history this property due to his short time with the City. He understood an office building was previously approved for this site in 2006 when the lot was subdivided into two lots. Commissioner Jones questioned if the size of Lot 2 was going to be a concern. He stated he was surprised the site did not have two driveways to assist with maneuvering semi-trucks through the property. Community Development Manager/City Planner Mrosla reported the applicant had looked at a number of lot designs for Lot 2. He commented under the current standards the parcel could be developed and meet current requirements. He stated some flexibility may be needed for use. He provided further comment on how access was needed to the adjacent property. Ben Johnson, Kimley Horn, discussed the proposed access to the site. He noted two access points were not proposed due to the elevation and grade changes on the property. Dan ______________ explained the site would have a one-way loop through the property. He stated he had investigated two access points, but given the challenging grades, this was not possible. He believed the proposed access was a creative way to address the sites needs. Commissioner Subramanian asked if the size of the building would impact the wetland area. Mr. Johnson discussed the buildable area on the site and noted the building would be 250,000 square feet. Mr. ___________ reported the building would cover 26% of the lot area and the impervious area would an additional percentage of the lot. Mr. Johnson commented further on how he would be addressing the stormwater management for the site. He noted the existing pond would be expanded to hold the site’s water runoff per the Rice Creek Watersheds calculations. Commissioner Vijums questioned why the City was allowing for 10% more warehousing. Community Development Manager/City Planner Mrosla deferred this question to the applicant. Mr. Johnson explained the zoning requires 25% to 50% office, which was more office driven than in other communities. He reported he was asking for 85% warehousing and 15% other uses, which could include office space, lab space or manufacturing. ARDEN HILLS PLANNING COMMISSION – September 9, 2020 12 Commissioner Vijums stated this seemed reasonable and perhaps City Code needed to be amended to reflect how business was being done today. He then asked why the applicant was requesting an additional five feet of building height. Mr. Johnson commented historically buildings of this nature were built to an 18 or 24 foot clear height but over time this clear height has morphed into an increased height. He stated he was trying to plan for the long-term future of this building which led him to request a 40 foot building height. He indicated this building height would allow him greater flexibility to meet the needs of his future tenants. Commissioner Vijums thanked the applicant for answering his questions. He stated he could support the increased building height. Chair Gehrig requested comment from staff or the applicant regarding the building materials selection. Mr. Johnson reported he worked closely with staff on the building exterior. He then described the building materials that were being proposed for the development. Commissioner Vijums commented it appears the applicant is looking for flexibility on building height and percentage of warehousing space. He suggested the City look at changing the overall code versus granting variances/flexibilities for similar requests in the future. Community Development Manager/City Planner Mrosla stated this was a great point. He commented on the recently approved Comprehensive Plan and noted staff could address these concerns as part of the updates being made to the Gateway Business District. Commissioner Jefferys supported Commissioner Vijums recommendation that City Code be addressed. She asked if the applicant had experience with the proposed natural plantings or seed and how well this has worked. Community Development Manager/City Planner Mrosla commented he has had several projects that has used this seed and so long as invasive weeds are addressed, this seed can work really well once it takes. Mr. Johnson explained the proposed seed would be consistent with the native wetlands. He indicated he has had success with a variety of native plantings/seedings in other projects. Commissioner Jones stated he supported a code change as well. He indicated he supported the placement of this warehouse/distribution development. He encouraged staff to consider how signage would be impacted if the building height was raised to 40 feet. He commented overall he supported this project. Chair Gehrig opened the public hearing at 8:14 p.m. Chair Gehrig invited anyone for or against the application to come forward and make comment. Mr. Johnson questioned how quickly the plat had to be filed with the County. ARDEN HILLS PLANNING COMMISSION – September 9, 2020 13 Community Development Manager/City Planner Mrosla commented the applicant would have 60 days to file the plat with the County. Commissioner Jones recommended Condition 3 be amended to read sixty (60) days. There being no additional comment Chair Gehrig closed the public hearing at 8:16 p.m. Commissioner Vijums moved and Commissioner Wicklund seconded a motion to recommend approval of Planning Case 20-010 for a Planned Unit Development, Conditional Use Permit and Preliminary Plat/Final Plat at 4200 Round Lake Road based on the findings of fact and the submitted plans, as amended by the thirty-one (31) conditions as amended in the September 9, 2020, report to the Planning Commission. A roll call vote was taken. The motion carried unanimously (7-0). UNFINISHED AND NEW BUSINESS None. REPORTS A. Report from the City Council Councilmember Scott provided the Commission with an update from the City Council. He reported City Hall remains closed, but all City activities were operational. He noted all City meetings were being held virtually. He explained a Special JDA meeting was held on September 8th but the County representatives were not in attendance. He indicated the Ramsey County Sheriff’s Department would not be participating in Night to Unite. He discussed the staff changes that have occurred at City Hall. He stated he supported Commissioner Vijums recommendation that City Code be addressed to reduce the number of variance requests. B. Planning Commission Comments and Requests Commissioner Jefferys thanked staff for providing the Commission with detailed staff reports for each Planning Case. She stated she looked forward to being able to meet in person someday. Commissioner Weber requested the meeting packets be mailed out sooner in order to provide Commissioner’s with more time to review the material. Community Development Manager/City Planner Mrosla explained the Commission members could pick up their packets at City Hall the Thursday prior to each meeting. He noted staff has discussed the possibility of delivering packets. Councilmember Scott stated he would bring this concern to the City Council and explained all Council packets were hand delivered. ADJOURN ARDEN HILLS PLANNING COMMISSION – September 9, 2020 14 Commissioner Vijums moved, seconded by Commissioner Jefferys, to adjourn the September 9, 2020, Planning Commission Meeting at 8:28 p.m. A roll call vote was taken. The motion carried unanimously (7-0). Planning Case # 20-010 – Public Hearing RequiredApplicant: Scannell Properties Property Location: 4200 Round Lake RoadRequest: Master Planned Unit Development, Conditional Use Permit, Site Plan and Preliminary/Final PlatPark Dedication: Cash contributions Zoning: GB, Gateway Business District Land Use: Light Industrial & OfficeLot Size: 26.08 Acres ExistingConditions: ProposedLotsTotalAcresUseLot121.94DevelopmentParcelLot23.87Accessdrive serving Lot 1 andfuturedevelopmenton Lot 2Plating: 1987 GATEWAY BLVD4440 W ROUND LAKE RDParking Lot Setback20’ setback12’ setbackLot WidthEasementsand Setbacks: LotSize: Use- District Provisions 1320.13: BuildingHeight:Section 1305.04 of the City Code defines building height as “the vertical distance from the average elevation of the grade along a face of a building to the highest point of the roof surface of flat roofs, the deck line of mansard roofs, or the average height between the eaves and the highest ridge of gable, hip, or gambrel roofs.”40ft. Aesthetics:1987 GATEWAY BLVD4300 ROUND LAKE RD WGB District StandardsProposed FARFloorAreaRatio(FAR).4 .26 Screeningand Trees:Minimum Caliper Inches Calculations Two-story building for the purposes of determining gross square footage499,552 GSFMinimum caliper inches required1,561Cal In. or 624 2” treesProposed caliper inches 310 CalIn or 110 trees71 trees along the right-of-way adjacent to the Gateway Blvd. Parkingand Site Operations:Semi turningcross access Easement Parkingand Site Operations:Proof of ParkingUseGross Floor Area(Sq. Ft.)Required StallsNumber of Stalls ProvidedParking Surplus Business & Professional Office (one (1) parking space for each 250 sq. ft.)37,500(15%)150364(230 proof)+232Other Business and Industry ( one (1) for each employee on shift plus one (1) for each vehicle used in conducting the business or one (1) for each 1,000 sq. ft. of floor area, whichever is greater)212,500(85%)212Total250,000 362 593 LandscapedArea and Perennials and Shrubberies:Perennials and Shrubberies Calculations 35% of total landscaping required339,673 sq. ft.Proposed landscaped area652,668sq. ft.10% perennials and/or shrubbery65,266 sq. ft.Proposed Square Footage*2,888 sq. ft.•71 trees along the right-of-way adjacent to the Gateway Blvd. *170,000 square feet of Mesic Prairie seed mix onsite Traffic Study: xAM Peak Hour of Generator - 80 vehicles in and out of the sitexEight (8) warehouse related vehicles and 72 passenger vehiclesxPM Peak Hour of Generator - 83 vehicles in and out of the sitexEight (8) warehouse related vehicles and 75 passenger vehicles. xRecommendation -requests Ramsey County to add five (5) seconds to the signal timing for Round Lake Road and Hwy 96 to allow for more northbound left turns during the PM peak hour. Suggested Findings of Fact:Staff offers the following findings of fact for consideration:1. The Applicant has submitted an application for a Planned Unit Development, Conditional Use Permit and Preliminary/Final Plat atthe Subject Property 4200 Round Lake Road.2. TheApplicant is proposing a 250,000 square foot office and warehouse facility on the Subject Property.3. TheApplicant has submitted a preliminary and final plat to plat two (2) properties.4. Flexibility through the PUD process has been requested in the following areas: district provisions, lot area, lot dimensions, parkingsetbacks, building height, minimum caliper inches, aesthetics, perennials and shrubberies.5. The proposed development plan meets or exceeds the minimum requirements of the City Code in the following areas: buildingsetbacks, landscape coverage, parking, planting islands, street trees, tree selection, floor area ratio, drainage wetlands and flood plaintree selection, lighting, screening.6. Where the plan is not in conformance with the City Code, flexibility has been requested by the Applicant and/or conditions havebeen placed on an approval that would mitigate the nonconformity.7. Atraffic study has been completed for the proposed use and suggests that Ramsey County to add five (5) seconds to the signal timingfor Round Lake Road and Hwy 96 to allow for more northbound left turns during the PM peak hour.8. Existing public facilities and shall be ableto absorb the additional demand for public services needed for the proposed use.9. The Subject Property is located with the Gateway Business(“GB”)District and is guided as Light Industrial & Office on the 2040Land Use Plan.10. The proposed Preliminary Plat and Final Plat are consistent with the Arden Hills Zoning Map and the 2040 Comprehensive Plan.11. The application is not anticipated to create a negative impact on the immediate area or the community as a whole. Motion Options CUP:1. Approval: Motion to adopt Resolution 2020-045, approving the Conditional Use for Planning Case 20-010 at 4200 Round Lake Road, based on the findings of fact and the submitted materials.2. Denial: Motion to deny Resolution 2020-045, for a Conditional Usefor Planning Case 20-010 at 4200 Round Lake Road, based on thefollowing findings of fact:findings to deny should specificallyreference the reasons for denial and why those reasons cannot bemitigated.3. Table: Motion to table Resolution 2020-045, for a Conditional Usefor Planning Case 20-010 at 4200 Round Lake Road for the followingreasons:a specific reason and/or information request should beincluded with a motion to table. Motion Options Planned Unit Development, Site Plan Review, Preliminary and Final Plat:•Recommend Approval with Conditions:Motion to recommend approvalof Planning Case 20-010 for a Planned Unit Development, Site Plan Review, Preliminary and Final Plat at 4200 Round Lake Road, based on the findings of fact and submitted plans, subject to the 31 Conditions of approval. •Recommend Approval without Conditions: Motion to recommend approvalof Planning Case 20-010 for a Planned Unit Development, Site Plan Review, Preliminary and Final Plat at 4200 Round Lake Road, based on the findings of fact and submitted plans in the report to the Planning Commission.•Recommend Denial:Motion to recommend denialof Planning Case 20-010 for a Planned Unit Development, Site Plan Review, Preliminary and Final Plat at 4200 Round Lake Road based on the following findings of fact: the Planning Commission should identify findings to deny should specifically reference the reasons for denial and why those reasons cannot be mitigated.•Table:Motion to tablePlanning Case 20-010 for a Planned Unit Development, Site Plan Review, Preliminary and Final Plat at 4200 Round Lake Road for the following reasons: the Planning Commission should identify a specific reason and/or information request should be included with a motion to table. 1. The project shall be completed in accordance with the plans submitted and as amended by theconditions of approval. Any significant changes to the plans, as determined by the City Planner,shall require review and approval by the City Council.2. The Preliminary Plat approval shall expire six months from the date of the City Council approvalunless the Final Plat has recorded with Ramsey County or a time extension granted by the CityCouncil.3. The Applicant shall record the Final Plat with Ramsey County and a copy shall be provided to theCity within sixty (90) days of theCity’sapproval.4. The Applicant shall be financially responsible for all applicable water and sanitary charges. Ratesapplied shall be those in effect at the time of Final Plat approval and shall be memorialized in theDevelopment Agreement.5. A Development Agreement shall be prepared by the City Attorney and subject to City Councilapproval. The Development Agreement shall be fully executed prior to release of a building permit.6. The Applicant shall submit a park dedication fee that shall be seven and a half (7.5) percent of thefair market value of the unimproved land and subject to the approval of the City Council. The parkdedication fee shall be submitted prior to the release of the Final Plat.7. Survey monuments shall be placed and installed at all block corners, angle points, points of curvesin streets, and at intermediate points as shown on the Final Plat. Pipes or steel rods shall be placedat the corners of each lot.8. The final plat shall provide dedication of a 60-ft wide right of way for Gateway Boulevard on Lot2, Block 1 overlying the area currently encumbered by existing drainage and utility easement.9. Prior to the issuance of a grading and erosion permit, planning staff shall approve in writing thefinal landscaping plan.10.Prior to the issuance of a grading and erosion permit, engineering staff shall approve in writing thefinal location of the loading driveway access to align with adjacent commercial driveway orprovide adequate offset distance.Conditions of Approval 11. A cross easement access and maintenance agreement for the proposed share access on Lot 2shall be submitted and memorialized in the DevelopmentAgreement.12.Site Plan approval shall be required for the construction of the proof of parking area.13.All light poles, including base, shall be a maximum of 25 feet in height and shall be shoeboxstyle, downward directed, with high-pressure sodium lamps or LED and flush lenses. Otherthan wash or architectural lighting, attached security lighting shall be shoebox style,downward directed with flush lenses. If complaints are received the lighting adjacent toresidential uses shall utilize house shields as directed by the City. In addition, any lightingunder canopies (building entries) shall be recessed and use a flush lens.14.Aright of way permit shall be required for work performed within the City right of way.15.A grading as-built and utility as-built planshall be provided to the City upon completion ofgrading and utility work.16.No exterior storage shall be permitted.17.This approval does not include signs. A separate sign permit is required for all proposedsignage.All signage shall meet the requirements of Sign District 6.18.Prior to the issuance of a building permit, a landscape financial security of $50,000.00 dollarsshall be submitted. Landscape financial security is held for two full growing seasons.19.All rooftop or ground mounted mechanical equipment shall be hidden from view with thesame materials used on the building in accordance with City Code requirements.20.All fencing and retaining wall materials shall be complementary to the building materials andshall be approved in writing by the Planning Division prior to issuance of a building permit.Retaining walls greater than four (4) feet in height shall be engineered and detailedcalculations shall be submitted to the City. 21. Prior to City Council consideration, the Applicant shall submit a materials board to be approved in writingby staff.22.A Grading and Erosion permit shall be obtained from theCity’sEngineering Department prior to commencingany grading, land disturbance or utility activities. The Developer shall be responsible for obtaining any permitsnecessary from other agencies, including but not limited to, MPCA, Rice Creek Watershed District, andRamsey County, MNDOT prior to the start of any site activities.23.The Applicant shall be responsible for protecting the proposed on-site storm sewer infrastructure andcomponents and any existing storm sewer from exposure to any and all stormwater runoff, sediments anddebris during all construction activities. Temporary stormwater facilities shall be installed to protect thequality aspect of the proposed and existing stormwater facilities prior to and during construction activities.Maintenance of any and all temporary stormwater facilities shall be the responsibility of theApplicant.24.Prior to the issuance of the Grading and Erosion permit, the Engineering Department shall review and approvefinal grading and utility plans in writing. Plans shall be amended to include detail drawings for connection tothe sanitary sewer system in Gateway Boulevard, restoration of utility cuts within public streets, and inclusionof City details 3401, 3402, 3408, and 4000.25.Any future trash enclosures shall utilize wooden gates and be constructed on three sides using the samematerials and patterns used on the building. Locations shall be approved by the Planning Department.26.The Applicant shall provide an executed copy of theCity’sstandard stormwater maintenance and easementagreement prior to approval of the DevelopmentAgreement.27.All disturbed boulevards shall be restored with sod.28.All areas of the site, where practical, shall be sodded or seeded and maintained. The property owner shallmow and maintain all site boulevards to the curb line of the public streets.29.Overnight trailer parking is prohibited onsite other than along the dock wall within the concrete dock apron.30.The Applicant shall work with Ramsey County to add five (5) seconds to the signal timing for Round LakeRoad and Hwy 96 to allow for more northbound left turns during the PM peak hour prior to the issuance of acertificate of occupancy.31.Warehousing and wholesaling shall not exceed 85 percent of the floor area tenant. The remaining 15 percent offloor area shall be non-warehouse uses such as a combination of uses including-but-not-limited-to office,manufacturing, production, research and development, lab and/or showroom per tenant. Page 1 of 1 NEW BUSINESS – 10A MEMORANDUM DATE: September 28, 2020 TO: Honorable Mayor and City Councilmembers Dave Perrault, City Administrator FROM: Gayle Bauman. Finance Director Mary Tomnitz, Accounting Clerk SUBJECT: Adopting and Confirming Quarterly Special Assessments for Delinquent Utilities Budgeted Amount: Actual Amount: Funding Source: $ $ $ Council Should Consider A motion to approve Resolution 2020-044 certifying delinquent utilities to Ramsey County. Background Delinquent utility amounts are certified to Ramsey County quarterly. A list of utility accounts with a delinquent balance was compiled and notices dated August 17, 2020 were mailed. These customers were informed of their delinquent status and were asked to make payment of the delinquent balance by September 18, 2020. Utility accounts with an unpaid delinquent balance would be certified to Ramsey County to be added to property taxes payable in 2021. The certification amount is equal to the unpaid delinquent balance plus an eight percent penalty. The list of remaining delinquent utility accounts, as of September 18, 2020 is attached. The City will request that Ramsey County levy the delinquent balances against the respective properties. Attachments Attachment A: Resolution No. 2020-044 and Delinquent Utility Accounts List To view the final document, access adopted Resolutions via Arden Hills Public Laserfiche Weblink by visiting cityofardenhills.org and clicking on Archived Documents under Helpful Links on our main webpage. CITY OF ARDEN HILLS COUNTY OF RAMSEY STATE OF MINNESOTA RESOLUTION NO. 2020-044 RESOLUTION ADOPTING AND CONFIRMING QUARTERLY SPECIAL ASSESSMENTS FOR DELINQUENT UTILITIES WHEREAS, the amount to be specially assessed for DELINQUENT UTILITIES has been duly calculated in accordance with the provisions of the Municipal Code and Minnesota Statues; and WHEREAS, notices have been duly mailed as required by law; and WHEREAS, said proposed assessments have at all times since their filing been open for public inspection, and an opportunity has been given to all interested parties to present objections if any, to the proposed assessments; and WHEREAS, there were no oral or written objections received. 1. The amounts so calculated and set forth in said notices are hereby levied against the respective parcels of land described therein, and 2. The proposed assessments are hereby adopted and confirmed as special assessments for each of said parcels of land and the assessments together with an additional penalty of eight percent (8%) of the original unpaid amount, inclusive of any previous delinquency penalty, shall be a lien concurrent with general taxes upon such parcel. NOW THEREFORE, BE IT RESOLVED by the City Council of the City of Arden Hills, Minnesota, that the City Administrator be authorized and directed to transmit to the County Auditor a certified duplicate of the assessment roll to be extended upon the property tax lists of the County, and the County Auditor shall collect said special assessments with taxes levied in 2020, payable in 2021: ADOPTED BY THE CITY COUNCIL OF THE CITY OF ARDEN HILLS THIS 28th DAY OF SEPTEMBER, 2020. ____________________________________ ATTEST: DAVID GRANT, MAYOR __________________________________________ JULIE HANSON, CITY CLERK Pacel ID Account_No Service Address Water Sewer Storm Total 8% Penalty Assessment Arrears Total 343023440085 000091-000 1174 EDGEWATER AVE 36.28 64.54 15.61 116.43 9.31 125.74 223023240216 000223-000 4361 ARDEN VIEW CT 3.50 176.57 33.53 213.60 17.09 230.69 223023340036 000231-000 4101 HAMLINE AVE N 89.64 108.90 15.61 214.15 17.13 231.28 223023240275 000290-000 4442 ARDEN VIEW CT 104.96 125.86 20.24 251.06 20.08 271.14 223023240336 000367-000 4335 ARDEN VIEW CT 83.22 97.96 20.24 201.42 16.11 217.53 223023240326 000375-000 4370 ARDEN VIEW CT 81.04 95.03 20.24 196.31 15.70 212.01 223023210030 000408-000 1375 ARDEN VIEW DR 109.32 134.11 20.24 263.67 21.09 284.76 223023210057 000454-000 1393 ARDEN VIEW DR 64.46 72.71 20.24 157.41 12.59 170.00 223023210108 000502-000 1444 ARDEN VIEW DR 174.60 249.16 20.24 444.00 35.52 479.52 223023120013 000569-000 1307 KARTH LAKE CIR 162.29 196.22 15.61 374.12 29.93 404.05 223023320013 000743-000 4283 NORMA AVE 277.45 692.59 15.61 985.65 78.85 1,064.50 223023120007 000990-000 1337 KARTH LAKE CIR 80.83 120.31 15.61 216.75 17.34 234.09 283023330013 001255-000 2027 THOM DR 90.36 98.87 15.61 204.84 16.39 221.23 163023340015 002285-000 4627 HIGHWAY 10 235.83 287.91 15.61 539.35 43.15 582.50 283023410038 001344-000 3757 MCCRACKEN LN 123.43 149.90 15.61 288.94 23.12 312.06 273023340016 001493-000 1442 Arden Oaks Drive 77.90 93.08 15.61 186.59 14.93 201.52 213023430017 001534-000 1791 JANET CT 100.64 124.56 15.61 240.81 19.26 260.07 333023110036 001551-000 1611 LAKE JOHANNA BLVD 121.50 146.20 15.61 283.31 22.66 305.97 283023120052 001575-000 1761 LAKE VALENTINE RD 94.52 117.04 15.61 227.17 18.17 245.34 213023410051 001584-000 1681 BRUEBERRY LN 65.28 77.11 20.24 162.63 13.01 175.64 343023330050 001671-000 3130 RIDGEWOOD RD 60.72 67.72 15.61 144.05 11.52 155.57 343023410055 001808-000 1171 CARLTON DR 172.74 207.73 15.61 396.08 31.69 427.77 333023340020 001884-000 3223 LAKE JOHANNA BLVD 94.94 117.43 15.61 227.98 18.24 246.22 333023340066 001897-000 1921 GLEN PAUL AVE 105.18 129.67 15.61 250.46 20.04 270.50 343023210016 001920-000 1437 ARDEN PL 86.21 104.83 15.61 206.65 16.53 223.18 333023420038 001969-000 3290 LAKE JOHANNA BLVD 92.93 115.14 15.61 223.68 17.89 241.57 333023240032 002096-000 1876 GRANT RD 159.11 190.50 15.61 365.22 29.22 394.44 343023420053 002098-000 3330 DUNLAP ST N 57.87 87.35 21.78 167.00 13.36 180.36 343023310015 002293-000 3354 SNELLING AVE N 54.42 58.96 15.61 128.99 10.32 139.31 283023330032 003132-000 3670 CLEVELAND AVE N 53.15 56.93 15.61 125.69 10.06 135.75 333023330057 003236-000 2015 GLEN PAUL AVE 88.53 106.47 15.61 210.61 16.85 227.46 283023330012 003256-000 2023 THOM DR 109.30 135.55 15.61 260.46 20.84 281.30 223023240240 003444-000 4412 ARDEN VIEW CT 127.83 160.25 20.24 308.32 24.67 332.99 343023140009 003823-000 1115 BENTON WAY 91.59 135.09 15.61 242.29 19.38 261.67 223023210007 003937-000 1343 ARDEN VIEW DR 109.33 133.91 20.24 263.48 21.08 284.56 343023420014 004546-000 1253 INGERSON RD 1.29 71.30 8.29 80.88 6.47 87.35 223023330015 004713-000 4149 NORMA AVE 110.13 135.05 15.61 260.79 20.86 281.65 223023210117 005368-000 1450 ARDEN VIEW DR 67.19 78.96 20.24 166.39 13.31 179.70 213023120004 005384-000 4541 LAKESHORE PL 81.07 120.63 15.61 217.31 17.38 234.69 283023130030 005473-000 1751 GLENVIEW AVE 89.22 107.00 15.61 211.83 16.95 228.78 213023430004 006414-000 4108 VALENTINE CREST RD 53.16 63.89 17.57 134.62 10.77 145.39 213023410028 006494-000 1675 BRUEBERRY LN 87.11 106.50 20.24 213.85 17.11 230.96 223023240248 007082-000 4416 ARDEN VIEW CT 90.53 109.79 20.24 220.56 17.64 238.20 283023330011 007090-000 1971 THOM DR 66.88 76.92 15.61 159.41 12.75 172.16 333023310030 007153-000 1827 BECKMAN AVE 121.33 147.34 15.61 284.28 22.74 307.02 223023230016 007235-000 1528 MCCLUNG DR 132.85 152.31 15.61 300.77 24.06 324.83 333023240019 008210-000 1873 GRANT RD 51.16 69.44 15.61 136.21 10.90 147.11 343023420030 008243-000 1277 INGERSON RD 2.31 276.54 14.86 293.71 23.50 317.21 223023320026 008331-000 1469 COLLEEN AVE 182.26 218.85 15.61 416.72 33.34 450.06 333023340067 009129-000 1927 GLEN PAUL AVE 93.92 116.18 15.61 225.71 18.06 243.77 283023120003 009894-000 1748 LAKE VALENTINE RD 1.66 38.98 10.65 51.29 4.10 55.39 223023240322 009989-000 4478 ARDEN VIEW CT 95.39 112.08 20.24 227.71 18.22 245.93 343023140015 010758-000 1132 BENTON WAY 183.86 225.50 15.61 424.97 34.00 458.97 213023140012 011270-000 4337 OLD HIGHWAY 10 76.26 113.71 15.61 205.58 16.45 222.03 223023240239 011640-000 4413 ARDEN VIEW CT 2.02 82.33 16.78 101.13 8.09 109.22 273023340057 012232-000 3663 HAMLINE AVE N 87.93 115.64 15.61 219.18 17.53 236.71 333023330024 012306-000 1983 EDGEWATER AVE 97.73 127.71 15.61 241.05 19.28 260.33 5,416.16 7,702.81 964.15 14,083.12 1,126.63 15,209.75 City of Arden Hills City Council Meeting for September 28, 2020 P:\Planning\Planning Cases\2020\20-010 4200 Round Lake Road PP PUD\CC Packets Page 1 of 7 NEW BUSINESS – 10B MEMORANDUM DATE: September 28, 2020 TO: Honorable Mayor and City Councilmembers Dave Perrault, City Administrator FROM: Mike Mrosla, Community Development Manager/City Planner SUBJECT: Planning Case # 20-010 Applicant: Scannell Properties Property Location: 4200 Round Lake Road Request: Master Planned Unit Development, Conditional Use Permit, Site Plan and Preliminary/Final Plat Budgeted Amount: Actual Amount: Funding Source: N/A N/A N/A Council shall consider: Adopting motions to approve, table or deny Planning Case 20-010 for Scannell Properties proposed development at 4200 Round Lake Road. Background Scannell Properties (“Applicant”) is proposing to construct a 250,000 square foot office and warehouse facility on the existing vacant land located at 4200 Road Lake Road (“Subject Property”). The Applicant is also requesting to subdivide the subject parcel into two (2) lots of record. The Subject Property is zoned GB, Gateway Business District and is guided as Light Industrial & Office on the Land Use Plan. The City Council was asked to hold the required public hearing for Planning Case 20-010 under Agenda Item 9B on September 28, 2020. A full evaluation of the proposed redevelopment and supporting attachments are included in the staff report under Agenda Item 9B. The remainder of this memo focuses on the requested approvals, findings of fact and the staff recommended conditions if a motion to approve is made. City of Arden Hills City Council Meeting for September 28, 2020 P:\Planning\Planning Cases\2020\20-010 4200 Round Lake Road PP PUD\CC Packets Page 2 of 7 Requested Action 1. Conditional Use Permit A Conditional Use Permit is required for a warehousing use within the GB District. City Code Section 1355.04 Subd. 3 of the Arden Hills Zoning Code lists the criteria for evaluating a Conditional Use Permit. The Planning Commission and City Council should consider the effect of the proposed use upon the health, safety, convenience and general welfare of the owners and occupants of the surrounding land and the community, in general, including but not limited to the following factors and findings: 1. Existing and anticipated traffic and parking conditions; A traffic study was required and was completed by Kimley-Horn and Associates. The proposed trip generation is fairly low based on the Applicants proposed use of an office/warehouse use. The traffic study only had one (1) recommended improvement. The recommendation requests Ramsey County to add five (5) seconds to the signal timing for Round Lake Road and Hwy 96 to allow for more northbound left turns during the PM peak hour. As a condition of approval the Applicant shall work with Ramsey County to add five (5) seconds to the signal timing for Round Lake Road and Hwy 96 to allow for more northbound left turns during the PM peak hour prior to the issuance of a certificate of occupancy. 2. Noise, glare, odors, vibration, smoke, dust, air pollution, heat, liquid or solid waste, and other nuisance characteristics; The proposed use does not conflict with the business functions of the existing businesses and will not pose a significant detrimental risk or nuisance to the health, safety, and general welfare of occupants of surrounding lands. 3. Drainage; The proposed site plan does not negatively impact drainage on adjacent properties and the submitted stormwater onsite meets the quantity and quality standards. 4. Population density; The proposed project does not increase population density. 5. Visual and land use compatibility with uses and structures on surrounding land; The GB district requires materials and colors selected for any individual building shall be compatible with other buildings in the GB District. The Applicant is proposing to use a color palette similar to the existing buildings on Gateway Boulevard. City of Arden Hills City Council Meeting for September 28, 2020 P:\Planning\Planning Cases\2020\20-010 4200 Round Lake Road PP PUD\CC Packets Page 3 of 7 6. Adjoining land values; The proposed development is not anticipated to negatively impact adjacent property values. 7. Park dedications where applicable; The cash contribution fee shall be seven and a half (7.5) percent of the fair market value of the unimproved land or $230,910.00. The City may require the payment prior to the release of the Final Plat or at a later time under terms agreed upon in the development agreement. Park dedication for Lot 2 will be determined at the time of development. 8. Orderly development of the neighborhood and the City within the general purpose and intent of the Zoning Code and the Comprehensive Development Plan for the City. Planning Case 20-010 for Scannell Properties proposed development at 4200 Round Lake is consistent with the purpose and intent of the R-2 Zoning District and with the policies within the City’s Comprehensive Plan. Suggested Findings of Fact: The Planning Commission reviewed this application at their September 9, 2020, meeting and have offered the following findings of fact for your consideration: 1. The Applicant has submitted an application for a Planned Unit Development, Conditional Use Permit and Preliminary/Final Plat at the Subject Property 4200 Round Lake Road. 2. The Applicant is proposing a 250,000 square foot office and warehouse facility on the Subject Property. 3. The Applicant has submitted a preliminary and final plat to plat two (2) properties. 4. Flexibility through the PUD process has been requested in the following areas: district provisions, lot area, lot dimensions, parking setbacks, building height, minimum caliper inches, aesthetics, perennials and shrubberies. 5. The proposed development plan meets or exceeds the minimum requirements of the City Code in the following areas: building setbacks, landscape coverage, parking, planting islands, street trees, tree selection, floor area ratio, drainage wetlands and flood plain tree selection, lighting, screening. 6. Where the plan is not in conformance with the City Code, flexibility has been requested by the Applicant and/or conditions have been placed on an approval that would mitigate the nonconformity. 7. A traffic study has been completed for the proposed use and suggests that Ramsey County to add five (5) seconds to the signal timing for Round Lake Road and Hwy 96 to allow for more northbound left turns during the PM peak hour. 8. Existing public facilities and shall be able to absorb the additional demand for public services needed for the proposed use. 9. The Subject Property is located with the Gateway Business (“GB”) District and is guided as Light Industrial & Office on the 2040 Land Use Plan. City of Arden Hills City Council Meeting for September 28, 2020 P:\Planning\Planning Cases\2020\20-010 4200 Round Lake Road PP PUD\CC Packets Page 4 of 7 10. The proposed Preliminary Plat and Final Plat are consistent with the Arden Hills Zoning Map and the 2040 Comprehensive Plan. 11. The application is not anticipated to create a negative impact on the immediate area or the community as a whole. Options and Motion Language The Planning Commission reviewed this application at their September 9, 2020 meeting. At that time, they recommended approval of Summit Development’s application for a Site Plan Review, Planned Unit Development, Conditional Use Permit, Preliminary Plat and Final Plat by a 7-0 vote. The following are motion language options for the City Council to consider. A Conditional Use Permit is required for warehousing uses within the Gateway Business District. 1. Approval: Motion to adopt Resolution 2020-045, approving the Conditional Use for Planning Case 20-010 at 4200 Round Lake Road, based on the findings of fact and the submitted materials. 2. Denial: Motion to deny Resolution 2020-045, for a Conditional Use for Planning Case 20-010 at 4200 Round Lake Road, based on the following findings of fact: findings to deny should specifically reference the reasons for denial and why those reasons cannot be mitigated. 3. Table: Motion to table Resolution 2020-045, for a Conditional Use for Planning Case 20-010 at 4200 Round Lake Road for the following reasons: a specific reason and/or information request should be included with a motion to table. Planned Unit Development, Site Plan, Preliminary and Final Plat 1. Recommend Approval with Conditions: Motion to recommend approval of Planning Case 20- 010 for a Planned Unit Development, Site Plan Review, Preliminary and Final Plat at 4200 Round Lake Road, based on the findings of fact and submitted plans, subject to the following conditions: 1. The project shall be completed in accordance with the plans submitted and as amended by the conditions of approval. Any significant changes to the plans, as determined by the City Planner, shall require review and approval by the City Council. 2. The Preliminary Plat approval shall expire six months from the date of the City Council approval unless the Final Plat has recorded with Ramsey County or a time extension granted by the City Council. 3. The Applicant shall record the Final Plat with Ramsey County and a copy shall be provided to the City within sixty (90) days of the City’s approval. 4. The Applicant shall be financially responsible for all applicable water and sanitary charges. Rates applied shall be those in effect at the time of Final Plat approval and shall be memorialized in the Development Agreement. 5. A Development Agreement shall be prepared by the City Attorney and subject to City Council approval. The Development Agreement shall be fully executed prior to release of a building permit. 6. The Applicant shall submit a park dedication fee that shall be seven and a half (7.5) percent of the fair market value of the unimproved land and subject to the approval of City of Arden Hills City Council Meeting for September 28, 2020 P:\Planning\Planning Cases\2020\20-010 4200 Round Lake Road PP PUD\CC Packets Page 5 of 7 the City Council. The park dedication fee shall be submitted prior to the release of the Final Plat. 7. Survey monuments shall be placed and installed at all block corners, angle points, points of curves in streets, and at intermediate points as shown on the Final Plat. Pipes or steel rods shall be placed at the corners of each lot. 8. The final plat shall provide dedication of a 60-ft wide right of way for Gateway Boulevard on Lot 2, Block 1 overlying the area currently encumbered by existing drainage and utility easement. 9. Prior to the issuance of a grading and erosion permit, planning staff shall approve in writing the final landscaping plan. 10. Prior to the issuance of a grading and erosion permit, engineering staff shall approve in writing the final location of the loading driveway access to align with adjacent commercial driveway or provide adequate offset distance. 11. A cross easement access and maintenance agreement for the proposed share access on Lot 2 shall be submitted and memorialized in the Development Agreement. 12. Site Plan approval shall be required for the construction of the proof of parking area. 13. All light poles, including base, shall be a maximum of 25 feet in height and shall be shoebox style, downward directed, with high-pressure sodium lamps or LED and flush lenses. Other than wash or architectural lighting, attached security lighting shall be shoebox style, downward directed with flush lenses. If complaints are received the lighting adjacent to residential uses shall utilize house shields as directed by the City. In addition, any lighting under canopies (building entries) shall be recessed and use a flush lens. 14. A right of way permit shall be required for work performed within the City right of way. 15. A grading as-built and utility as-built plan shall be provided to the City upon completion of grading and utility work. 16. No exterior storage shall be permitted. 17. This approval does not include signs. A separate sign permit is required for all proposed signage. All signage shall meet the requirements of Sign District 6. 18. Prior to the issuance of a building permit, a landscape financial security of $50,000.00 dollars shall be submitted. Landscape financial security is held for two full growing seasons. 19. All rooftop or ground mounted mechanical equipment shall be hidden from view with the same materials used on the building in accordance with City Code requirements. 20. All fencing and retaining wall materials shall be complementary to the building materials and shall be approved in writing by the Planning Division prior to issuance of a building permit. Retaining walls greater than four (4) feet in height shall be engineered and detailed calculations shall be submitted to the City. 21. Prior to City Council consideration, the Applicant shall submit a materials board to be approved in writing by staff. 22. A Grading and Erosion permit shall be obtained from the City’s Engineering Department prior to commencing any grading, land disturbance or utility activities. The Developer shall be responsible for obtaining any permits necessary from other agencies, including but not limited to, MPCA, Rice Creek Watershed District, and Ramsey County, MNDOT prior to the start of any site activities. City of Arden Hills City Council Meeting for September 28, 2020 P:\Planning\Planning Cases\2020\20-010 4200 Round Lake Road PP PUD\CC Packets Page 6 of 7 23. The Applicant shall be responsible for protecting the proposed on-site storm sewer infrastructure and components and any existing storm sewer from exposure to any and all stormwater runoff, sediments and debris during all construction activities. Temporary stormwater facilities shall be installed to protect the quality aspect of the proposed and existing stormwater facilities prior to and during construction activities. Maintenance of any and all temporary stormwater facilities shall be the responsibility of the Applicant. 24. Prior to the issuance of the Grading and Erosion permit, the Engineering Department shall review and approve final grading and utility plans in writing. Plans shall be amended to include detail drawings for connection to the sanitary sewer system in Gateway Boulevard, restoration of utility cuts within public streets, and inclusion of City details 3401, 3402, 3408, and 4000. 25. Any future trash enclosures shall utilize wooden gates and be constructed on three sides using the same materials and patterns used on the building. Locations shall be approved by the Planning Department. 26. The Applicant shall provide an executed copy of the City’s standard stormwater maintenance and easement agreement prior to approval of the Development Agreement. 27. All disturbed boulevards shall be restored with sod. 28. All areas of the site, where practical, shall be sodded or seeded and maintained. The property owner shall mow and maintain all site boulevards to the curb line of the public streets. 29. Overnight trailer parking is prohibited onsite other than along the dock wall within the concrete dock apron. 30. The Applicant shall work with Ramsey County to add five (5) seconds to the signal timing for Round Lake Road and Hwy 96 to allow for more northbound left turns during the PM peak hour prior to the issuance of a certificate of occupancy. 31. Warehousing and wholesaling shall not exceed 85 percent of the floor area tenant. The remaining 15 percent of floor area shall be non-warehouse uses such as a combination of uses including-but-not-limited-to office, manufacturing, production, research and development, lab and/or showroom per tenant. 2. Recommend Approval without Conditions: Motion to recommend approval of Planning Case 20-010 for a Planned Unit Development, Site Plan Review, Preliminary and Final Plat at 4200 Round Lake Road, based on the findings of fact and submitted plans in the report to the Planning Commission. 3. Recommend Denial: Motion to recommend denial of Planning Case 20-010 for a Planned Unit Development, Site Plan Review, Preliminary and Final Plat at 4200 Round Lake Road based on the following findings of fact: the Planning Commission should identify findings to deny should specifically reference the reasons for denial and why those reasons cannot be mitigated. 4. Table: Motion to table Planning Case 20-010 for a Planned Unit Development, Site Plan Review, Preliminary and Final Plat at 4200 Round Lake Road for the following reasons: the Planning Commission should identify a specific reason and/or information request should be included with a motion to table. City of Arden Hills City Council Meeting for September 28, 2020 P:\Planning\Planning Cases\2020\20-010 4200 Round Lake Road PP PUD\CC Packets Page 7 of 7 Notice and Public Comments Notice was published in the Pioneer Press on September 18, 2020. Staff has not received and comments. Deadline for Agency Actions The City of Arden Hills received the completed application for this request on August 29, 2020. Pursuant to Minnesota State Statute, the City must act on this request by October 28, 2020 (60 days), unless the City provides the Petitioner with written reasons for an additional 60 day review period. The City may, with the consent of the Applicant, extend the review period beyond the initial 120 days. Budget Impact NA Attachments A. Ramsey County Estimated Tax Value B. Resolution 2020-045 9/22/2020Beacon - Ramsey County, MN - Property Tax: 213023310032https://beacon.schneidercorp.com/application.aspx?app=RamseyCountyMN&PageType=Report&Page=PropertyTax&KeyValue=213023310032 1/3Pay Property TaxesParcel ID213023310032Parcel StatusActivePropertyAddress4200WestROUNDLAKERDARDEN HILLS, MN 55112Sec/Twp/Rng21/030/023Brief TaxbDescriptionLot 1 Block 1 of TRAVERSE BUSINESS CENTEREXTHATPARTOFLOT1BLK1INT.I.1210(Note: Not to be usedbon legal documents)Parcel Area20.80 AcresParcelbWidth0 FeetParcelDepth0Feet(Note: Width and Depth represent buildable area of lot in the case of irregularly shaped lots)Tax ClassiØcation3A-Commercial/Industrial/Public UtilityRoll TypeReal PropertyMunicipalityARDENHILLSSchool DistrictISD #621WatershedRICE CREEK W/STIF DistrictLandUseCode400C -COMMERCIALVACANTLAND* The Tax ClassiØcation is the Assessor OfØce’s determination of the use of the property and is not the same as the property’s zoning. * Please contact the zoning authority for information regarding zoning. * To determine whether your property is Abstract or Torrens, call 651-266-2050*Multi-ParcelLinkdisplaysadditionalparcelsthatarelinkedtogetherforcomputationofnettaxcapacityPleaserefertodisclaimeratbottomofthispageTypeNameAddressOwnerNorth American Land Company Llc1851 Buerkle Rd White Bear Lake MN 55110-5246 First Half Due 05-15-2020AmountDue$53,200.00Penaltyb&bFeesb(thrubcurrentbmonth)$0.00 Sub Total$53,200.00Payments Made($53,200.00)BalanceDue$0.00Total Due bbbb$53,200.00Second Half Due 10-15-2020AmountDue$53,200.00Penaltyb&bFeesb(thrubcurrentbmonth)$0.00 Sub Total$53,200.00Payments Made$0.00BalanceDue$53,200.00bPayPropertyTaxSummary ViewMulti-Parcel Link213023340009TaxpayersCurrent Tax Year*Information listed is as of yesterday. For speciØc payoff information contact Property Tax Info at 651-266-2000 9/22/2020Beacon - Ramsey County, MN - Property Tax: 213023310032https://beacon.schneidercorp.com/application.aspx?app=RamseyCountyMN&PageType=Report&Page=PropertyTax&KeyValue=213023310032 2/3bb2020 Payable 2019 Payable 2018 Payable 2017 Payable 2016 PayablebEstimated Market Value $3,078,800 $3,078,800 $3,078,800 $3,078,800 $3,078,800bTaxable Market Value $3,078,800 $3,078,800 $3,078,800 $3,078,800 $3,078,800bbbbbbbbNet Tax Amount $106,400.00 $105,466.00 $108,262.00 $112,616.00 $116,106.00+ Special Assessments $0.00 $0.00 $0.00 $0.00 $0.00=Total Taxes$106,400.00 $105,466.00 $108,262.00 $112,616.00 $116,106.00+ Penalty $0.00 $0.00 $0.00 $0.00 $0.00+ Interest $0.00 $0.00 $0.00 $0.00 $0.00+ Fees$0.00 $0.00 $0.00 $0.00 $0.00- Amount Paid $53,200.00 $105,466.00 $108,262.00 $112,616.00 $116,106.00=Outstanding Balance$53,200.00 $0.00 $0.00 $0.00 $0.00Note: + sign indicates a multiple year assessment. Click on the + to view additional years. Note: This property has a deferred special assessment. Contact Property Tax Info for more information: 651-266-2000bAssess # Year DescriptionInitial Amount Principal Interest Installment Amount Remaining Balance DeferredbS-252014100 2020 ROUND LAKE ROAD AREA IMPROVEMENTbbb b bYesbNote: Installment amount is the amount that will be included in the property tax total for the referenced payable year. Remaining Balance is the amount eligible for prepayment. Prepayment must be paid in full by November 15th of the current year.Please call the City of Saint Paul General Assessment line for payoff amounts or additional information concerning any Saint Paul assessment. You can reach them at 651-266-8858 or go to Assessment Lookup. Suburban property owners should call 651-266-2000 for detailed assessment information. TaxYearBusinessDateEffectiveDate Transaction TypeTaxAmountSpecialAssessment Penalty Interest Fees Overpayment Total2020 5/14/2020 5/14/2020 Payment ($53,200.00) $0.00 $0.00 $0.00 $0.00 $0.00 ($53,200.00)2020 2/23/2020bOriginal Charge $106,400.00 $0.00 $0.00 $0.00 $0.00 $0.00 $106,400.002019 10/12/2019 10/12/2019 Payment ($52,733.00) $0.00 $0.00 $0.00 $0.00 $0.00 ($52,733.00)2019 5/16/2019 5/15/2019 Payment ($52,733.00) $0.00 $0.00 $0.00 $0.00 $0.00 ($52,733.00)2019 2/28/2019bOriginal Charge $105,466.00 $0.00 $0.00 $0.00 $0.00 $0.00 $105,466.002018 10/16/2018 10/15/2018 Payment ($54,131.00) $0.00 $0.00 $0.00 $0.00 $0.00 ($54,131.00)2018 5/14/2018 5/14/2018 Payment ($1,230.00) $0.00 $0.00 $0.00 $0.00 $0.00 ($1,230.00)2018 3/5/2018 12/30/2017 Apply Advance ($52,901.00) $0.00 $0.00 $0.00 $0.00 $52,901.00 $0.002018 2/28/2018bOriginal Charge $108,262.00 $0.00 $0.00 $0.00 $0.00 $0.00 $108,262.002018 1/3/2018 12/30/2017 Payment $0.00 $0.00 $0.00 $0.00 $0.00 ($52,901.00) ($52,901.00)Date eCRV # Sale Price State Study Recommendation State Study Reject Reason Cnty Stdy Rec10/2/2014269744$4,125,000 YbYPay Property TaxesTax SummarySpecial AssessmentsTax Transaction HistorySalesPay Property Tax 9/22/2020Beacon - Ramsey County, MN - Property Tax: 213023310032https://beacon.schneidercorp.com/application.aspx?app=RamseyCountyMN&PageType=Report&Page=PropertyTax&KeyValue=213023310032 3/32020Value NoticeTax StatementPayment StubsProposedTaxStatement2019Value NoticeTax StatementPaymentStubsProposed Tax Statement2018Value NoticeTaxStatementPayment StubsProposed Tax Statement2017ValueNoticeTax StatementPayment StubsProposed Tax Statement2016Value NoticeTax StatementTheProperty TaxRefundProgramisadministeredby theStateofMinnesota.Forinformationregardingtheprogram,pleasecall651-296-3781orvisitthewebsitehereForm M1PR(Property Tax Refund)Nodataavailableforthefollowingmodules:DelinquentTaxes,ServiceCompany andLender,Photos.Statements and NoticesState of MinnesotaVersion 2.3.86The information in this web site represents current data from a working Øle which is updated daily (see Last Data Upload at bottom of page for the timing of the last update). Information isbelievedreliable,butitsaccuracycannotbeguaranteed.Nowarranty,expressedorimplied,isprovidedforthedataherein,oritsuse.User Privacy Policy GDPR Privacy NoticeLast Data Upload: 9/22/2020, 6:03:12 AMDeveloped by 1 CITY OF ARDEN HILLS COUNTY OF RAMSEY STATE OF MINNESOTA RESOLUTION NO. 2020-045 RESOLUTION APPROVING A CONDITIONAL USE PERMIT FOR THE SUBJECT PROPERTY AT 4200 ROUND LAKE ROAD WHEREAS, City Staff received a land use application for 4200 Round Lake Road (“Subject Property”) for a Conditional Use Permit request on May 1, 2020; WHEREAS, the Subject Property is located in the GB, Gateway Business District and is guided as Light Industrial & Office on the Land Use Plan; WHEREAS, the Applicant has requested a Conditional Use Permit in order to operate a warehouse use; WHEREAS, the City’s obligation has been met where the Arden Hills Planning Commission duly held a public hearing on September 9th, 2020. All persons present at said meeting were given an opportunity to be heard and present written statements; WHEREAS the Planning Commission considered the recommendation of the City Staff that this request be approved and, as such voted 7-0 in favor of the request; and, NOW, THEREFORE, BE IT RESOLVED THAT THE CITY COUNCIL OF THE CITY OF ARDEN HILLS: Hereby adopts Resolution 2020-045 approving Planning Case 20-010 for a Conditional Use Permit request at the Subject Property 4200 Round Lake Road to operate a warehouse use based on the findings of fact and the submitted plans in the July 27th, 2020 Report to the City Council, as amended by the following conditions: 1. The project shall be completed in accordance with the plans submitted and as amended by the conditions of approval. Any significant changes to the plans, as determined by the City Planner, shall require review and approval by the City Council. 2. The Preliminary Plat approval shall expire six months from the date of the City Council approval unless the Final Plat has recorded with Ramsey County or a time extension granted by the City Council. 3. The Applicant shall record the Final Plat with Ramsey County and a copy shall be provided to the City within sixty (90) days of the City’s approval. 4. The Applicant shall be financially responsible for all applicable water and sanitary charges. Rates applied shall be those in effect at the time of Final Plat approval and shall be memorialized in the Development Agreement. 2 To view the final document, access adopted Resolutions via Arden Hills Public Laserfiche Weblink by visiting cityofardenhills.org and clicking on Archived Documents under Helpful Links on our main webpage. 5. A Development Agreement shall be prepared by the City Attorney and subject to City Council approval. The Development Agreement shall be fully executed prior to release of a building permit. 6. The Applicant shall submit a park dedication fee that shall be seven and a half (7.5) percent of the fair market value of the unimproved land and subject to the approval of the City Council. The park dedication fee shall be submitted prior to the release of the Final Plat. 7. Survey monuments shall be placed and installed at all block corners, angle points, points of curves in streets, and at intermediate points as shown on the Final Plat. Pipes or steel rods shall be placed at the corners of each lot. 8. The final plat shall provide dedication of a 60-ft wide right of way for Gateway Boulevard on Lot 2, Block 1 overlying the area currently encumbered by existing drainage and utility easement. 9. Prior to the issuance of a grading and erosion permit, planning staff shall approve in writing the final landscaping plan. 10. Prior to the issuance of a grading and erosion permit, engineering staff shall approve in writing the final location of the loading driveway access to align with adjacent commercial driveway or provide adequate offset distance. 11. A cross easement access and maintenance agreement for the proposed share access on Lot 2 shall be submitted and memorialized in the Development Agreement. 12. Site Plan approval shall be required for the construction of the proof of parking area. 13. All light poles, including base, shall be a maximum of 25 feet in height and shall be shoebox style, downward directed, with high-pressure sodium lamps or LED and flush lenses. Other than wash or architectural lighting, attached security lighting shall be shoebox style, downward directed with flush lenses. If complaints are received the lighting adjacent to residential uses shall utilize house shields as directed by the City. In addition, any lighting under canopies (building entries) shall be recessed and use a flush lens. 14. A right of way permit shall be required for work performed within the City right of way. 15. A grading as-built and utility as-built plan shall be provided to the City upon completion of grading and utility work. 16. No exterior storage shall be permitted. 17. This approval does not include signs. A separate sign permit is required for all proposed signage. All signage shall meet the requirements of Sign District 6. 18. Prior to the issuance of a building permit, a landscape financial security of $50,000.00 dollars shall be submitted. Landscape financial security is held for two full growing seasons. 19. All rooftop or ground mounted mechanical equipment shall be hidden from view with the same materials used on the building in accordance with City Code requirements. 20. All fencing and retaining wall materials shall be complementary to the building materials and shall be approved in writing by the Planning Division prior to issuance of a building permit. Retaining walls greater than four (4) feet in height shall be engineered and detailed calculations shall be submitted to the City. 21. Prior to City Council consideration, the Applicant shall submit a materials board to be approved in writing by staff. 3 To view the final document, access adopted Resolutions via Arden Hills Public Laserfiche Weblink by visiting cityofardenhills.org and clicking on Archived Documents under Helpful Links on our main webpage. 22. A Grading and Erosion permit shall be obtained from the City’s Engineering Department prior to commencing any grading, land disturbance or utility activities. The Developer shall be responsible for obtaining any permits necessary from other agencies, including but not limited to, MPCA, Rice Creek Watershed District, and Ramsey County, MNDOT prior to the start of any site activities. 23. The Applicant shall be responsible for protecting the proposed on-site storm sewer infrastructure and components and any existing storm sewer from exposure to any and all stormwater runoff, sediments and debris during all construction activities. Temporary stormwater facilities shall be installed to protect the quality aspect of the proposed and existing stormwater facilities prior to and during construction activities. Maintenance of any and all temporary stormwater facilities shall be the responsibility of the Applicant. 24. Prior to the issuance of the Grading and Erosion permit, the Engineering Department shall review and approve final grading and utility plans in writing. Plans shall be amended to include detail drawings for connection to the sanitary sewer system in Gateway Boulevard, restoration of utility cuts within public streets, and inclusion of City details 3401, 3402, 3408, and 4000. 25. Any future trash enclosures shall utilize wooden gates and be constructed on three sides using the same materials and patterns used on the building. Locations shall be approved by the Planning Department. 26. The Applicant shall provide an executed copy of the City’s standard stormwater maintenance and easement agreement prior to approval of the Development Agreement. 27. All disturbed boulevards shall be restored with sod. 28. All areas of the site, where practical, shall be sodded or seeded and maintained. The property owner shall mow and maintain all site boulevards to the curb line of the public streets. 29. Overnight trailer parking is prohibited onsite other than along the dock wall within the concrete dock apron. 30. The Applicant shall work with Ramsey County to add five (5) seconds to the signal timing for Round Lake Road and Hwy 96 to allow for more northbound left turns during the PM peak hour prior to the issuance of a certificate of occupancy. 31. Warehousing and wholesaling shall not exceed 85 percent of the floor area tenant. The remaining 15 percent of floor area shall be non-warehouse uses such as a combination of uses including-but-not-limited-to office, manufacturing, production, research and development, lab and/or showroom per tenant. PASSED AND ADOPTED BY THE CITY COUNCIL OF THE CITY OF ARDEN HILLS THIS 28th DAY OF SEPTEMBER, 2020. ________________________________ Mayor Attest: ______________________________ City Clerk Page 1 of 2 NEW BUSINESS – 10C MEMORANDUM DATE: September 28, 2020 TO: Honorable Mayor and City Councilmembers Dave Perrault, City Administrator FROM: Mike Mrosla, Community Development Manager/City Planner SUBJECT: Revisions to the Small Business Emergency Assistance Grant Program Budgeted Amount: Actual Amount: Funding Source: N/A $150,000 CARES Act Council Should Consider A motion to adopt resolution 2020-046 removing the minimum number of employees required per the program parameters and extending the application window for the Small Business Emergency Assistance Grant Program to allow for additional businesses with less than three (3) employees to apply. Background At its August 24, 2020 meeting, the City Council adopted resolution 2020-035 establishing a Small Business Emergency Assistance Grant Program in response to the COVID-19 pandemic. At the direction of the City Council, the City of Arden Hills made available $150,000.00 of CARES Act Funds to support the Grant Program. The intent of the grant program is to provide financial assistance to local businesses to help them continue their operations, preserve employment, and prevent business closures in an effort to encourage long-term economic vitality in Arden Hills. The program provides locally-owned and operated businesses with an emergency grant of up to $5,000. The established grant amount allows for up to 30 Arden Hills business to apply and receive funding. To be eligible to receive a grant, a business must demonstrate loss due to COVID-19 and meet the eligibility requirements and program parameters. The application window closed on Friday, September 25. At the time of writing this, city staff has received 18 applications and has awarded funds to 13 businesses. Staff will provide an update to Council as to any new applications received. Discussion The previous program parameters require businesses to employ between 3 and 45 persons prior to March 31, 2020 in order to participate in the program to receive funding. Staff recently has been contacted by a couple of local businesses that conform with all of the other program parameters except they employ less than three (3) employees. The businesses include self-fitness centers and other personal/business services. Should Council want to remove the minimum employee threshold, staff recommends reopening the application window starting Tuesday, September 29 through Tuesday, October 6, 2020 to allow businesses with less than three (3) employees the ability to apply Page 2 of 2 (note this would still exclude home based businesses as they are prohibited by the program parameters). Should Council want to remove the minimum employment criteria and reopen the application window, a resolution has been provided for consideration. If approved, staff will promote the extension through emails, the website, and social media. Next Steps Staff will bring forward to the first City Council meeting in October a discussion item about offering additional funding to previously awarded grantees should funding be available. Budget Impact The city had made available $150,000 from the CARES Act Funds for the proposed Small Business Emergency Assistance Grant Program. Council shall consider The following are motion language options for the City Council to consider. 1. Approval: A motion to adopt resolution 2020-046 removing the minimum employment criteria and reopening the application window for the Small Business Emergency Assistance Grant Program starting Tuesday, September 29 through Tuesday, October 6, 2020. 2. Denial: Motion to deny a motion to adopt resolution 2020-046 removing the minimum employment criteria and reopening the application window for the Small Business Emergency Assistance Grant Program starting Tuesday, September 29 through Tuesday, October 6, 2020. 3. Table: Motion to table a motion to adopt resolution 2020-046 removing the minimum employment criteria and reopening the application window for the Small Business Emergency Assistance Grant Program starting Tuesday, September 29 through Tuesday, October 6, 2020. Attachments A. Program Parameters B. Resolution No. 2020-046 1 Small Business Emergency Assistance Grant Program Parameters Grant amount: 1.At the direction of the City Council the City of Arden Hills will make available $150,000.00 of Coronavirus Relief Funds for the Small Business Emergency Assistance Grant Program. 2.The maximum grant amount shall be $5,000.00 per eligible business. 3.Depending on available funding and demand for the program additional rounds of funding may become available at a future date. Eligibility Requirements: 1.Any Arden Hills business meeting the below criteria who can demonstrate loss due to COVID-19 excluding home-based businesses, self-employed, and individual contractors. 2.The business shall have a physical address (proof of address required) within the City. 3.Business shall be in operation long enough to demonstrate financial viability prior to the State of Minnesota Emergency Executive Order 20-04 (March 16, 2020). 4.The business shall employ between 3 and 45 persons prior to March 31, 2020. 5.All businesses shall be in good standing with the city. a.All businesses shall be a conforming or a legally nonconforming use under the current zoning regulations of the city. b.Businesses shall not be in violation of the city’s zoning code. c.Businesses shall not have delinquent taxes, bills or charges due to the City from February 2020 or prior. 6.Applicants are strongly encouraged to claim all applicable private insurance and utilize all other sources of applicable assistance available from other private and public sources, including requests for rent/mortgage, utility and loan deferrals or forgiveness. Applicants are also strongly encouraged to apply for emergency loans through the Small Business Administration (SBA) and Minnesota Department of Employment and Economic Development (DEED) prior to applying for this grant. 7.Applications must include proof of application submittal, acceptance, approval and/or denial of state and federal emergency financing programs. Non-eligibility Requirements: 2 1. Businesses that do not have a physical address within the City. 2. Businesses that derive income from passive investments without operational ties to operating businesses within the City; real estate transactions; property rentals or property management. 3. Businesses that primarily focus in on speculative activities based on fluctuations in price rather than the normal course of trade. 4. Businesses that primarily generate income from gambling activities. 5. Businesses that engage in activities prohibited by law. 6. Businesses that have no current or historical financial statements. 7. Businesses that earn revenue from pyramid schemes, lending services and/or day trading/short term investments. 8. Businesses that previously received emergency funds from the city during the current round of funding. Program Guidelines The Small Business Emergency Assistance Grant has the following terms and conditions: 1. Amount: Businesses may apply for a one-time emergency grant of up to $5,000. Applicants should apply for the total amount that they can safely guarantee will be used for the eligible uses found in paragraph 3, below even if the amount exceeds $5,000, in the event a future round of funding is considered. 2. Term: All grant awards must be utilized by November 15, 2020. 3. General Grant Uses: Awarded funds may be used exclusively for operating expense purposes, defined as current payroll obligations (i.e. may not include employees who have been laid off), lease or mortgage payments, utilities, accounts payable, and other critical business expenses that can’t be paid as a direct result of the current health emergency. Awarded funds may not be used for business owner’s/manager’s personal uses or expenses. 4. Proof of Need: All applicants must demonstrate financial need for grant funds prior to approval. This includes but is not limited to the previous year’s annual gross revenue, average monthly gross revenue prior to COVID-19, and projected monthly gross revenue for the next three months. Additionally, applicants are encouraged, but not required to provide evidence of application submittal, acceptance, approval and/or denial of state and federal emergency financing programs. This could simply include an email response from these agencies. 5. Proof of Expenses: Applicant shall provide proof of eligible expense(s) requested to be paid with grant funds. 6. Reporting: As a condition for receiving grant funding, all grant recipients are required to submit a Certification of Expenses form to the City upon funds being issued or before November 30, 2020 specifying how the entirety of the grant funds were utilized. 3 7. Disbursement of Funds: The City will award grant funds on a first-come, first- considered/awarded basis. Once a business is notified, the City will distribute the funds by check within 7-10 business days. 8. Termination: The City of Arden Hills retains the right to terminate any agreement under the Emergency Assistance Program if a grant recipient is found to be in violation of any conditions set forth in the grant guidelines or grant agreement. 9. Right to Deny: The City of Arden Hills retains the right to deny any application for grant funding for any reason. 10. Funding Availability: The Small Business Emergency Assistance Program has a limited amount of general grant funds available. For general grants, awards will be provided on a first-come, first-considered basis until the earlier of the date the fund is exhausted, or the City-declared state of emergency is lifted. 11. Indemnification: All grant recipients shall be required to indemnify the City of Arden Hills, and any officers acting on their behalf. 12. Minnesota Data Practices Disclaimer: While the City does not intend to proactively display, share or advertise business financial information provided as part of the application and review process, confidentiality of such data cannot be guaranteed and is subject to Minnesota Data Practices Act with regard to public access to data. Application Process Application requirements will involve providing: 1. Basic details about the business: business name/type/sector, State Tax ID number. 2. Amount of general grant funding being requested. 3. Number of employees employed by the business as of March 16, 2020 and the number as of the time of this application. 4. Information regarding operations during the COVID-19 pandemic/Stay-at-Home executive order(s), including dates the business was required to be closed due to State of Minnesota orders (actual or est. dates), whether the business is/was subsequently operating under reduced services/capacity restrictions per State of Minnesota. 5. Proof of financial need: Examples include revenue/financial statements demonstrating business impacts due to the COVID-19 pandemic and associated executive orders. 6. Proof of eligible expenses: Examples include proof of payroll expenses, paid/unpaid business invoices, mortgage/rent/utility/statements, property taxes and/or other business- related expenses. 7. Narrative descriptions and estimated calculations of the negative impacts on the business due to COVID-19, including the operational effect of closure and subsequent reopening/partial reopening of operations following the COVID-19 executive orders. 8. Information on the intended use of the grant funds and which eligible expenses will be addressed with the funds. 9. Supporting documentation and application attachments. 4 10. If the business is not already registered as part of the City’s Business Registration program, a completed registration must be submitted prior to funding disbursement. 11. Signature of owner and/or managing partner(s). 12. Fully completed and signed applications along with required documents. 13. Upon submission of application, applicants will receive an email confirming receipt of application. 14. The application will be reviewed for eligibility upon receipt. If additional information or documentation is necessary, staff will contact the applicant. All applicants will be given one (1) week after being contacted to submit any additional information. 15. Funds for grants will be distributed on a first-come, first-considered/awarded basis. Applications will be accepted until September 15, 2020 or when all general grant funds are fully committed. Each general grant application will be considered independently in the order received until funding is expended. Once all available funding has been expended, any remaining eligible applications not receiving funding will be held and considered if future funding rounds become available. To view the final document, access adopted Resolutions via Arden Hills Public Laserfiche Weblink by visiting cityofardenhills.org and clicking on Archived Documents under Helpful Links on our main webpage. CITY OF ARDEN HILLS COUNTY OF RAMSEY STATE OF MINNESOTA RESOLUTION NO. 2020-046 RESOLUTION TO AMEND THE PROGRAM PARAMETERS AND REOPEN THE APPLICATION SUBMITTAL PERIOD FOR SMALL BUSINESS EMERGENCY ASSISTANCE GRANT PROGRAM WHEREAS, the federal and state governments have provided federal financial assistance through the Federal Coronavirus Aid, Relief, and Economic Security (CARES) Act to Minnesota cities impacted by the COVID-19 pandemic, The funds are now available and the City is required to expend all of its funds by November 15, 2020, and; WHEREAS, one of the eligible costs for use of the federal funding is to provide financial assistance to local businesses that have been financially impacted by the pandemic, and; WHEREAS, the City Council at its August 24, 2020 meeting approved establishing a small business emergency assistance grant program to provide financial assistance to its local businesses in accordance with CARES Act funding and guidelines, and; WHEREAS, the approved programs parameters has a minimum employment of three employees, and; WHEREAS, the application submittal period is set to close on Friday, September 25, 2020, NOW, THEREFORE, BE IT RESOLVED by the City Council of the City of Arden Hills, Minnesota, that: 1. The approved programs parameters shall be revised to remove the minimum employment criteria. 2. The Small Business Emergency Assistance Grant Program application submittal period shall be reopened starting Tuesday, September 29 through Tuesday, October 6, 2020 to allow businesses with less than three (3) employees the ability to apply. ADOPTED BY THE CITY COUNCIL OF THE CITY OF ARDEN HILLS THIS 28th DAY OF SEPTEMBER, 2020. ______________________________ David Grant, Mayor ATTEST: ______________________________ Julie Hanson, City Clerk