The URL can be used to link to this page

Home My WebLink About10-12-2020-RAPPROVAL OF AGENDA PUBLIC INQUIRIES/INFORMATIONAL 7KLVLVDQRSSRUWXQLW\IRUFLWL]HQVWREULQJWRWKH&RXQFLO ¶s attention any items not currently on the agenda which are relevant to the City. In addressing the Council, you must first state your name and address for the record. To allow adequate time for each SHUVRQZLVKLQJWRDGGUHVVWKH&RXQFLOVSHDNHUVPXVWOLPLWWKHLUFRPPHQWVWRWKUHH (3) minutes. Written documents may be distributed to the Council prior to the meeting to allow a more timely presentation. Speakers should not use obscene, profane, or threatening language, or make personal attacks. Matters of litigation involving the City shall not be discussed during Public Inquiry by citizens or Council. The Council may not respond to speaker comments, engage in a debate, or take any action on the issues raised by citizens, but may direct City staff to research or follow up on an issue, if desired by Council. If Council directs further review by staff, the results of that review will be presented at a following regular Council meeting. RESPONSE TO PUBLIC INQUIRIES STAFF COMMENTS COVID -19 Update Dave Perrault, City Administrator MEMO.PDF Mayor: David Grant Councilmembers: Brenda Holden Fran Holmes Dave McClung 6WHYH6FRWW Regular City Council Agenda October 12, 2020 7:00 p.m. City Hall Address: 1245 W Highway 96 Arden Hills MN 55112 Phone: 651 -792 -7800 Website : www.cityofardenhills.org City Vision Arden Hills is a strong community that values its unique environmental setting, strong residential neighborhoods, vital business community, well -maintained infrastructure, fiscal soundness, and our long -standing tradition as a desirable City in which to live, work, and play. 7KLVPHHWLQJFDQEHDFFHVVHGUHPRWHO\by joining via Zoom T o join the Zoom Meeting via your computer, click this link (or copy and paste it LQWRDQHZEURZVHUhttps://us02web.zoom.us/j/88674820764 This meeting will be streamed live on local Cable Channel 16 and available for playback on our website. CALL TO ORDER -Declare October 12, 2020 a Non -Holiday to Conduct City Business 1. 2. 3. 4. 4.A. Documents: Transportation Update Todd Blomstrom, Public Works Director/City Engineer MEMO.PDF APPROVAL OF MINUTES September 14, 2020 Regular City Council 09 -14 -20 -R.PDF September 21, 2020 Work Session 09 -21 -20 -WS.PDF CONSENT CALENDAR Those items listed under the Consent Calendar are considered to be routine by the &LW\&RXQFLODQGZLOOEHHQDFWHGE\RQHPRWLRQXQGHUD&RQVHQW&DOHQGDUIRUPDW There will be no separate discussion of these items, unless a Councilmember so requests, in which event, the item will be removed from the general order of business and considered separately in its normal sequence on the agenda. Motion To Approve Claims And Payroll Gayle Bauman, Finance Director CLAIMS AND PAYROLL.PDF Motion To Approve Resolution 2020 -048 Awarding HVAC Project To Air Express Dave Perrault, City Administrator MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF ATTACHMENT C.PDF Motion To Authorize Approval Of 2021 -2026 Elections Administration Contract With Ramsey County Elections Julie Hanson, City Clerk 4.B. Documents: 5. 5.A. Documents: 5.B. Documents: 6. 6.A. Documents: 6.B. Documents: 6.C. Documents: MEMO.PDF ATTACHMENT A.PDF Motion To Award Contract For Professional Services For Pavement Condition Data Collection David Swearingen, Assistant City Enginer, Engineer in Training Todd Blomstrom, Public Works Director/City Engineer MEMO.PDF ATTACHMENT A.PDF Motion To Approve Resolution 2020 -047 Metropolitan Livable Communities Act Participation Mike Mrosla, Community Development Manager/City Planner MEMO.PDF ATTACHMENT A.PDF PULLED CONSENT ITEMS Those items that are pulled from the Consent Calendar will be removed from the general order of business and considered separately in its normal sequence on the agenda. PUBLIC HEARINGS NEW BUSINESS Resolution 2020 -049 To Extend The Application Submittal Period For Small Business Emergency Assistance Grant Program Mike Mrosla, Community Development Manager/City Planner MEMO.PDF ATTACHMENT A.PDF UNFINISHED BUSINESS Resolution 2020 -045 Planning Case 20 -010 ±Master Planned Unit Development, Conditional Use Permit, Site Plan And Preliminary/Final Plat ±Scannell Properties ±4200 Round Lake Road Mike Mrosla, Community Development Manager/City Planner MEMO.PDF ATTACHMENT A.PDF 6.D. Documents: 6.E. Documents: 7. 8. 9. 9.A. Documents: 10. 10.A. Documents: ATTACHMENT B.PDF ATTACHMENT C.PDF ATTACHMENT D.PDF COUNCIL/STAFF COMMENTS ADJOURN 11. Page 1 of 1 STAFF COMMENTS –$ MEMORANDUM DATE: TO: FROM: 2FWREHU Honorable Mayor and City Councilmembers Dave Perrault, City Administrator SUBJECT: &29,'8SGDWH Budgeted Amount: Actual Amount: Funding Source: $$$ A verbal update will be provided at the City Council meeting. Page 1 of 1 STAFF COMMENTS –% MEMORANDUM DATE: TO: FROM: 2FWREHU 2020 Honorable Mayor and City Councilmembers Dave Perrault, City Administrator Todd Blomstrom, Public Works Director/City Engineer SUBJECT: Transportation Update Budgeted Amount: Actual Amount: Funding Source: $$$ A verbal update will be provided at the City Council meeting. Approved: October 12, 2020 CITY OF ARDEN HILLS, MINNESOTA REGULAR CITY COUNCIL MEETING SEPTEMBER 14, 2020 7:00 P.M. - ARDEN HILLS CITY COUNCIL CHAMBERS CALL TO ORDER/ROLL CALL Pursuant to due call and notice thereof, Mayor David Grant called to order the regular City Council meeting at 7:00 p.m. Note: On March 20th, the Mayor signed a determination allowing Councilmembers to participate in City Council meetings via telephone pursuant to State Statute 13D.021 Present:Mayor David Grant, Councilmembers Brenda Holden, Fran Holmes, Dave McClung and Steve Scott Absent: None Also present: City Administrator Dave Perrault; Public Works Director/City Engineer Todd Blomstrom; Finance Director Gayle Bauman; City Clerk Julie Hanson via telephone: Community Development Manager/ City Planner Mike Mrosla PLEDGE OF ALLEGIANCE 1. APPROVAL OF AGENDA MOTION: Councilmember Holden moved and Councilmember Holmes seconded a motion to approve the meeting agenda as presented. A roll call vote was taken. The motion carried unanimously (5-0). 2. PUBLIC INQUIRIES/INFORMATIONAL None. 3. RESPONSE TO PUBLIC INQUIRIES None. 4. STAFF COMMENTS ARDEN HILLS CITY COUNCIL – SEPTEMBER 14, 2020 2 A. COVID-19 Update City Administrator Perrault provided the Council with an update on how the City was responding to COVID-19. He encouraged residents to visit the City’s website for the most current and up to date information regarding COVID-19. He reported the Minnesota Department of Health and CDC also had websites with current guidelines and recommendations. He explained the City of Arden Hills remains in a peacetime state of emergency and City Hall will remain closed until further notice. He indicated all City services remain operational and staff can be reached via phone or email. He reported the City’s small business assistance grant program was approved by the City Council at a previous meeting and applications were still being accepted. B. Transportation Update Public Works Director/City Engineer Blomstrom reported work continues on the I-35W MNPASS project. He explained the center paving and median work south of I-694 is nearing completion. He commented on the County Road I bridge replacement. He indicated drivers are asked to remain aware when driving through the I-35W project area to ensure safe passage. 5. APPROVAL OF MINUTES A. July 20, 2020, City Council Work Session B. August 10, 2020, Special City Council Work Session C. August 10, 2020, Special City Council Executive Session (Closed) D. August 10, 2020, Regular City Council E. August 17, 2020, City Council Work Session Councilmember Scott stated he submitted minor corrections to staff for the August 10 Regular City Council meeting minutes and August 17 City Council Work Session meeting minutes. MOTION: Councilmember Holden moved and Councilmember Holmes seconded a motion to approve the July 20, 2020, City Council Work Session meeting minutes, August 10, 2020, Special City Council Work Session meeting minutes, August 10, 2020, Special City Council Work Session (Closed) meeting minutes; August 10, 2020, Regular City Council meeting minutes as amended; and August 17, 2020, City Council Work Session meeting minutes as amended. A roll call vote was taken. The motion carried unanimously (5- 0). 6. CONSENT CALENDAR A. Motion to Approve Consent Agenda Item - Claims and Payroll B. Motion to Authorize Purchase of Ford F150 Extended Cab Pickup Truck C. Motion to Award 2020 CIPP Lining Project to Michels Corporation D. Motion to Approve Resolution 2020-041 for Denial of Findings of Fact and Decision – Planning Case 20-004 – Variance at 1741 Venus Avenue E. Motion to Approve Planning Case 20-005 – Development Agreement – Bethel University – 2 Pine Tree Drive ARDEN HILLS CITY COUNCIL – SEPTEMBER 14, 2020 3 MOTION: Councilmember Holden moved and Councilmember Holmes seconded a motion to approve the Consent Calendar as presented and to authorize execution of all necessary documents contained therein. A roll call vote was taken. The motion carried unanimously (5-0). 7. PULLED CONSENT ITEMS None. 8. PUBLIC HEARINGS A. 2021 PMP Street and Utility Improvement Project Public Works Director/City Engineer Blomstrom stated on July 27, 2020 the City Council adopted Resolution 2020-029 receiving the feasibility report and calling for a public hearing on September 14, 2020 to consider proposed improvements for the 2021 Pavement Management Program (PMP) Street and Utility Improvement Project. Public Works Director/City Engineer Blomstrom explained projects involving special assessments generally require two public hearings commonly known as an improvement hearing and an assessment hearing. The subject hearing for September 14 is the first improvement hearing. The purpose of the improvement hearing is for the City Council to discuss a specific local improvement before ordering it done. The second assessment hearing would be scheduled for early spring next year to provide property owners an opportunity to express concerns about the actual special assessments. Public Works Director/City Engineer Blomstrom reported at the improvement hearing, interested persons may voice their opinion regarding the proposed project improvements and whether or not they are in the proposed assessment area. A reasonable estimate of the total amount to be assessed and the description of the methodology used to calculate individual assessment for affected parcels is contained within the feasibility report, a copy of which is available for review on the City’s website. Pursuant to Minnesota Statutes, Chapter 429, notices of the public hearing were published in the Pioneer Press on August 31, 2020 and September 7, 2020. A notice was also mailed to each property within the feasibility study area on August 28, 2020. Public Works Director/City Engineer Blomstrom indicated the following streets are proposed for reconstruction: Jerrold Avenue from New Brighton Road to 335 feet west of Prior Avenue; Glenpaul Avenue from New Brighton Road to Cleveland Avenue; and Prior Avenue from County Road D to 155-feet north of Jerrold Avenue. Reconstruction involves fully rebuilding the road base and surface and the addition of curb and gutter along the length of the street. The following streets are proposed to be reclaimed: Edgewater Avenue from New Brighton Road to west cul-de- sac, and Jerrold Avenue from 335 feet west of Prior Avenue to west cul-de-sac. Reclamation involves pulverizing the existing bituminous surface and recycling the material to be used as an aggregate base prior to installing a new bituminous surface. These street segments currently have concrete curb and gutter. The project includes spot repairs for damaged curb. The feasibility study also investigated potential street improvements along Lake Valentine Road from Snelling Avenue North (CSAH 76) to Mounds View High School and recommends these street ARDEN HILLS CITY COUNCIL – SEPTEMBER 14, 2020 4 improvements be rescheduled for the year 2028. The City’s Public Works Department would complete routine surface repairs to address pavement condition issues along Lake Valentine Road during the interim period. The estimated costs and funding sources for the roadway projects was reviewed with the Council. Staff provided further comment on the street, curb, storm drainage, water system and sanitary sewer improvements that would be completed for these roadways and requested the Council hold a Public Hearing. Councilmember Holden asked what the next steps would be for this project. She understood February was the best month for the City to receive bids. She questioned why the City was seeking bids in March or April. Public Works Director/City Engineer Blomstrom reviewed the next steps for this project and anticipated the project would be bid at the end of January. He noted the bidding would remain open for two or three weeks. Councilmember Holmes commented on the core samples and pavement conditions for the roadways. She inquired if reclamation or reconstruction was recommended for the core sample on Slide 18. Public Works Director/City Engineer Blomstrom reported the deterioration was significant for this core sample and therefore this street would require a full depth reclamation of the pavement. Councilmember Holmes stated she supported curb and gutter being installed along Jerrold Avenue. She requested staff speak further as to the benefits of curb and gutter being installed. Public Works Director/City Engineer Blomstrom explained as bituminous goes through the freeze/thaw cycle in Minnesota the pavement can deteriorate and deform. This process can create flat spots that hold water. He stated poor drainage is a key factor in pavement deterioration. He commented further on the importance of curb and gutter in keeping pavement well drained. Mayor Grant opened the public hearing at 7:43 p.m. Urbae Hall, 1991 Edgewater Avenue, asked if the proposed improvements would help address the standing water on Prior Avenue. Public Works Director/City Engineer Blomstrom reviewed the expanded storm sewer and catch basins that would be installed along Prior Avenue. He reported these improvements would address the standing water that occurs along Prior Avenue. Deb Lane, 1950 Jerrold Avenue, questioned if the rain gardens would be part of the curb and gutter project. Public Works Director/City Engineer Blomstrom explained the City would be looking for residents who would volunteer to have a rain garden. Ms. Lane stated she would be willing to volunteer to have a rain garden. She inquired what she would have to do to get the sewer pipe from her house to the street replaced. ARDEN HILLS CITY COUNCIL – SEPTEMBER 14, 2020 5 Public Works Director/City Engineer Blomstrom encouraged any resident interested in having their sewer pipe replaced to contact City staff. He noted this work would be addressed during the second round of public engagement. He reported staff would assist in coordinating this work but noted the work would not be completed by the City. Councilmember Holden requested further information on how the water would drain from Prior Avenue. Public Works Director/City Engineer Blomstrom discussed how the water would drain along Prior Avenue and into storm drains. Thomas Whittle, 1867 Glenpaul Avenue, questioned how old Glenpaul Avenue was originally put in place. Public Works Director/City Engineer Blomstrom stated a thin overlay was completed in the late 1990’s on Glenpaul Avenue. City Administrator Perrault reported staff received one comment via the chat function asking if the City had explored sidewalk installation. Public Works Director/City Engineer Blomstrom explained staff did not receive any comments expressing the desire for sidewalks in the Glenpaul or Hazelnut neighborhoods. He reported the residents that live along Lake Valentine Road had expressed the desire to have a sidewalk from Snelling Avenue to the Mounds View High School for students. He indicated the City is pursuing a grant application for a trail extension along Lake Valentine Road. With no one coming forward to speak, Mayor Grant closed the public hearing at 7:58 p.m. 9. NEW BUSINESS A. Resolution 2020-037 Ordering Improvements and Preparation of Plans and Specifications for the 2021 PMP Street and Utility Improvement Project Public Works Director/City Engineer Blomstrom stated following the public hearing under agenda item No. 8A, the next step in the project delivery process is to approve a Resolution ordering the improvements and the preparation of plans and specification for the 2021 PMP Street and Utility Improvement Project. The resolution would order the improvements and plans in accordance with the recommendations provided in Section 7 of the project feasibility report. Upon approval of the resolution, the project design process would proceed with a second virtual public informational meeting conducted during the week of October 19, 2020, final plans available for City Council approval in January 2021 and an assessment hearing scheduled for late March or early April 2021. Councilmember Holden stated she would like to clear up whether or not Prior Avenue was included in the project area. She commented she did not believe Prior Avenue should be included. ARDEN HILLS CITY COUNCIL – SEPTEMBER 14, 2020 6 Public Works Director/City Engineer Blomstrom explained based upon the City’s assessment policy Prior Avenue would be excluded. MOTION: Councilmember Holden moved and Councilmember Holmes seconded a motion to adopt Resolution #2020-037 – Ordering Improvements and Preparation of Plans and Specifications for the 2021 PMP Street and Utility Improvement Project. Councilmember Holden hoped that the City Council would vote to support this Resolution. She indicated these streets were in dire need of improvement. Councilmember McClung agreed. Mayor Grant reported he drove these roadways and explained some are very close to breaking apart. He agreed these streets were in need of improvement. A roll call vote was taken. The motion carried (5-0). B. Set Preliminary Levy and Establish Truth in Taxation Public Hearing Date for Proposed Taxes Payable in 2021 Finance Director Bauman explained State law requires that cities certify their proposed property tax levies to the county auditor by September 30. The proposed tax levy that is given preliminary approval may be lowered but cannot be increased. The City Council needs to decide the maximum levy that it is willing to approve and then adopt a Resolution. The final levy will be set in December 2020. A budget workshop was held with the Council on August 17, 2020. Staff was directed to reduce the proposed COLA for non-union employees from 3% to 2% and to raise the proposed maximum levy increase from 3% to 5%. It was noted there will be another budget workshop in either October or November, prior to the final levy and budget adoption meeting in December. She provided further comment on the anticipated expenditures and revenues for 2021. She described how the proposed levy would impact the median value homeowner. She discussed the amount of funds available for a General Fund Transfer and recommended $341,000 be transferred to cover the cost of the land purchase for the future Lake Johanna Fire Station and that the remaining $137,000 be transferred to the PIR Fund. Staff recommended the Council set the Preliminary Levy and Set the Truth in Taxation Hearing Date. Councilmember Holmes requested further information regarding the City’s tax rate. Finance Director Bauman explained the tax rate was the percentage that was applied to the estimated taxable value of a home. She reviewed the City’s tax rate from 2020, which was 25.414%. She noted with a 3% tax levy the City’s tax rate would be 24.891% in 2021 and with a 5% tax levy the City’s tax rate would be 25.417% in 2021. Councilmember Holmes asked why NYFS was included in the City Council budget. She recommended this expense be a separate line item. ARDEN HILLS CITY COUNCIL – SEPTEMBER 14, 2020 7 City Administrator Perrault stated this was a historical item and noted the expense could be moved to a separate line item. Mayor Grant commented he did not believe it was necessary to make this a separate line item. Councilmember Holden suggested this item be placed under Administration or under its own line item. Councilmember Holmes stated two large projects were included in the building permit revenues for next year. She indicated the Council should take into consideration how this line item would be impacted if these projects did not go forward. She discussed the Karth Lake assessment and questioned how these assessments would be administered. Finance Director Bauman explained once the paperwork was sent to Ramsey County, the County would administer the distribution and collection of these fees. Councilmember McClung commented he did not have any problem with the Karth Lake assessments or the Truth in Taxation hearing date. He indicated he was having trouble with 5% levy increase. He stated he would like to see this reduced to 3% by December. He explained he could support a tax levy of 4% at this time. Councilmember Scott reported this was a preliminary levy and noted this was a not to exceed amount that could come down. He stated the City gives itself some wiggle room within the preliminary levy and could reduce this amount between September and December. Councilmember Holden indicated she agreed with Councilmember McClung. She stated the City had $478,000 leftover from last year. For this reason, she recommended the City move forward with a 4% tax levy so as not to have an overly high surplus. Mayor Grant commented he understood this was a preliminary levy. He explained he could support a 4% tax levy moving forward at this time. Councilmember Holmes stated she would like the City to move forward with a 5% tax levy for 2021. She indicated the City would not be putting a sizeable transfer into the PIR fund in 2020 due to the purchase of the fire station property. For this reason, she recommended the Council approve a 5% tax levy for the coming year. Councilmember Scott commented he supported a 4.5% tax levy. He stated he did not want the City to have to approve larger increases in the future. Mayor Grant provided a summary of the comments being made by the Council and asked if the Council could support the preliminary tax levy being set at 4.25%. Councilmember Holden indicated she could support 4.25%. Councilmember McClung explained he could support the preliminary tax levy being set at 4.25%. ARDEN HILLS CITY COUNCIL – SEPTEMBER 14, 2020 8 Councilmember Scott agreed. Mayor Grant reported he could support the tax levy being set at 4.25%. Councilmember Holden asked what amount would be certified if the tax levy were set at 4.25%. Finance Director Bauman reported this amount would be $4,311,090. MOTION: Councilmember Holden moved and Mayor Grant seconded a motion to adopt Resolution #2020-038 – Setting the Preliminary Levy for Taxes Payable in 2021 in the amount of $4,311,090. A roll call vote was taken. The motion carried 4-1 (Councilmember McClung opposed). MOTION: Councilmember Holden moved and Councilmember Holmes seconded a motion to adopt Resolution #2020-039 – Setting the Preliminary Levy for Taxes Payable in 2021 for the Karth Lake Special Taxing District in the amount of $6,611.11. A roll call vote was taken. The motion carried (5-0). MOTION: Councilmember Holden moved and Councilmember Holmes seconded a motion to adopt Resolution #2020-040 – Adopting Truth In Taxation Public Hearing Date for Proposed Taxes Payable in 2021 as December 14, 2020. A roll call vote was taken. The motion carried (5-0). C. Resolution 2020-042 Extending the Application Submittal Period for Small Business Emergency Assistance Grant Program Community Development Manager/City Planner Mrosla stated at its August 24, 2020 meeting, the City Council adopted resolution 2020-035 establishing a Small Business Emergency Assistance Grant Program in response to the COVID-19 pandemic. At the direction of the City Council, the City of Arden Hills made available $150,000 of CARES Act Funds to support the Grant Program. The intent of the grant program is to provide financial assistance to local businesses to help them continue their operations, preserve employment, and prevent business closures in an effort to encourage long-term economic vitality in Arden Hills. The program provides locally-owned and operated businesses with an emergency grant of up to $5,000. The established grant amount allows for up to 30 Arden Hills business to apply and receive funding. To be eligible to receive a grant, a business must demonstrate loss due to COVID-19 and meet the eligibility requirements and program parameters. Community Development Manager/City Planner Mrosla reported the application window opened on Monday, August 31 and runs through Tuesday, September 15, 2020. To date, City staff has received 18 applications for funding. Should Council want to extend the application window via resolution to allow for additional time for businesses to apply for the grant a Resolution has been provided for consideration. If approved, staff would promote the extension through emails, the website, and social media. ARDEN HILLS CITY COUNCIL – SEPTEMBER 14, 2020 9 Councilmember Holmes stated she supported extending this program. She questioned if this extension would allow businesses that received grants in round one to reapply in round two if they have additional expenses. Community Development Manager/City Planner Mrosla commented if the Council were to approve a program extension, the requirements for round 2 could be changed to allow businesses to reapply for additional funding. Mayor Grant indicated he would like to spread this money around to help as many businesses as possible. He explained the City has enough money within this program to help 30 businesses. He stated he supported the program being extended an additional two weeks. Councilmember McClung reported his only concern with extending this program was that he wanted to be assured the City had enough time to complete a second round if funding is available. He suggested round one only be extended an additional 10 days. Mayor Grant questioned if Councilmember McClung supported a second round of funding if all funds has been exhausted during round one. Councilmember McClung stated he would support the City Council considering a second round of funding if this were to occur. Councilmember Holden questioned what staff would recommend for this program. Community Development Manager/City Planner Mrosla recommended the program be extended to Friday, September 25. MOTION: Councilmember Holden moved and Councilmember XX seconded a motion to adopt Resolution #2020-042 – Extending the Application Window for the Small Business Emergency Assistance Grant Program in response to the COVID-19 pandemic through September 25, 2020. A roll call vote was taken. The motion carried (5-0). 10. UNFINISHED BUSINESS None. 11. COUNCIL COMMENTS Councilmember Scott stated last month he attended a neighborhood meeting in the Fairview and Crystal neighborhoods after a crime spree occurred. He indicated 30 residents were in attendance at this meeting, along with Ramsey County Deputy Mike Servatka. He noted Cindy Garretson volunteered to organize and chair a new neighborhood watch program for this area. He explained a sign would be posted in this neighborhood. ARDEN HILLS CITY COUNCIL – SEPTEMBER 14, 2020 10 Councilmember Scott commented the residents in this neighborhood were still concerned with the speed of traffic in this area of the City. He requested the Council discuss the speed of traffic in residential neighborhoods at a future worksession meeting. Councilmember McClung reported Minnesota would be an important state in the upcoming election. He encouraged residents to consider voting absentee, which would begin on September 18, 2020 and would run through November 2, 2020. He reminded the public that the general election would be held on Tuesday, November 3. Councilmember Holmes discussed the improvements that had been made at Perry Park. She stated the dog park looks really nice. Councilmember Holden thanked the Public Works staff for their great efforts to overlay Norma Lane, Dawn Circle and Edie Circle. Councilmember Holden supported the City Council discussing a change to the residential speed limit to 25 miles per hour. Councilmember Holden stated the Lake Johanna neighborhood has been trying to get Ramsey County to address the speed of traffic from Beckman to Lake Lane. Public Works Director/City Engineer Blomstrom explained he would speak with the County and would report back to the Council regarding this matter. Councilmember Holden recommended a letter be sent to the County Commissioner regarding the County park in Arden Hills. She wanted to see sidewalks and crosswalks installed at Lake Johanna. Councilmember Holden commented the Arden Hills/Shoreview Rotary would be completing some volunteer work in Arden Hills. She explained this group would be painting the ice skating rink this fall and next spring would be installing a garden at the manufactured home community. Councilmember Holden thanked staff for posting information regarding voting via absentee ballot on the City’s website and other social media platforms. Mayor Grant stated the dog park had the backstop removed some time ago. He requested staff look into the deep holes that dogs have dug at the dog park. Mayor Grant thanked the Public Works Department for their great work on the overlay project. Mayor Grant requested an update from staff on the upcoming election. City Clerk Hanson provided the Council with an update on the upcoming election. She explained absentee voting would begin on Friday, September 18. She reported in person, early absentee voting would take place at the Ramsey County Elections Office in St. Paul, the New Brighton Community Center and the Ramsey County Library in Roseville. She reported additional sites would be opening for in-person absentee voting on October 27 but these sites have not been ARDEN HILLS CITY COUNCIL – SEPTEMBER 14, 2020 11 finalized. She reported she would be meeting with Ramsey County elections staff tomorrow to learn more about this. She stated those that request a ballot by mail would be allowed to turn their ballot in in person at certain locations and that more information would be provided in the near future regarding this option and process. ADJOURN MOTION: Mayor Grant moved and Councilmember Holmes seconded a motion to adjourn. A roll call vote was taken. The motion carried unanimously (5-0). Mayor Grant adjourned the Regular City Council Meeting at 9:10 p.m. __________________________ __________________________ ___________________________ ______________________________ Julie Hanson David Grant City Clerk Mayor $SSURYHG2FWREHU CITY OF ARDEN HILLS, MINNESOTA CITY COUNCIL WORK SESSION MEETING SEPTEMBER 21, 2020 5:00 P.M. - ARDEN HILLS CITY COUNCIL CHAMBERS CALL TO ORDER/ROLL CALL 3XUVXDQWWRGXHFDOODQGQRWLFHWKHUHRI0D\RU*UDQWFDOOHGWRRUGHUWKH&LW\&RXQFLO :RUN6HVVLRQPHHWLQJDWSP'XHWRWKH&29,'SDQGHPLFWKLVPHHWLQJZDV KHOGYLUWXDOO\ Present via Telephone: 0D\RU'DYLG*UDQW&RXQFLOPHPEHUV%UHQGD+ROGHQ)UDQ +ROPHV'DYH0F&OXQJDQG6WHYH6FRWW Absent: 1RQH Also present:&LW\$GPLQLVWUDWRU 'DYH3HUUDXOW3XEOLF:RUNV'LUHFWRU&LW\(QJLQHHU 7RGG %ORPVWURP &RPPXQLW\ 'HYHORSPHQW 0DQDJHU&LW\ 3ODQQHU 0LNH 0URVOD $VVRFLDWH3ODQQHU-RH+DUWPDQQ5HFUHDWLRQ3URJUDPPHU-RH9DXJKDQDQG'HSXW\&LW\ &OHUN-ROHQH7UDXED Also present via telephone: )LQDQFH 'LUHFWRU *D\OH %DXPDQ DQG &LW\ &OHUN -XOLH +DQVRQ 1. AGENDA ITEMS A. Absentee Ballot Returns City Clerk Hanson VWDWHG 5DPVH\ &RXQW\ (OHFWLRQV 5&( KDV HVWDEOLVKHG D SURFHVVIRU DFFHSWLQJPDLOHGDEVHQWHHEDOORWVLQSHUVRQIRUYRWHUVWKDWGRQRWZDQWWRXWLOL]HWKHPDLOWRUHWXUQ WKHLUEDOORWEXWZRXOGUDWKHUGURSLWRIILQSHUVRQ7KHSURFHVVIRUDFFHSWLQJPDLOHGEDOORWVGRHV QRW LQYROYH GURSER[HV EXW UDWKHU HVWDEOLVKHG VSHFLILF EDOORWUHWXUQ ORFDWLRQV IRU VHFXULW\ SXUSRVHV(YHU\EDOORWWKDWLVGURSSHGRIILQSHUVRQQHHGVWREHUHYLHZHGIRUSURSHUFRPSOHWLRQE\ DQRQVLWHVWDIISHUVRQWRHQVXUHWKHHQYHORSHZDVFRPSOHWHGFRUUHFWO\DQGZLOOQRWEHUHMHFWHG %DOORWUHWXUQORFDWLRQVKDYHEHHQHVWDEOLVKHGE\5&(DQGDUHRSHQWRDOO5DPVH\&RXQW\YRWHUV WKDWZLVKWRGURSRIIWKHLUPDLOHGEDOORWLQSHUVRQ,WZDVQRWHGEDOORWVZRXOGEHDFFHSWHGIURP WKURXJKDQGWKHORFDWLRQVZHUHOLVWHGIRUWKH&RXQFLO City Clerk Hanson FRPPHQWHGVKRXOGDFRQWUDFWFLW\VXFKDV$UGHQ+LOOVZLVKWRDFFHSWPDLOHG EDOORWVLQSHUVRQDW&LW\+DOOIRUDQ\SHULRGRIWLPHEHWZHHQQRZDQG1RYHPEHU5DPVH\ $5'(1+,//6&,7<&281&,/:25.6(66,21±6(37(0%(5 &RXQW\(OHFWLRQVZRXOGKDYHUHTXLUHPHQWVIRUVWDII7KHVHUHTXLUHPHQWVZHUHUHYLHZHGLQGHWDLO ZLWK WKH &RXQFLO %HFDXVH EDOORW GURSRIIV PXVW EH JLYHQ GLUHFWO\ WR &LW\ VWDII IRU UHYLHZ IROORZHG E\ WZLFH ZHHNO\ WKHQ HYHU\ GD\ VHFXUH WUDQVSRUW E\ VWDII WKHUH ZLOO EH QR RXWGRRULQGRRUGURSER[RUXQREVHUYHGGURSRIIVDOORZHG,QGLYLGXDOVFDQQRWVLPSO\SXWWKHLU EDOORWLQRXU&LW\+DOOGURSER[PRXQWHGRQWKHZDOOLQWKHHQWUDQFHOHDGLQJWRWKHEXLOGLQJQRU FDQWKH\EHSODFHGLQWKHSODVWLFELQVZHDUHFXUUHQWO\XVLQJIRUODUJHSODQVDQGSHUPLWGURSRIIV 7KH\PXVWEHKDQGHGGLUHFWO\WRVWDIIDQGSURFHVVHGDVLQGLFDWHGDERYH Mayor Grant TXHVWLRQHGKRZWKH\ZRXOGEHUHYLHZLQJWKHEDOORWV City Clerk Hanson VWDWHGWKLVZRXOGEHFRPSOHWHGE\DVWDIIPHPEHU Mayor Grant H[SODLQHGKHGLGQRWEHOLHYHWKH&LW\VKRXOGWDNHWKLVRQDW&LW\+DOO+HVWDWHGLW ZDVKLVXQGHUVWDQGLQJQRRQHLQ$UGHQ+LOOVKDGFXUUHQWO\EHHQWUDLQHG City Clerk Hanson LQGLFDWHGWKLVZDVFRUUHFW6KHGLVFXVVHGWKHSURFHVVWKDWZRXOGEHIROORZHG E\VWDIIWRUHYLHZDQGFHUWLI\EDOORWV6KHFRPPHQWHGIXUWKHURQKRZUHVLGHQWVFRXOGEULQJEDOORWV WR1HZ%ULJKWRQ5RVHYLOOHRU6KRUHYLHZLI$UGHQ+LOOVGLGQRWDFFHSWEDOORWV Councilmember HoldenDJUHHGZLWK0D\RU*UDQWVWDWLQJWKH&LW\GLGQRWKDYHVWDIIWRVSDUHIRU FHUWLI\LQJEDOORWV6KHH[SUHVVHGFRQFHUQZLWKWKHIDFWVWDIIPD\EHH[SRVHGWR&29,'ZKLFK ZRXOGEHDFRQFHUQIRUWKH&LW\¶VDOUHDG\OLPLWHGQXPEHURIVWDIIPHPEHUV Councilmember ScottH[SODLQHGKHZRXOGEHYRWLQJDEVHQWHHWKLV\HDU+HLQGLFDWHGLIHUURUVDUH IRXQGRQPDLQLQEDOORWVDUHSODFHPHQWEDOORWZLOOEHVHQWLIWLPHDOORZV+HVWDWHGDWWKLVWLPH KHZDVQRWLQIDYRURIRSHQLQJXS&LW\+DOOWRDFFHSWEDOORWV Councilmember McClungVWDWHGKHKDGQRWKLQJWRDGG Councilmember HolmesGLGQRWVXSSRUWRSHQLQJXS&LW\KDOOIRUEDOORWFHUWLILFDWLRQ &RXQFLOFRQVHQVXVZDVWRGLUHFWVWDIIWRQRWDOORZDEVHQWHHEDOORWUHWXUQVDW&LW\+DOO City Clerk HansonUHSRUWHGWKH&LW\&RXQFLOZRXOGKDYHWRKROGD6SHFLDO&LW\&RXQFLOPHHWLQJ RQ7KXUVGD\1RYHPEHUWKLQRUGHUWRFDQYDVWKHHOHFWLRQUHVXOWV B. Public Input Regarding the Keeping of Chickens Community Development Manager/City Planner Mrosla VWDWHGDWWKHLU$XJXVW:RUN 6HVVLRQWKH&LW\&RXQFLOGLVFXVVHGRSWLRQVWRDPHQGWKHODQJXDJHLQWKH=RQLQJ&RGHWRUHOD[ UHVWULFWLRQVRQUDLVLQJFKLFNHQVDQGRQFKLFNHQFRRSVLQUHVLGHQWLDOGLVWULFWVEDVHGRQH[DPSOHVRI VLPLODUFRPPXQLWLHV¶RUGLQDQFHUHVWULFWLRQV7KH&LW\&RXQFLORSWHGQRWWRDPHQGWKHFRGHDWWKDW WLPHEXWLQVWHDGWRUHYLHZWKHRUGLQDQFHODQJXDJHDWDODWHUGDWH+RZHYHUDWLWV$XJXVW PHHWLQJ WKH &LW\ &RXQFLO UHTXHVWHG WR GLVFXVV SXEOLF LQSXW RSSRUWXQLWLHV RQ WKH NHHSLQJ RI FKLFNHQVDWDQXSFRPLQJZRUNVHVVLRQ $5'(1+,//6&,7<&281&,/:25.6(66,21±6(37(0%(5 Councilmember Holden DVNHGLIVWDIIKDGVSRNHQWR5RVHYLOOH0RXQGV9LHZ6KRUHYLHZDQG 1HZ%ULJKWRQUHJDUGLQJDQ\LVVXHVWKHVHFLWLHVZHUHKDYLQJZLWKFKLFNHQV Community Development Manager/City Planner Mrosla VWDWHGKHKDGVSRNHQZLWKVHYHUDO QHLJKERULQJ FLWLHV DQG WKH RQO\ FRQFHUQ ZDV WKH RFFDVLRQDO UXQDZD\ FKLFNHQ +H H[SODLQHG 0RXQGV9LHZGRHVUHTXLUHDSXEOLFKHDULQJSULRUWRUHFHLYLQJDSSURYDORIDFKLFNHQOLFHQVH Councilmember HoldenLQGLFDWHGLWZRXOGEHLPSRUWDQWIRUWKH&LW\WRFRQWDFWHYHU\FLWL]HQLQ $UGHQ+LOOVWRJDLQIHHGEDFNRQWKLVLVVXH Councilmember McClung DJUHHG ZLWK &RXQFLOPHPEHU +ROGHQ +H VXJJHVWHG D VXUYH\ EH FRQGXFWHGDORQJZLWKDSXEOLF]RRPPHHWLQJ Councilmember HoldenVXJJHVWHGWKHVXUYH\EHDEOHWREHUHWXUQHGSRVWDJHIUHHIRUUHVLGHQWV 6KHFRPPHQWHGVKHZRXOGQHYHUVXSSRUWWKH&LW\KDYLQJURRVWHUV Mayor Grant LQGLFDWHGKHWRRZRXOGQHYHUDSSURYHRIWKH&LW\KDYLQJURRVWHUV+HH[SODLQHG QRQHRIWKHQHLJKERULQJFLWLHVSHUPLWURRVWHUV+HVWDWHGKHZDQWHGWRUHDFKRXWWRSHRSOHVRWKH &LW\JHWVDUHSUHVHQWDWLYHVDPSOLQJRIRSLQLRQVUHJDUGLQJFKLFNHQV+HVXSSRUWHGRSWLRQDVWKLV ZRXOGKHOSFUDIWDQRUGLQDQFH+HTXHVWLRQHGKRZWKH&LW\FRXOGHQVXUHLWUHFHLYHGRQO\RQH VXUYH\SHUKRXVHKROG Community Development Manager/City Planner Mrosla LQGLFDWHG VWDII ZRXOG UHTXLUH DQ DGGUHVVDQGHPDLOIRUHDFKVXUYH\+HVWDWHGDSDSHUVXUYH\FRXOGEHVHQWRXWE\WKH&LW\EXWKH EHOLHYHGDQRQOLQHVXUYH\ZRXOGEHPRUHHIILFLHQW Councilmember ScottHQFRXUDJHGWKH&LW\WRPRYHIRUZDUGZLWKDFRPSUHKHQVLYHRQOLQHVXUYH\ Councilmember HoldenGLVFXVVHGWKHSHWLWLRQWKH&LW\UHFHLYHG6KHQRWHGVKHKDVZRUNHGZLWK 5DFKHODQG0DULHVLQFH)HEUXDU\RI6KHFRPPHQWHGIXUWKHURQKRZVRPHRIWKHDGGUHVVHV RQWKHVXUYH\ZHUHPLVUHSUHVHQWHGHYHQWKRXJKWKHLQGLYLGXDOVZHUH$UGHQ+LOOVUHVLGHQWV Councilmember McClung LQGLFDWHGWKHUHZHUHDORWRIIRONVWKDWVKRZHGXSWRSURYLGHIHHGEDFN IRUWKH&LW\WKURXJKWKHSHWLWLRQ+HVWDWHGKHVXSSRUWHGWKH&LW\PRYLQJIRUZDUGZLWKDVKRUWHU VXUYH\YHUVXVDFRPSUHKHQVLYHVXUYH\ Councilmember Scott H[SODLQHGKHGLGQRWVXSSRUWWKH&LW\KDYLQJURRVWHUV Councilmember Holmes DJUHHG WKH &LW\ VKRXOG QRW KDYH URRVWHUV 6KH VXSSRUWHG WKH &LW\ KROGLQJD]RRPPHHWLQJDORQJZLWKDFRPSUHKHQVLYHRQOLQHVXUYH\6KHUHFRPPHQGHGWKH&LW\ DGYHUWLVHWKLVLQIRUPDWLRQZLGHO\WRWKHSXEOLFLQRUGHUWRJDLQIHHGEDFNIURPWKHFRPPXQLW\ Councilmember HoldenVXJJHVWHGDSRVWFDUGEHVHQWWRHYHU\UHVLGHQWWRLQIRUPWKHPRIWKH RQOLQHVXUYH\UHJDUGLQJFKLFNHQV Councilmember ScottEHOLHYHGWKHSRVWFDUGZRXOGQRWEHQHFHVVDU\DQGWKDWLQIRUPDWLRQFRXOG EHSRVWHGLQDQXSFRPLQJ&LW\QHZVOHWWHUWRLQIRUPWKHSXEOLFRIWKHVXUYH\ $5'(1+,//6&,7<&281&,/:25.6(66,21±6(37(0%(5 Councilmember McClungFRPPHQWHGKHVXSSRUWHGDSRVWFDUGEHLQJVHQWWRWKHSXEOLF+H VWDWHGKHKDVEHHQUHYLHZLQJFKLFNHQRUGLQDQFHVIURPQHLJKERULQJFRPPXQLWLHVDQGKHQRWHGKLV IDYRULWHRUGLQDQFHVKDYHEHHQIURP6KRUHYLHZDQG%ORRPLQJWRQ Mayor GrantLQGLFDWHGKHVXSSRUWHGWKH&LW\VHQGLQJDSRVWFDUGDORQJZLWKSRVWLQJDPHVVDJH ZLWKLQWKH&LW\QHZVOHWWHU+HZDQWHGWRJLYHUHVLGHQWVHYHU\RSSRUWXQLW\WRWDNHSDUWLQWKLV GLDORJXH Councilmember HolmesVXSSRUWHGWKH&LW\VHQGLQJDSRVWFDUG Councilmember HoldenDVNHGZKDWWKHWLPHOLQHZDVIRUWKLVSURMHFWPRYLQJIRUZDUG Community Development Manager/City Planner Mrosla VWDWHGVWDIIFRXOGKDYHDPDLOLQJRXW LQWKHQH[WZHHN+HVXJJHVWHGWKHSXEOLFEHDOORZHGWRKDYHRQHPRQWKWRFRPSOHWHWKHVXUYH\ Councilmember HoldenTXHVWLRQHGLIWKHSRVWFDUGZRXOGEHODERULQWHQVLYHJLYHQWKHDOUHDG\ KHDY\ZRUNORDGVWDIIKDGDWWKLVWLPH Community Development Manager/City Planner Mrosla FRPPHQWHGDIWHUVSHDNLQJPRUHZLWK VWDIILWPD\WDNHRQHWRWZRZHHNVWRJHWWKHSRVWFDUGLQWKHPDLO+HUHFRPPHQGHGWKHVXUYH\EH SRVWHGRQOLQH2FWREHUWKDQGUXQIRUDWOHDVWRQHPRQWK Councilmember HoldenDQWLFLSDWHGD]RRPPHHWLQJFRXOGQRWEHKHOGXQWLO-DQXDU\JLYHQWKH KROLGD\V Councilmember HolmesVXJJHVWHGWKH]RRPPHHWLQJEHKHOGSULRUWR7KDQNVJLYLQJWRNHHSWKH PRPHQWXPRQWKLVWRSLFPRYLQJIRUZDUG Councilmember McClungDJUHHGDPHHWLQJFRXOGEHKHOGSULRUWR7KDQNVJLYLQJ Mayor GrantVXJJHVWHGVWDIIEHDOORZHGWRPRYHIRUZDUGZLWKWKHSRVWFDUGDQGRQOLQHVXUYH\ DQGWKDWVWDIIEHDOORZHGWRUHSRUWEDFNDWDIXWXUHPHHWLQJ &RXQFLOFRQVHQVXVZDVWRGLUHFWVWDIIWRVHQGDSRVWFDUGWRDOOUHVLGHQWVLQ$UGHQ+LOOVDORQJZLWK SRVWLQJDPHVVDJHLQDQXSFRPLQJ&LW\QHZVOHWWHUHQFRXUDJLQJWKHPWRFRPSOHWHDQRQOLQHVXUYH\ DQG WKDW VWDII EH DOORZHG WR UHSRUW EDFN WR WKH &RXQFLO UHJDUGLQJ WKLV PDWWHU DW D IXWXUH ZRUNVHVVLRQPHHWLQJ C. County Road E/Snelling Avenue Roundabout Public Works Director/City Engineer Blomstrom VWDWHGWKH&LW\&RXQFLOZRUNVHVVLRQRQ-XO\ LQFOXGHGDGLVFXVVLRQRIDQHQYLURQPHQWDOILHOGLQYHVWLJDWLRQIRUIXWXUHLPSURYHPHQWVWR 6QHOOLQJ$YHQXH1RUWK$VSDUWRIWKLVGLVFXVVLRQWKH&RXQFLOUHTXHVWHGVWDIIWRSODFHDQLWHPRQ DIXWXUHZRUNVHVVLRQWRGLVFXVVSRWHQWLDOLPSURYHPHQWVWRWKHLQWHUVHFWLRQRI6QHOOLQJ$YHQXH 1RUWKDQG&RXQW\5RDG( $5'(1+,//6&,7<&281&,/:25.6(66,21±6(37(0%(5 Public Works Director/City Engineer Blomstrom UHSRUWHGRQ$SULOWKH&LW\&RXQFLO WRRNWZRDFWLRQVUHODWHGWRWKHLQWHUVHFWLRQRI2OG6QHOOLQJ$YHQXHDQG&RXQW\5RDG()LUVWWKH &RXQFLO DSSURYHG D &RRSHUDWLYH $JUHHPHQW ZLWK 5DPVH\ &RXQW\ IRU D WUDIILF VWXG\ RI WKH LQWHUVHFWLRQ7KLVDJUHHPHQWVWLSXODWHGWKDWWKH&LW\ZRXOGKLUHDFRQVXOWDQWWRVWXG\SRWHQWLDO LQWHUVHFWLRQLPSURYHPHQWV6HFRQGWKH&RXQFLODSSURYHGDSURIHVVLRQDOVHUYLFHVDJUHHPHQWZLWK :6% $VVRFLDWHVWRSUHSDUHDQ,QWHUVHFWLRQ&RQWURO(YDOXDWLRQUHSRUWIRUWKHLQWHUVHFWLRQ:6% FRPSOHWHGWKH,QWHUVHFWLRQ&RQWURO(YDOXDWLRQUHSRUWIRUWKHLQWHUVHFWLRQRI2OG6QHOOLQJ$YHQXH DQG&RXQW\5RDG(LQ1RYHPEHU6WDIIFRPPHQWHGIXUWKHURQWKHWUDIILFVWXG\UHVXOWVZLWK WKH&RXQFLOQRWLQJWKHUHZDVDFUDVKUDWHFRQFHUQIRUWKLVLQWHUVHFWLRQ+HGLVFXVVHGWKHRSWLRQV DYDLODEOHIRUWKH&RXQFLODQGUHTXHVWHGGLUHFWLRQRQKRZWRSURFHHG Mayor GrantTXHVWLRQHGZKHUHWKH&RXQW\ZDVZLWKWKLVSURMHFW Public Works Director/City Engineer Blomstrom VWDWHG 5DPVH\ &RXQW\ KDV LQFOXGHG WKLV SURMHFWDVRQHRIWKHSURMHFWVLQWKHLUFDSLWDOWUDQVSRUWDWLRQLPSURYHPHQWSODQ+HUHSRUWHGWKH &RXQW\VWLOOVHHVYDOXHLQWKHSURMHFW Councilmember Holden FRPPHQWHGWKHDQDO\VLVLVTXLWHRXWGDWHG6KHVWDWHGWKHUHZHUH VRPDQ\FUDVKHVDWWKLVLQWHUVHFWLRQGXHWRURDGFRQVWUXFWLRQIRUFLQJPRUHWUDIILFWRWKLVDUHD6KH LQGLFDWHGWKHLQWHUVHFWLRQZDVQHYHUSURSHUO\VWULSHGHLWKHU6KHH[SODLQHG%HWKHOKDVUHGXFHGWKH QXPEHURISHRSOHRQFDPSXV)RUWKLVUHDVRQVKHUHFRPPHQGHGWKHDQDO\VLVEHUHFRQGXFWHGRU WKHSURMHFWEHSXVKHGRIIIRUDIHZ\HDUV Mayor GrantDVNHGLI%HWKHO¶V38'OLPLWHGWKHQXPEHURIVWXGHQWVWKDWFRXOGEHRQFDPSXV Community Development Manager/City Planner Mrosla H[SODLQHG%HWKHOKDGD&83+H QRWHGKHZDVXQFHUWDLQRIDVSHFLILFQXPEHUKDGEHHQVHWIRUWKHQXPEHURIVWXGHQWV Mayor Grant UHFDOOHGWKHQXPEHUEHLQJVWXGHQWV Councilmember HoldenVWDWHGVKHEHOLHYHGWKLVZDVWKHFRUUHFWQXPEHU Mayor Grant DJUHHGWKHDQDO\VLVVKRXOGEHUHGRQHJLYHQWKHIDFWWUDIILFSDWWHUQVKDYHFKDQJHG GXHWR&29,' Councilmember HolmesGLVFXVVHG%HWKHO8QLYHUVLW\¶VWUDIILFVWXG\DQGQRWHGWKLVLQIRUPDWLRQ ZDV VHYHQ \HDUV ROG ZKLFK ZDVTXLWH RXW RI GDWH 6KH LQGLFDWHG WUDIILF SDWWHUQV FDQ FKDQJH GUDPDWLFDOO\LQVHYHQ\HDUV6KHVXSSRUWHGWKH&LW\ZDLWLQJIRUWKHQHZQRUPDOWREHHVWDEOLVKHG EHIRUHPRYLQJIRUZDUGZLWKDQ\FKDQJHVDWWKLVLQWHUVHFWLRQ6KHFRPPHQWHGWKHUHPD\QRWEH HQRXJK SUREOHPV DW WKLV LQWHUVHFWLRQ IRU WKH &LW\ WR PRYH IRUZDUG ZLWK D URXQGDERXW 6KH VXJJHVWHGWKH&LW\FRQVLGHUSXUVXHRSWLRQSXWWLQJWKLVLWHPRQKROGLQGHILQLWHO\ Councilmember ScottLQGLFDWHGKHZDVOHDQLQJWRZDUGVRSWLRQ+HEHOLHYHGWKLVLQWHUVHFWLRQ PHULWHG&RXQFLOFRQVLGHUDWLRQJLYHQWKHOHYHORIWUDIILFDQGVHYHULW\RIWKHFUDVKHV+HFRPPHQWHG KHVXSSRUWHGWKH&LW\PRYLQJIRUZDUGZLWKWKHURXQGDERXW Mayor GrantVXSSRUWHGWKH&LW\ORRNLQJDWWKLVLQWHUVHFWLRQDJDLQ $5'(1+,//6&,7<&281&,/:25.6(66,21±6(37(0%(5 Councilmember McClungH[SODLQHGKHVXSSRUWHGDK\EULGDSSURDFKWRWKLVLQWHUVHFWLRQ+H XQGHUVWRRGWUDIILFSDWWHUQVKDYHFKDQJHGGXHWR&29,'DQGWKDWDWUDIILFVWXG\GRQHQRZZRXOG QRWEHKHOSIXO+HVXJJHVWHGWKHVWXG\EHFRPSOHWHGVRPHWLPHQH[W\HDU+HUHFRPPHQGHGWKH &LW\SXWWKHLQWHUVHFWLRQLPSURYHPHQWLWHPRQWKHVKHOIXQWLOVRPHWLPHODWHQH[W\HDU Mayor GrantTXHVWLRQHGKRZPXFKWKHWUDIILFDQDO\VLVVWXG\FRVWWKH&LW\ Public Works Director/City Engineer Blomstrom UHSRUWHGWKHVWXG\FRVWWRFRPSOHWH 7KHFRRSHUDWLYHDJUHHPHQWLQGLFDWHVWKH&LW\SDLGDQG5DPVH\&RXQW\SDLG Mayor GrantVXPPDUL]HGWKHFRPPHQWVRIWKH&RXQFLOVWDWLQJWKHFRQVHQVXVZDVWRNHHSWKLV SURMHFWXQGHUFRQVLGHUDWLRQEXWZLWKXSGDWHGWUDIILFLQIRUPDWLRQLQDSRVW&29,'ZRUOG Public Works Director/City Engineer Blomstrom FRPPHQWHG KH ZRXOG EULQJ WKH 6QHOOLQJ $YHQXHURDGZD\LPSURYHPHQWSURMHFWIHDVLELOLW\VWXG\EDFNWRWKH&RXQFLODQGZRXOGKDYHWKH &RXQW\5RDG(6QHOOLQJ$YHQXHLQWHUVHFWLRQLPSURYHPHQWVDVDVHSDUDWHSURMHFW D. Winter Recreation Programming Recreation Programmer Vaughan VWDWHGWKH&LW\&RXQFLO6SHFLDO:RUN6HVVLRQRQ-XO\ LQFOXGHGDGLVFXVVLRQRIUHFUHDWLRQSURJUDPPLQJDQGFKDOOHQJHVDVVRFLDWHGZLWK&29,' 7KH&RXQFLOGLUHFWHGVWDIIWRHYDOXDWHDOWHUQDWLYHVIRUZLQWHUUHFUHDWLRQSURJUDPVDQGSODFHWKLV LQIRUPDWLRQ RQ D IXWXUH ZRUN VHVVLRQ IRU &RXQFLO FRQVLGHUDWLRQ 6WDII KDV RUJDQL]HG ZLQWHU UHFUHDWLRQDODFWLYLWLHVLQWRILYHFDWHJRULHV7KH&RXQFLOPD\KDYHTXHVWLRQVRUUHTXHVWDGGLWLRQDO LQIRUPDWLRQUHJDUGLQJWKHVHSURJUDPV)LQDOGLUHFWLRQIURPWKH&LW\&RXQFLOLVQHHGHGE\WKH 2FWREHUZRUNVHVVLRQLIWKH&RXQFLOZLVKHVWRSXEOLVKWKHZLQWHUUHFUHDWLRQJXLGHGXULQJWKH ODVW ZHHN LQ 2FWREHU6WDIISURYLGHGIXUWKHUFRPPHQW RQWKHSURSRVHGZLQWHUSURJUDPPLQJ RSSRUWXQLWLHVDQGUHTXHVWHGIHHGEDFNIURPWKH&RXQFLORQKRZWRSURFHHG Councilmember HoldenDVNHGKRZWKHZDUPLQJKRXVHVZRXOGEHGLVLQIHFWHG Recreation Programmer Vaughan H[SODLQHG WKH ULQN DWWHQGDQWV ZRXOG FOHDQ WKH EXLOGLQJV IUHTXHQWO\+HVWDWHGVWDIIFRXOGGUDIWDSODQIRUWKHZDUPLQJKRXVHPDLQWHQDQFH Councilmember HoldenH[SUHVVHGFRQFHUQZLWKWKHVL]HRIWKHZDUPLQJKRXVHVDQGKRZPDQ\ SHRSOHZRXOGEHXVLQJWKHPGXULQJWKHZLQWHUPRQWKV Councilmember McClung TXHVWLRQHGZKDW W\SHRISROLF\ZRXOGKDYHWREHSXWLQSODFHWR HQVXUHVRFLDOGLVWDQFLQJZRXOGRFFXUGXULQJWKHZLQWHUPRQWKVRQWKHLFHULQNVDQGZLWKLQWKH ZDUPLQJKRXVHV Recreation Programmer Vaughan FRPPHQWHGVWDIIZRXOGKDYHWRVHWDPD[LPXPRFFXSDQF\ OLPLWZLWKLQWKHZDUPLQJKRXVHV+HLQGLFDWHGWKHZDUPLQJKRXVHDWWHQGDQWVZRXOGKDYHWREH FRDFKHGRQLPSOHPHQWLQJDQGHQIRUFLQJWKHRFFXSDQF\OLPLWV Mayor GrantLQTXLUHGLIWKH&LW\VKRXOGSURYLGHRXWGRRUULQNVIRUJHQHUDOVNDWLQJWKLVZLQWHU $5'(1+,//6&,7<&281&,/:25.6(66,21±6(37(0%(5 &RXQFLOFRQVHQVXVZDVWRVXSSRUWWKH&LW\SURYLGLQJRXWGRRUULQNVIRUJHQHUDOVNDWLQJWKLVZLQWHU Mayor GrantDVNHGLIWKH&LW\VKRXOGSURYLGHZDUPLQJKRXVHVDQGDWWHQGDQWVWKLVZLQWHU Councilmember ScottGLGQRWVXSSRUWWKH&LW\KDYLQJLWVZDUPLQJKRXVHVRSHQWKLVZLQWHU Councilmember McClungDJUHHGWKH&LW\VKRXOGQRWRSHQWKHZDUPLQJKRXVHV Councilmember HolmesVWDWHGKHUFRQFHUQZRXOGEHKRZWKHDWWHQGDQWZRXOGNHHSWKHQXPEHUV ZLWKLQWKHZDUPLQJKRXVHGRZQ6KHFRPPHQWHGLIWKHZDUPLQJKRXVHVZHUHQRWRSHQSHRSOH ZRXOGKDYHWRWU\DQGSXWWKHLUVNDWHVRQLQWKHLUFDU6KHDQWLFLSDWHGZLWKRXWWKHZDUPLQJKRXVHV WKHLFHULQNVZRXOGQRWKDYHPXFKXVH)RUWKLVUHDVRQVKHVXSSRUWHGWKH&LW\RSHQLQJLWV ZDUPLQJKRXVHVWKLVZLQWHU Councilmember Holden VWDWHGVKHDOVRVXSSRUWHGWKHZDUPLQJKRXVHVEHLQJRSHQHGWKLVZLQWHU 6KHLQGLFDWHGKHUELJFRQFHUQZRXOGEHKRZWRNHHSWKHDWWHQGDQWVVDIH6KHUHFRPPHQGHG SHRSOHLQWKHZDUPLQJKRXVHKDYHDVFDUIRUVRPHRWKHUIDFHFRYHULQJRQLQRUGHUWRHQWHU Mayor GrantH[SODLQHGKHVXSSRUWHGWKHZDUPLQJKRXVHVEHLQJRSHQDVZHOO+HFRPPHQWHG SHRSOHZRXOGKDYHWRZHDUPDVNVRUVRPHRWKHUIDFHFRYHULQJZKHQHQWHULQJWKHZDUPLQJKRXVHV Councilmember HoldenUHSRUWHGVKHZRXOGOLNHWRVHHVWDIIZULWLQJXSSROLFLHVIRUWKHZDUPLQJ KRXVHVDQGUHFRPPHQGHGWKH&RXQFLOUHYLHZWKHVHSROLFLHV Councilmember ScottTXHVWLRQHGLIWKHZDUPLQJKRXVHVFRXOGEHDYDLODEOHWRWKHSXEOLFZLWKRXW DQDWWHQGDQW Councilmember HoldenVWDWHGVKHZDVDJDLQVWWKLVGXHWRJUDIILWLDQGRWKHUFRQFHUQV Mayor Grant DJUHHGVWDWLQJLWZRXOGEHGLIILFXOWWRHQIRUFHPDVNXVDJHDQGRFFXSDQF\OLPLWV ZLWKRXWDQDWWHQGDQWRQVLWH Councilmember ScottUHLWHUDWHGWKDWKHGLGQRWVXSSRUWWKH&LW\RSHQLQJWKHZDUPLQJKRXVHVGXH WRWKHKHDOWKULVNVWKLVLQGLYLGXDOFRXOGEHIDFLQJ Councilmember HolmesFRPPHQWHGULQNDWWHQGDQWVZHUHDOVRUHVSRQVLEOHIRUFOHDULQJWKHULQNV RIVQRZDQGFRXOGEHHQFRXUDJHGWRVSHQGWLPHRXWGRRUVIRUKHDOWKDQGVDIHW\SXUSRVHV Councilmember HoldenTXHVWLRQHGZKDWWKHKRXUVRIRSHUDWLRQZHUHIRUWKHZDUPLQJKRXVHV Recreation Programmer Vaughan VWDWHGWKHZDUPLQJKRXVHVZHUHRSHQ0RQGD\WR)ULGD\IURP SPWRSPRQ6DWXUGD\VIURPSPWRSPDQGRQ6XQGD\VIURPSP WRSP+HQRWHGWKHKRXUVZHUHGLIIHUHQWIRUKROLGD\V Councilmember HoldenVXJJHVWHGWKHKRXUVEHUHGXFHGLIWKH&LW\ZHUHWRRSHQWKHZDUPLQJ KRXVHV $5'(1+,//6&,7<&281&,/:25.6(66,21±6(37(0%(5 Mayor GrantDVNHGLIDQ\RQHZRXOGEHRSHQWRSODFLQJEHQFKHVRXWVLGHLQRUGHUWRDOORZSHRSOH DSODFHWRSXWRQWKHLUVNDWHV+HUHSRUWHGWKLVZRXOGEHDVDIHURSWLRQIRUWKLVZLQWHU Councilmember Holden VWDWHGVKHFRXOGVXSSRUWWKLVRSWLRQ Councilmember ScottLQGLFDWHGKHVXSSRUWHGWKLVRSWLRQDVZHOO Councilmember HoldenTXHVWLRQHGLIWKHLFHULQNOLJKWVZHUHRQWLPHUV Recreation Programmer Vaughan UHSRUWHGWKHOLJKWVZHUHQRWRQWLPHUVEXWUDWKHUWKHULQN DWWHQGDQWVZHUHUHVSRQVLEOHIRUWXUQLQJWKHOLJKWVRQDQGRIIZLWKWKHH[FHSWLRQRI&XPPLQJV 3DUN Mayor GrantVWDWHGSLFQLFWDEOHVFRXOGEHSODFHGQHDUWKHULQNVLQRUGHUWRDVVLVWSHRSOHLQ SXWWLQJWKHLUVNDWHVRQ+HQRWHGWKLVZRXOGDOVRSURYLGHUHVLGHQWVZLWKDSODFHWRSXWWKHLU EHORQJLQJV Recreation Programmer Vaughan H[SODLQHGRWKHUFRPPXQLWLHVZHUHSODFLQJSLFQLFWDEOHVQHDU ULQNVIRUWKLVZLQWHU Councilmember HoldenVXJJHVWHGWKHZDUPLQJKRXVHVEHXVHGRQO\E\WKHDWWHQGDQWDQGWKDW SLFQLFWDEOHVEHORFDWHGRXWVLGHWKHULQNVIRUXVHE\WKHYLVLWRUV Councilmember Scott DQGCouncilmember McClungVXSSRUWHGWKLVUHFRPPHQGDWLRQ Councilmember HolmesVWDWHGVKHFRXOGVXSSRUWWKLVRSWLRQEXWIHDUHGDWWHQGDQFHDWWKHULQNV ZRXOGJRGRZQZLWKRXWWKHZDUPLQJKRXVHVEHLQJRSHQ Councilmember HoldenUHTXHVWHGVWDIIVWLOOGUDIWDFOHDQLQJSROLF\IRUWKHZDUPLQJKRXVHV Councilmember Scott UHFRPPHQGHGWKH&LW\EHIOH[LEOHZLWKWKHZDUPLQJKRXVHDWWHQGDQWV JLYHQWKHIDFWDVHFRQGZDYHRI&29,'ZDVH[SHFWHGODWHWKLVIDOORUHDUO\ZLQWHU Councilmember HoldenTXHVWLRQHGLIWKH&LW\ZRXOGEHRQWKHKRRNIRUXQHPSOR\PHQWLIWKH ZDUPLQJKRXVHDWWHQGDQWVZHUHKLUHGDQGWKHQKRXUVZHUHUHGXFHGRUHOLPLQDWHG Recreation Programmer Vaughan VWDWHGWKHQXPEHURIKRXUVSHUZHHNZRXOGEHWRRORZIRU WKHVHHPSOR\HHVWRTXDOLI\IRUXQHPSOR\PHQW &RXQFLOFRQVHQVXVZDVWRVXSSRUWLFHVNDWLQJULQNVWKLVZLQWHUDORQJZLWKWKHRSHQLQJRIZDUPLQJ KRXVHVIRUWKHDWWHQGDQWVRQO\ZLWKSLFQLFWDEOHVDURXQGWKHULQNVIRUWKHYLVLWRUV Mayor GrantTXHVWLRQHGKRZWKH&RXQFLOZDQWHGWRSURFHHGZLWKVNDWLQJOHVVRQVDQGFOLQLFV Councilmember HoldenDVNHGLIWKHQXPEHURISHRSOHLQWKHFOLQLFVZRXOGSD\IRUWKHLQVWUXFWRU 6KHVWDWHGVKHZRXOGRQO\ZDQWIRXUWRVL[VWXGHQWVLQDFODVVIRUVDIHW\SXUSRVHV $5'(1+,//6&,7<&281&,/:25.6(66,21±6(37(0%(5 Councilmember HolmesH[SODLQHGVKHVXSSRUWHGERWKWKHLFHVNDWLQJOHVVRQVDQGFOLQLFV6KH LQGLFDWHGWKHUHZRXOGEHHQRXJKVRFLDOGLVWDQFLQJGXULQJWKHVHHYHQWV Councilmember McClungFRPPHQWHGKHZRXOGQHHGPRUHLQIRUPDWLRQUHJDUGLQJWKHQXPEHURI DWWHQGHHVDQGKRZ6WDWHJXLGHOLQHVZRXOGEHPHW Recreation Programmer Vaughan VWDWHGKHFRXOGFRPHEDFNZLWKPRUHLQIRUPDWLRQRQKRZWKH &LW\ZRXOGDSSURDFKWKHVNDWLQJOHVVRQVDQGFOLQLFV Councilmember ScottUHSRUWHGKHZRXOGEHLQIDYRURIKDYLQJRXWGRRUVDQFWLRQHGDFWLYLWLHV Councilmember HoldenVXJJHVWHGWKHOHVVRQVDQGFOLQLFVQRWEHKHOGDW+D]HOQXW3DUN Recreation Programmer Vaughan VWDWHGDOORIWKH&LW\¶VVNDWLQJOHVVRQVDQGFOLQLFVDUHKHOGDW &XPPLQJV3DUN &RXQFLOFRQVHQVXVZDVWRGLUHFWVWDIIWRUHSRUWEDFNWRWKH&RXQFLOZLWKDGGLWLRQDOLQIRUPDWLRQRQ WKHQXPEHURIDWWHQGHHVWKDWZRXOGEHH[SHFWHGDWWKHVNDWLQJFOLQLFVDQGOHVVRQVDQGKRZWKH SURJUDPVZRXOGPHHW6WDWHJXLGHOLQHV Mayor Grant TXHVWLRQHGKRZWKH&RXQFLOIHOWDERXWEHIRUHDQGDIWHUVFKRROSURJUDPV Councilmember HoldenVWDWHGVKHGLGQRWVXSSRUWIRRWEDOOEXWFRXOGVXSSRUWSLFNOHEDOO Councilmember HolmesLQGLFDWHGVKHFRXOGRQO\VXSSRUWWKHVHSURJUDPVLIWKHVFKRROGLVWULFW ZHUHWRRSHQEDFNXSIRUEOHQGHGRQVLWHOHDUQLQJ Councilmember McClung DJUHHG LI WKH VFKRROV DUH QRW RSHQ WKH SURJUDPV VKRXOG QRW EH RIIHUHG+HVWDWHGZLWKRXWNQRZLQJKRZ&29,'ZRXOGLPSDFWWKHJHQHUDOSXEOLFWKLVPD\QRWEH DJRRGLGHD Councilmember ScottDVNHGLIDOORIWKHVHSURJUDPVZHUHIRUWKHZLQWHUPRQWKVDQGTXHVWLRQHG LIWKHVHSURJUDPVZHUHKHOGLQGRRUV Recreation Programmer Vaughan VWDWHGWKHVHSURJUDPVZHUHIRUWKHZLQWHUDQGVSULQJVPRQWKV DQGZRXOGEHKHOGLQGRRUV Councilmember ScottFRPPHQWHGKHZRXOGQRWVXSSRUWWKHEHIRUHDQGDIWHUVFKRROSURJUDPV EHFDXVHWKH\ZHUHKHOGLQGRRUV Mayor GrantLQGLFDWHGLWZRXOGEHGLIILFXOWWRWUDFNZKDWVFKRROVZRXOGGRWKLVZLQWHUDQGIRU WKLVUHDVRQKHUHFRPPHQGHGWKHEHIRUHDQGDIWHUVFKRROSURJUDPVQRWPRYHIRUZDUG &RXQFLOFRQVHQVXVZDVWRQRWPRYHIRUZDUGZLWKEHIRUHDQGDIWHUVFKRROSURJUDPVDWWKLVWLPH Mayor Grant UHTXHVWHG IXUWKHU LQIRUPDWLRQ IURP VWDII UHJDUGLQJ RQOLQH SURJUDPPLQJ RSSRUWXQLWLHV $5'(1+,//6&,7<&281&,/:25.6(66,21±6(37(0%(5 Recreation Programmer Vaughan GLVFXVVHGWKHSURSRVHGRQOLQHRSSRUWXQLWLHV+HH[SODLQHG VWDIIKDVUHYLHZHGWKHYLUWXDOSURJUDPVEHLQJRIIHUHGE\WKH&LW\RI5RVHYLOOH+HQRWHG5RVHYLOOH ZDVZRUNLQJZLWKSULYDWHYHQGRUVZKRSURYLGHWKHLQVWUXFWRUVFXUULFXOXPDQGPDWHULDOVZKLOH 5RVHYLOOHWDNHVUHJLVWUDWLRQ+HGLVFXVVHGWKHFODVVHVWKDWDUHEHLQJRIIHUHGDWWKLVWLPH6WDII UHTXHVWHGGLUHFWLRQRQKRZWRSURFHHGZLWKYLUWXDOSURJUDPPLQJZLWKSULYDWHYHQGRUV Councilmember Holden VXSSRUWHG WKH &LW\ HQFRXUDJLQJ UHVLGHQWV WR VLJQ XS IRU YLUWXDO SURJUDPPLQJWKURXJKWKH&LW\RI5RVHYLOOH Councilmember HolmesDVNHGLI5RVHYLOOHFKDUJHGDKLJKHUUDWHWRQRQUHVLGHQWV Recreation Programmer Vaughan VWDWHGKHGLGORRNLQWRWKLVDQGIRUYLUWXDOFODVVHVDKLJKHUIHH ZDVQRWFKDUJHGWRQRQUHVLGHQWV &RXQFLOFRQVHQVXVZDVWRGLUHFWVWDIIWRHQFRXUDJHUHVLGHQWVWRVLJQXSIRUYLUWXDOSURJUDPPLQJ WKURXJKWKH&LW\RI5RVHYLOOH Recreation Programmer Vaughan GLVFXVVHG RWKHU VSHFLDO ZLQWHU HYHQWV WKDW ZHUH EHLQJ SURSRVHGIRUWKHFRPLQJPRQWKVDQGTXHVWLRQHGKRZVWDIIVKRXOGSURFHHG Councilmember HoldenVXJJHVWHGWKHGDQFHFODVVHVEHKHOGYLUWXDOO\ Recreation Programmer Vaughan VWDWHGKHLVVSHDNLQJZLWK+DSS\)HHWWRVHHLIDYLUWXDOSODQ FRXOGEHGHYHORSHG Councilmember ScottVXJJHVWHGWKHOHWWHUIURP6DQWDHYHQWEHKHOGYLUWXDOO\WKLV\HDU Recreation Programmer Vaughan UHSRUWHGWKLVHYHQWZRXOGQRWUHTXLUHFRQWDFW Councilmember Scott VWDWHG KH ZRXOG EH LQ IDYRU RI WKRVH DFWLYLWLHV WKDW FRXOG EHKRVWHG YLUWXDOO\DQGKHZRXOGEHDJDLQVWDOOWKDWZRXOGUHTXLUHLQSHUVRQLQGRRUDWWHQGDQFH Councilmember McClungDJUHHGDOOSURJUDPPLQJVKRXOGEHYLUWXDO 7KH&RXQFLOZDVLQDJUHHPHQWWKDWVWDIIVKRXOGSXUVXHRQO\VSHFLDOHYHQWSURJUDPVWKDWFDQEH FRQGXFWHGYLUWXDOO\ Councilmember HoldenVXJJHVWHGWKHEUHDNIDVWZLWK6DQWDHYHQWEHFKDQJHGWRDYLUWXDOHYHQW 6KHLQGLFDWHGWKLVZRXOGDOORZSDUHQWVWRVLJQXSIRUDWLPHVORWIRUWKHLUFKLOGWRKDYHDYLUWXDO YLVLWIURP6DQWD Recreation Programmer Vaughan GLVFXVVHGWKHDGXOWSURJUDPVWKDWZHUHRIIHUHGE\WKH&LW\ GXULQJWKHZLQWHUPRQWKV+HQRWHGDOO$$53FODVVHVKDYHEHHQFDQFHOHGWKURXJK'HFHPEHURI +HTXHVWLRQHGLIDQ\DGXOWFODVVHVVKRXOGEHRIIHUHG $5'(1+,//6&,7<&281&,/:25.6(66,21±6(37(0%(5 Mayor GrantUHSRUWHGWKHDGXOW$$53FODVVFRXOGEHFRPSOHWHGRQOLQH+HUHFRPPHQGHGVWDII PDNHWKHSXEOLFDZDUHRIWKLVRSSRUWXQLW\ Councilmember McClungGLGQRWVXSSRUWWKH&LW\VSRQVRULQJKLJKULVNFODVVHVDW&LW\+DOO Councilmember ScottVWDWHGKHZRXOGVXSSRUWWKH&LW\RIIHULQJYLUWXDOFODVVHVEXWFRXOGQRW VXSSRUWWKH&LW\KRVWLQJDQ\FODVVHVWKDWUHTXLUHGLQSHUVRQLQGRRUDWWHQGDQFH Councilmember HolmesH[SODLQHGDQRWKHURSWLRQZRXOGEHWRHQFRXUDJHUHVLGHQWVWRSXUVXH DGXOWSURJUDPLQJRSWLRQVLQ5RVHYLOOH6KRUHYLHZDQG1HZ%ULJKWRQ Councilmember Holden UHFRPPHQGHGWKH&LW\RIIHUVRPHW\SHRIRQHRQRQHIRRWFDUHIRU VHQLRUV6KHLQGLFDWHGWKLVZDVDEHWWHURSWLRQIRUVHQLRUVWKDQKDYLQJWRJRWRWKHGRFWRU Mayor GrantFRPPHQWHGRQWKHLPSRUWDQFHRIIRRWFDUHDQGVWDWHGWKLVZDVDJRRGLGHD Councilmember ScottVWDWHGKHFRXOGVXSSRUWDIRRWFDUHRSWLRQIRUVHQLRUVLILWFDQEHGRQH VDIHO\ Councilmember McClungDQGCouncilmember HolmesDJUHHG &RXQFLOFRQVHQVXVZDVWRVXSSRUWDIRRWFDUHSURJUDPPRYLQJIRUZDUGLILWFDQEHGRQHVDIHO\ Recreation Programmer Vaughan TXHVWLRQHGLIWKH&RXQFLOZDQWHGVWDIIWRSXEOLVKDZLQWHU SURJUDPJXLGHLIDOOSURJUDPVZRXOGEHRIIHUHGYLUWXDOO\RUVKRXOGVWDIISRVWWKHLQIRUPDWLRQRQ WKH&LW\¶VZHEVLWH Councilmember HoldenVXJJHVWHGDWZRSDJHEURFKXUHEHSULQWHGIRUWKHSXEOLF Mayor Grant VWDWHG KH XQGHUVWRRG RWKHU FRPPXQLWLHV ZHUH SULQWLQJ D VKRUWHQHG JXLGH IRU UHVLGHQWV Councilmember HolmesDJUHHGLWZRXOGEHQHILWWKHSXEOLFWRKDYHDEURFKXUHSULQWHGWRPDNH WKHPDZDUHRIWKHFKDQJHV Councilmember McClungDJUHHG E. NYFS Funding City Administrator Perrault VWDWHG GXULQJ LWV $XJXVW EXGJHW GLVFXVVLRQ WKH &LW\ &RXQFLO UHTXHVWHGVWDIIEULQJEDFNDGGLWLRQDOLQIRUPDWLRQUHJDUGLQJWKH1RUWK(DVW<RXWKDQG)DPLO\ 6HUYLFHV1<)6EXGJHWUHTXHVWDQGKRZWKHVHUYLFHVDUHSURYLGHGWRWKHUHVLGHQWVRI$UGHQ+LOOV 2QHRWKHULWHPIRU&RXQFLOFRQVLGHUDWLRQ ZDVZKHWKHURUQRWWKH&LW\ZRXOGOLNHWRPDNHD SRUWLRQRILWV&$5(6IXQGLQJDYDLODEOHWR1<)6WRKHOSRIIVHWDGGLWLRQDOFRVWVWKH\DUHLQFXUULQJ GXHWRWKH&29,'SDQGHPLF $5'(1+,//6&,7<&281&,/:25.6(66,21±6(37(0%(5 Councilmember McClungFRPPHQWHGKHFRXOGEHVXSSRUWLYHLIVRPHRIWKHDGGLWLRQDOIXQGLQJ ZRXOGEHGLUHFWHGWRZDUGVPHQWDOKHDOWK Councilmember Holden DVNHGLI$UGHQ+LOOV¶UHVLGHQWVZRXOGQRWEHVHUYHGLIWKH&LW\GLGQRW SD\ City Administrator Perrault VWDWHGKHGLGQRWKDYHDQDQVZHUWRWKLVTXHVWLRQ Mayor GrantVWDWHG1<)6ZDVDYDOXDEOHVHUYLFHWRWKHFRPPXQLW\+HGLVFXVVHGKRZ1<)6 ZRXOGEHLPSDFWHGLIDOOFLWLHVZHUHWREDLORQWKHP+HLQGLFDWHGKHVXSSRUWHGWKH&LW\IXQGLQJ 1<)6JRLQJIRUZDUGHYHQZLWKWKHSURSRVHGLQFUHDVH Councilmember HoldenTXHVWLRQHGZKDWRWKHUQRQSURILWVWKH&LW\VKRXOGEHIXQGLQJLIWKH\GR JRRGZRUNVLQWKHFRPPXQLW\ Mayor GrantH[SODLQHG$UGHQ+LOOVZDVLQVWUXPHQWDOLQVWDUWLQJ1<)6DQGZDVDIRXQGLQJ FKDUWHUPHPEHU+HLQGLFDWHGWKH&LW\ZDVQRWDIRXQGLQJFKDUWHUPHPEHURIDQ\RWKHUQRQSURILW LQWKHFRPPXQLW\ Councilmember Holden VWDWHG VKH ZDV XSVHW EHFDXVH WKH &LW\ KDV QHYHU UHFHLYHG D VLPSOH DSRORJ\IRUWKHZD\WKHLUERDUGKDVWUHDWHG$UGHQ+LOOV5HJDUGOHVVRIPHHWLQJZLWKWKHQHZ H[HFXWLYHGLUHFWRUWKHERDUGUHPDLQVWKHVDPH6KHIHDUHGWKHERDUGZDVQRWDEOHWRWDNHRQWKH PHQWDO KHDOWK LVVXHV RFFXUULQJ LQ $UGHQ +LOOV JLYHQ WKH IDFW LW FRXOG QRW DSRORJL]H IRU PLVEHKDYLRU6KHVWDWHGVKHZDVDJDLQVWIXQGLQJ1<)6RUSURSRVHGWKDW1<)6EHIXQGHGDWRQO\ Councilmember HolmesFRPPHQWHGVKHKDGQRFRQILGHQFHLQWKH1<)6ERDUG6KHIHDUHGWKDW DVLPLODUVLWXDWLRQFRXOGRFFXUDJDLQLQWKHIXWXUHGXHWRWKHOHDGHUVKLSRQWKH1<)6ERDUG6KH VWDWHGVKHDJUHHGZLWK&RXQFLOPHPEHU+ROGHQ6KHTXHVWLRQHGZK\WKH&LW\ZDVIXQGLQJDQRQ SURILW6KHH[SODLQHGWKHUHZHUHDORWRIPHQWDOKHDOWKRSWLRQVDYDLODEOHWRUHVLGHQWVWKHVHGD\V 6KHLQGLFDWHGWKHUHZHUHQRRWKHUQRQSURILWVLQ$UGHQ+LOOVWKDWZHUHUHFHLYLQJIXQGLQJIURPWKH &LW\6KHUHFRPPHQGHGWKH&LW\VWRSIXQGLQJ1<)6 Councilmember Scott VWDWHGKHZDQWHGWRDYRLGJHWWLQJLQWRWKHSROLWLFDOGLVSXWH+HGLGQRW EHOLHYHQRZZDVWKHWLPHWRFXWRIIWKHIHHWRIDQRQSURILWRUJDQL]DWLRQLQWKHFRPPXQLW\WKDW ZDVSURYLGLQJFULWLFDOVHUYLFHVWR$UGHQ+LOOVUHVLGHQWV+HVXSSRUWHGIXQGLQJ1<)6ZLWKWKH LQFUHDVH+HVXJJHVWHG&$5(6$FWIXQGLQJEHXVHGIRUWKHLQFUHDVH Councilmember McClung LQGLFDWHG KH KDV VRPH UHVHUYDWLRQV UHJDUGLQJ 1<)6 EXW KH XQGHUVWRRG WKH VHUYLFHV WKH\ ZHUH SURYLGLQJ ZHUH LPSRUWDQW +H UHSRUWHG KH ZRXOG QRW EH VXSSRUWLYHRIFXWWLQJDOOWLHV+HVWDWHGKHFRXOGVXSSRUWSD\LQJDSRUWLRQZLWK&$5(6$FW GROODUVDQGSD\LQJWKHUHPDLQLQJDPRXQWDIWHUWKHILUVWRIWKH\HDU Councilmember HoldenUHFRPPHQGHGPRUH&$5(6$FWGROODUVEHXVHGLI1<)6ZHUHIXQGHG 6KHVXJJHVWHGRIWKHIHHEHSDLGIRUE\&$5(6$FWIXQGVDVWKLVZRXOGUHGXFHWKHLPSDFWRQ $UGHQ+LOOVWD[SD\HUV $5'(1+,//6&,7<&281&,/:25.6(66,21±6(37(0%(5 City Administrator Perrault VWDWHG&$5(6$FWGROODUVFRXOGQRWEHXVHGWRIURQWH[SHQVHVLQ EXWUDWKHUKDGWREHXVHGIRUH[SHQVHVLQ )XUWKHUGLVFXVVLRQHQVXHGUHJDUGLQJWKH&LW\¶V&$5(6$FWIXQGLQJ Mayor GrantTXHVWLRQHGKRZPDQ\DSSOLFDWLRQVWKH&LW\KDVUHFHLYHGIRU&$5(6$FWJUDQWV Community Development Manager/City Planner Mrosla UHSRUWHGWKH&LW\KDVUHFHLYHG JUDQWDSSOLFDWLRQVDQGQRWHGSD\PHQWVKDYHEHHQLVVXHGDWWKLVWLPH Mayor GrantDVNHGLIWKH&RXQFLOFRXOGVXSSRUWWKH&LW\RIIHULQJLQ&$5(6$FWIXQGLQJ WR1<)6DQGWKHQUHGXFLQJWKHDPRXQWIXQGHGWR1<)6LQE\ Councilmember McClungVWDWHGKHFRXOGVXSSRUWWKLVRSWLRQ City Administrator Perrault UHFRPPHQGHGKHDQGWKH0D\RUKROGDFRQYHUVDWLRQDIWHUWKLV PHHWLQJDQGWKDWWKLVLWHPEHEURXJKWEDFNWRWKH&LW\&RXQFLO F. JDA Chair Discussion City Administrator Perrault VWDWHGSHUWKHE\ODZVRIWKH-RLQW'HYHORSPHQW$XWKRULW\-'$ WKDW RYHUVHHV WKH 7&$$3 UHGHYHORSPHQW SURMHFW WKH &LW\ RI $UGHQ +LOOV LV UHVSRQVLEOH IRU DSSRLQWLQJDQRQHOHFWHGPHPEHUDV&KDLURIWKH-'$ZKLOH5DPVH\&RXQW\DSSRLQWVWKH9LFH &KDLU7KHFXUUHQW&KDLULV%ULDQ+ROPHVDQGKLVWHUPH[SLUHVDWWKHHQGRIWKLV\HDU7KH&LW\ &RXQFLOVKRXOGGLVFXVVLILWZRXOGOLNHWRJRWKURXJKDIRUPDOUHFUXLWPHQWSURFHVVWRILOOWKH XSFRPLQJ WZR\HDU WHUP RU UHDSSRLQW 0U +ROPHV 6KRXOG &RXQFLO ZDQW WR UHDSSURYH 0U +ROPHVKHKDVLQGLFDWHGKHLVZLOOLQJWRUHPDLQRQDV&KDLU6KRXOG&RXQFLOSUHIHUWRKROGD UHFUXLWPHQW6WDIIZLOOEULQJEDFNDIRUPDOSODQLQ2FWREHUIRU&RXQFLOFRQVLGHUDWLRQ Mayor GrantVWDWHGKHVXSSRUWHG%ULDQ+ROPHVFRQWLQXLQJDVWKH-'$&KDLU7KH&RXQFLOZDV LQDJUHHPHQW G. COVID-19 Operations and Staffing Update City Administrator Perrault SURYLGHG WKH &RXQFLO ZLWK DQ XSGDWH RQ KRZ WKH &LW\ ZDV UHVSRQGLQJWR&29,'+HUHSRUWHG&LW\+DOOUHPDLQVFORVHGWRWKHSXEOLF+HFRPPHQWHG &LW\ PHHWLQJV ZHUH VWLOO EHLQJ KHOG UHPRWHO\ +H LQGLFDWHG WKHSXEOLF ZRUNV FUHZ ZDV VWLOO RSHUDWLQJXQGHUWKHVSOLWVKLIWPRGHO+HUHYLHZHGWKHJRYHUQRU¶VXSGDWHGJXLGDQFHFRPPHQWHG RQSRWHQWLDO&$5(6$FWSXUFKDVHVDQGUHTXHVWHGIHHGEDFNIURPWKH&RXQFLORQKRZWRDGGUHVV SXEOLFVDIHW\FRVWV Councilmember Holden VWDWHGVKHDVNHGVWDIIWRORRNLQWRWKHDLUKDQGOHULPSURYHPHQWVDW&LW\ +DOOWRLPSURYHHPSOR\HHKHDOWKDQGVDIHW\6KHUHFRPPHQGHG0LFUREDQSURGXFWVEHFRQVLGHUHG DW&LW\+DOO Councilmember Holmes IHDUHGDEDUULHUZLWKDPLFURSKRQHZRXOGDSSHDUYHU\XQIULHQGO\DWWKH IURQWFRXQWHU $5'(1+,//6&,7<&281&,/:25.6(66,21±6(37(0%(5 City Administrator Perrault FRPPHQWHGWKHEDUULHUZRXOGVSDQWKHHQWLUHIURQWSRUWLRQRIWKH IURQWGHVNDQGQRWHGWKHPLGGOHSRUWLRQFRXOGEHVZDSSHGRXWDIWHUWKHWKUHDWRI&29,' OHVVHQV+HUHFRPPHQGHGIRUWKHWLPHEHLQJWKDWWKHDUHDEHVHDOHG+HLQGLFDWHGLWZRXOGEH GLIILFXOW IRU SHRSOH WR KHDU WKURXJK WKH SOH[LJODVV IRU WKLV UHDVRQ D PLFURSKRQH ZDV EHLQJ UHFRPPHQGHG Mayor GrantTXHVWLRQHGLI&LW\+DOOZRXOGEHRSHQHGLIWKHEDUULHUDQGPLFURSKRQHZHUHSXWLQ SODFH City Administrator Perrault VWDWHGWKLVZRXOGEHXSWR&LW\&RXQFLO Councilmember HoldenLQGLFDWHGVKHKDVUHFHLYHGQRFRPSODLQWVWKDW&LW\+DOOKDVEHHQFORVHG GXULQJWKH&29,'SDQGHPLF Councilmember McClungH[SODLQHGKHKDVQRWKHDUGDQ\QHJDWLYHFRPPHQWVHLWKHU Councilmember HoldenUHFRPPHQGHG&LW\+DOOUHPDLQFORVHGLQRUGHUWRSURWHFW&LW\VWDII Councilmember ScottVWDWHGKHVXSSRUWHGWKH&LW\LQVWDOOLQJWKHEDUULHUDQGPLFURSKRQHIRU VDIHW\SXUSRVHVDW&LW\+DOO Councilmember HolmesTXHVWLRQHGZKDWWKHSXUSRVHZDVRIKDYLQJWKHSHUPDQHQWEDUULHULQ SODFHLI&LW\+DOOUHPDLQVFORVHG City Administrator Perrault VWDWHGWKHIURQWGHVNVWDIIPHPEHUVKDYHKDGOLWWOHWRQRFRQWDFW ZLWKDQ\RQHDWWKLVWLPH+HUHSRUWHGWKLVZRXOGFKDQJHLIWKH&LW\ZHUHWREHJLQKRVWLQJIRRWFDUH FOLQLFV Councilmember HolmesDVNHGLIVWDIIZDVDZDUHRIDQ\RWKHU&LW\+DOOVWKDWKDYHDIXOOEDUULHU ZLWKDPLFURSKRQH Deputy Clerk Trauba H[SODLQHGVKHZDVQRWDZDUHRIDQ\RWKHUFLWLHVWKDWKDYHDPLFURSKRQH 6KHVWDWHGWKHSUREOHPZLWKWKH&LW\¶VRSHQLQJZDVWKDWLWZDVTXLWHODUJHDQGIRUWKLVUHDVRQWKH FRQWUDFWRUUHFRPPHQGHGDPLFURSKRQHEHLQVWDOOHG Councilmember ScottVWDWHGKHVXSSRUWHGWKHSHUPDQHQWEDUULHUDQGPLFURSKRQH Councilmember HoldenUHFRPPHQGHGWKDWLIWKHEDUULHUZDVLQVWDOOHGWKDWWKHPLGGOHSRUWLRQEH UHPRYDEOH City Administrator Perrault FRPPHQWHGRQWKHGLIIHUHQWRSWLRQVDQGQRWHGWKHPLGGOHSRUWLRQ FRXOGEHVOLGLQJYHUVXVSHUPDQHQW Councilmember HoldenUHFRPPHQGHGWKHEDUULHUEHLQVWDOOHGZLWKDVOLGLQJRSWLRQWRDYRLG IXWXUHH[SHQVHV $5'(1+,//6&,7<&281&,/:25.6(66,21±6(37(0%(5 Mayor GrantDJUHHGLWPDGHVHQVHWRLQVWDOODVOLGLQJEDUULHUDWWKLVWLPHJLYHQWKHIDFW&$5(6 $FWIXQGLQJFRXOGEHXVHG+HQRWHGWKLVEDUULHUZRXOGKDYHWREHLQVWDOOHGSULRUWR1RYHPEHU WK+HDVNHGKRZWKH&RXQFLOZDQWHGWRSURFHHG Councilmember McClungVXSSRUWHGWKHEDUULHUEHLQJLQVWDOOHGZLWKDVOLGLQJPLGGOHSRUWLRQ Councilmember HolmesDJUHHG Councilmember ScottVXSSRUWHGWKHEDUULHULQVWDOODWLRQDVZHOO Mayor GrantDVNHGLIWKH&RXQFLOVXSSRUWHGWKHDLUSXULILHUEHLQJLQVWDOOHGDW&LW\+DOO 7KH&RXQFLOVXSSRUWHGWKLVLQVWDOODWLRQ&RXQFLOGLUHFWHGVWDIIWRNHHS&LW\+DOOFORVHGIRUWKH WLPHEHLQJDQGWREHDOORZHGWRVSHQGXSWRRQ0LFUREDQSURGXFWVZLWKLQWKH&LW\+DOO NLWFKHQDUHD,QDGGLWLRQWKH&RXQFLOVXSSRUWHGWKHIXQGLQJH[SHQVHVIRUWKH/DNH-RKDQQD)LUH 'HSDUWPHQWWKURXJK7LHUDQG5DPVH\&RXQW\6KHULII¶V'HSDUWPHQWH[SHQGLWXUHV H. Garbage Cans and Street Ordinance Update Associate Planner Hartmann VWDWHG VWDII KDV UHFHQWO\ UHFHLYHG FRPSODLQWV UHJDUGLQJ WKH SODFHPHQWRIZDVWHFRQWDLQHUVZLWKLQWKHULJKWRIZD\8SRQLQYHVWLJDWLRQRIWKHFRPSODLQWVWDII GHWHUPLQHGWKDWFRQWDLQHUVZHUHHQFURDFKLQJLQWRWKHULJKWRIZD\&LW\FRGHDGGUHVVHVZDVWH FRQWDLQHU VWRUDJH RQ QRQFROOHFWLRQ GD\V &LW\ &RGH 6HFWLRQ 6XEG $ VWDWHV ³&RQWDLQHUVVKDOOEHVWRUHGZLWKLQDQHQFORVHGEXLOGLQJRULQWKHVLGHRUUHDU\DUGDGMDFHQWWRD VWUXFWXUH&RQWDLQHUVVKDOOQRWEHVWRUHGLQWKHIURQW\DUGIRUZDUGRIWKHSULQFLSDOVWUXFWXUH´7KLV FRGHVHFWLRQGRHVQRWDGGUHVVKRZZDVWHFRQWDLQHUVDUHDOORZHGWREHVWRUHGRXWVLGHRQWUDVKGD\ IRU FROOHFWLRQ &LW\ &RGH 6HFWLRQ 6XEGLYLVLRQ VWDWHVWKDW ³5HIXVH DQG UHF\FOLQJ FRQWDLQHUVIURPVLQJOHIDPLO\GZHOOLQJVVKDOOEHSODFHGDWWKHLUDVVLJQHGFROOHFWLRQORFDWLRQWKH QLJKWEHIRUHRUWKHGD\RIFROOHFWLRQ&RQWDLQHUVVKDOOEHUHPRYHGQRPRUHWKDQWZHOYHKRXUV DIWHUWKHVFKHGXOHGFROOHFWLRQGD\´<HWWKLVFRGHVHFWLRQGRHVQRWDGGUHVVWKHORFDWLRQLQZKLFK WKHFRQWDLQHUVPD\EHSODFHGRQWUDVKGD\RQO\WKHGXUDWLRQLQZKLFKWKH\FDQEHOHIWRXWVLGHRI WKHLUDVVLJQHGFROOHFWLRQORFDWLRQ6WDIIUHTXHVWHGGLUHFWLRQIURPWKH&RXQFLORQKRZWRGHILQH ³DVVLJQHGFROOHFWLRQORFDWLRQ´ Mayor GrantFRPPHQWHGVRPHUHVLGHQWVDUHSXWWLQJJDUDJHFDQVLQSDUNLQJDUHDVUDWKHUWKDQDW WKHHGJHRIWKHLUGULYHZD\ Councilmember Scott VWDWHG KH ZDV ILQH ZLWK WKH PRGLILHG ODQJXDJH LQ &LW\ &RGH +H TXHVWLRQHGLIWKLVQHZODQJXDJHZRXOGEHHQIRUFHDEOHRQ&RXQW\ULJKWRIZD\ Associate Planner Hartmann UHSRUWHGWKLVODQJXDJHZRXOGEHHQIRUFHDEOHRQ&RXQW\ULJKWRI ZD\ Councilmember ScottLQGLFDWHGKHVXSSRUWHGWKHODQJXDJHDVPRGLILHG Councilmember McClungVWDWHGKHVXSSRUWHGWKHODQJXDJH $5'(1+,//6&,7<&281&,/:25.6(66,21±6(37(0%(5 Councilmember HolmesH[SODLQHGVKHVXSSRUWHGWKHODQJXDJHEXWDQWLFLSDWHGWKLVZRXOGEHD GLIILFXOWPDWWHUIRUWKH&LW\WRHQIRUFH Councilmember HoldenFRPPHQWHGVKHKDGDSUREOHPZLWKWKHSURSRVHGODQJXDJH6KHVWDWHG VKHZDVXQFHUWDLQDVWRKRZWKH&LW\GHILQHG³FXUEVLGH´ Community Development Manager/City Planner MroslaVXJJHVWHGWKHZRUG³FXUEVLGH´EH HOLPLQDWHGDQGWKDWUHVLGHQWVEHHQFRXUDJHGWRSODFHWKHLUJDUEDJHFDQVDWWKHHQGRUDGMDFHQWWR WKHGULYHZD\ Councilmember McClungVXJJHVWHGWKHSKUDVH³EXWQRWLQWKHVWUHHW´EHDGGHGWRWKLVODQJXDJH Mayor GrantVWDWHGWKLVZRXOGPDNHWKHODQJXDJHPRUHFOHDU &RXQFLOFRQVHQVXVZDVWRGLUHFWVWDIIWREULQJWKHUHYLVHGODQJXDJHEDFNWRWKH&RXQFLODWDIXWXUH &LW\&RXQFLOPHHWLQJ I. Livable Communities Act Community Development Manager/City Planner Mrosla VWDWHGVLQFHWKH&LW\KDVRSWHG WRSDUWLFLSDWHLQWKH0HWURSROLWDQ/LYDEOH&RPPXQLW\$FW/&$SURJUDPV3DUWLFLSDWLQJLQWKLV SURJUDPLVYROXQWDU\KRZHYHULWSURYLGHVWKH&LW\ZLWKWKHRSSRUWXQLW\WRFRPSHWHIRUJUDQWVDQG ORDQV WR VXSSRUW DFWLYLWLHV WKDW KHOS WKH &LW\ PHHW KRXVLQJ JRDOV UHPHGLDWH HQYLURQPHQWDO FRQWDPLQDWHG VLWHV DQG VXSSRUW SURMHFWV WKDW OLQN MREV KRXVLQJDQGWUDQVLW7KH/LYDEOH &RPPXQLWLHV3URJUDPLVEDVHGRQFRRSHUDWLRQDQGLQFHQWLYHVWRDFKLHYHERWKUHJLRQDODQGORFDO JRDOV7KURXJKWKLVSURJUDPWKH&LW\UHFHLYHGLQWRUHPHGLDWHFRQWDPLQDWLRQDW WKH7UDYHUVH%XVLQHVV&HQWHUSURSHUW\DQGIRUWKH7ZLQ&LWLHV$UP\$PPXQLWLRQ3ODQW 7&$$3SURSHUW\UHXVHSODQQLQJLQ Community Development Manager/City Planner Mrosla H[SODLQHGDOOFLWLHVWKDWSDUWLFLSDWHLQ WKH/&$SURJUDPDUHUHTXLUHGWRHVWDEOLVKDIIRUGDEOHDQGOLIHF\FOHKRXVLQJJRDOVIRUWKHQH[W GHFDGHWKURXJK$VSDUWRIWKH&RPSUHKHQVLYH3ODQDSSURYDOSURFHVVWKH&LW\ DOUHDG\DFNQRZOHGJHGWKDWWKH&LW\¶VVKDUHRIWKHIXWXUHUHJLRQDODIIRUGDEOHKRXVLQJQHHGZDV QHZDIIRUGDEOHKRXVLQJXQLWV7KLVQXPEHUZDVFDOFXODWHGE\WKH0HWURSROLWDQ&RXQFLODQGZDV EDVHGRQLQIRUPDWLRQVXFKDVDYDLODEOHODQGDFFHVVWRMREVDQGDFFHVVWRWUDQVLW Community Development Manager/City Planner Mrosla FRPPHQWHGLQUHFRJQLWLRQRIPDQ\ FLW\¶VOLPLWHGUHVRXUFHVWRFUHDWHQHZDIIRUGDEOHKRXVLQJWKH0HWURSROLWDQ&RXQFLOKDVVKLIWHG IURPRQHWDUJHWDIIRUGDEOHKRXVLQJQXPEHUWRDWDUJHWUDQJHIRUDIIRUGDEOHKRXVLQJ7KHQHZ WDUJHWUDQJHRIDIIRUGDEOHKRXVLQJXQLWVLQ$UGHQ+LOOVLVWRQHZXQLWVRYHUWHQ\HDUV+H FRPPHQWHGIXUWKHURQWKHLPSRUWDQFHRIWKHFRPPXQLW\KDYLQJOLIHF\FOHKRXVLQJ,WZDVQRWHG WKHOLIHF\FOHKRXVLQJWDUJHWUDQJHIRU$UGHQ+LOOVLQWKH&RPSUHKHQVLYHSODQZDVWR QHZXQLWV7KHOLIHF\FOHKRXVLQJWDUJHWUDQJHIRU$UGHQ+LOOVLVQHZXQLWV Community Development Manager/City Planner Mrosla H[SODLQHGERWKDIIRUGDEOHDQGOLIH F\FOHKRXVLQJDUHFRQVLVWHQWZLWKWKH&LW\¶V&RPSUHKHQVLYH3ODQDQG]RQLQJUHJXODWLRQV SURYLGHGWKH7&$$3SURSHUW\UHGHYHORSVLQDFFRUGDQFHZLWKWKH&RPSUHKHQVLYH3ODQ,ID FLW\LVQRWDEOHWRPHHWWKHDIIRUGDEOHKRXVLQJJRDOVE\WKHUHDUHQRUHSHUFXVVLRQV+RZHYHU $5'(1+,//6&,7<&281&,/:25.6(66,21±6(37(0%(5 LIDFLW\GRHVQRWSDUWLFLSDWHLQWKHSURJUDPWKHFLW\LVQRWHOLJLEOHIRUFHUWDLQJUDQWSURJUDPV LQFOXGLQJWKH/LYDEOH&RPPXQLWLHV'HPRQVWUDWLRQ$FFRXQW/&'$/RFDO+RXVLQJ,QFHQWLYH $FFRXQW/+,$DQG7D[%DVH5HYLWDOL]DWLRQ$FFRXQW7%5$7KH/&'$DQG7%5$JUDQWVLQ SDUWLFXODUFRXOGEHXVHIXOIRUUHGHYHORSPHQWSURMHFWVDQG7&$$3 Councilmember HoldenVWDWHGVKHVXSSRUWHGWKLVSURJUDP Mayor GrantDJUHHG &RXQFLOFRQVHQVXVZDVWRGLUHFWVWDIIWRFRQWLQXHZLWKWKH/LYDEOH&RPPXQLWLHVSURJUDP J. Council Tracker $IWHUGLVFXVVLRQWKHUHZHUHQRFKDQJHVWR WKH&RXQFLO7UDFNHU 2. COUNCIL COMMENTS AND STAFF UPDATES Councilmember Holmes UHTXHVWHG VWDII LQYHVWLJDWH WUDLQLQJ RSWLRQV IRU WKH QHZ 3ODQQLQJ &RPPLVVLRQPHPEHUV Councilmember Scott VWDWHGKHZRXOGEHLQWHUHVWHGLQUHFHLYLQJWKLVWUDLQLQJDVZHOOJLYHQWKH IDFWKHVHUYHVDWWKH&RXQFLO/LDLVRQ Councilmember ScottZHOFRPHGKRPHWKHVW(&DG&RPEDW$LU%ULJDGHWKDWZDVSDUWRIWKH $UGHQ+LOOV1DWLRQDO*XDUG Councilmember McClung FRPPHQWHG RQ D UHFHQW KRXVH ILUH WKDW RFFXUUHG LQ WKH &LW\ DQG WKDQNHG1HZ%ULJKWRQDQG5RVHYLOOHIRUWKHLUPXWXDODLG+HHQFRXUDJHGUHVLGHQWVWRFKHFNWKH EDWWHULHVLQWKHLUVPRNHGHWHFWRUVWKLVIDOO Councilmember Holmes VWDWHGVKHKDVUHFHLYHGQXPHURXVHPDLOVIURPPHPEHUVRIWKH1RUWK 6XEXUEDQ<RXWK&RDOLWLRQ6KHH[SODLQHGWKH&LW\&RXQFLOZRXOGEHGLVFXVVLQJWKLVLWHPDWWKH 1RYHPEHUZRUNVHVVLRQPHHWLQJ6KHVXJJHVWHGDVWDWHPHQWEHSODFHGRQWKH&LW\¶VZHEVLWH UHJDUGLQJWKLVIDFW Councilmember Holden FRPPHQWHGWKH$UGHQ+LOOV6KRUHYLHZ5RWDU\&OXEKDVSDLQWHGWKH KRFNH\ERDUGVDW)UHHZD\3DUN+HWKDQNHGDOOZKRYROXQWHHUHGIRUWKLVSURMHFW ADJOURN 0D\RU*UDQWDGMRXUQHGWKH&LW\&RXQFLO:RUN6HVVLRQPHHWLQJDWSP BBBBBBBBBBBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBBBBBBBBBBBB -ROHQH7UDXED'DYLG*UDQW 'HSXW\&LW\&OHUN0D\RU CONSENT ITEM6A MEMORANDUM DATE: October 12, 2020 TO:Honorable Mayor and City Councilmembers Dave Perrault, City Administrator FROM:Gayle Bauman, Finance Director Pang Silseth, Accounting Analyst SUBJECT: Budgeted Amount: Actual Amount: Funding Source: N/A N/A N/A Council Should Consider A. Approve Claims and Payroll or B. Reject Claims and Payroll Background Payroll is processed biweekly and accounts payable is processed weekly. Budget Impact NA Attachments 2020 Payroll #20 ……………………………………………………………. $107,098.19 Total Payroll $107,098.19 Paid Claims---9/19/2020 through 10/2/2020 (Check Nos. 49585-49604 and ACH Checks) ……………………………... $274,856.68 Total Accounts Payable $274,856.68 Total Claims $381,954.87 CITY OF ARDEN HILLS PAYROLL # 20 CHECKS DATED: 10/02/20 Biweekly: 09/12/20 - 09/25/20 EMPLOYEE DEDUCTIONS AMT.Payment Method FIT 6,603.35 EFT SIT 3,082.23 EFT FICA Oasdi 4,559.66 EFT FICA Medicare 1,066.38 EFT TOTAL TAXES 15,311.62 Health Premium 1,541.69 A/P Check* Dental Premium 241.04 A/P Check* FSA Health Care Reimb. 0.00 A/P Check* FSA Dependent Care Reimb. 0.00 A/P Check* TOTAL FLEXIBLE SPENDING 1,782.73 HSA Health Saving 303.33 Health Care Savings Plan-Retirement 0.00 EFT Health Care Savings Plan-2% 491.56 EFT Health Care Savings Plan-4% 424.06 EFT TOTAL HEALTH SAVINGS 1,218.95 PERA 4,450.04 EFT ICMA 2,704.39 EFT Central Pension Fund-Union 614.40 A/P Check* MN State Retirement System 750.00 EFT TOTAL RETIREMENT 8,518.83 IUOE 49 Dues (Union) 140.00 A/P Check* LTD/STD Insurance 1,226.35 A/P Check* PERA Life Insurance 32.00 A/P Check* Life/Addl/Dep Life 132.94 A/P Check* Life/Addl non-tax 35.70 A/P Check* UNUM 19.51 A/P Check* AFLAC 22.76 EFT TOTAL VOLUNTARY 1,609.26 Total Employee Deductions 28,441.39 Net Payroll 0.00 Direct Deposit 47,759.90 EFT Gross Payroll Tie-Out 76,201.29 Plus City Paid Benefit 30,896.90 TOTAL PAYROLL COST 107,098.19 FICA TIE-OUT Gross Payroll 76,201.29 Less Total FSA 1,782.73 Less Total H.SA 1,218.95 Less Voluntary Ins 58.46 Plus ICMA Employer 401.46 Net P/R Subject to FICA 73,542.61 FICA Oasdi @ 6.20% 4,559.66 FICA Medicare @ 1.45% 1,066.38 Note: Federal and State Payroll Tax obligations are satisfied by means of utilizing the US Bank Easy Tax Deposit Service. Transfers are typically made up to two days after the payroll date. * A/P Checks can be found on the ACCOUNTS PAYABLE Check Approval report. Checks may be paid this week or the following week. 103.20 103.20 1,625.00 5,134.65 401.46 5,536.11 18,006.55 1,625.00 5,626.04 17,370.20 636.35 CITY BENEFIT 4,559.66 1,066.38 ! "# $ %&'() **+,+ ) '+ '+-#,.****, #,.****,/ 012*+,+ #,.****,/ 0* "+ 34)$5(1%$)464 *+7 *,8+,"* *!4)3$4 ."* ."*/ 0703"+ #8# $1/494)4)4/)$6 *+7 # /:,,#+ # /:**8 "+/ 0703#8# 1(1 1(1'$11$64)3$4$1 *+7 ,", *;$66$1:.8#* ,", *;$66$1:# .,8*+/ 07031(1 ## (/ *+*+,8 " *!4)3$4 88 88/ 012*+,8 *# ')/74)$1 *+*+," 8#* 4 / )/$$ /$(1'448#++ 8#++/ 012*+," # :661/)&66 *+*+,, )4*# )4/!66;$14:)1/ +. +./ 012*+,, # 1$6#$1 *+*+,* )4*# )4/!66;$14:)1/ +. +./ 012*+,* *1()/7%4/ 76/<$1/411 *+*+* "" )946$1:#".+8, #".+8,/ 012*+* # (''$4('/744)4/)&('//4 *+*+* ! = > 7()9* 1(/)&)414%6!?7()9 / 012*+* , )4&(1/& *+*+* '644/!+,# '46:/.** .**/ 012*+* #** /)$//4;(;/$1!6$//641*+*+*# 3**, /((6/,++#)4 $)+,,#* +,,#*/ 012*+*# *"++ 34)$5(1(114/ *+*+* (3++ :/4)3$4 "+# "+#/ 012*+* +.""+/ 0*+ * :)$1:4)$1 7 *8+#"# $2@ +*, +*,/ 0703* # A4414A$ 41/$1 7 *** @@ "# "#/ 0703# #" / 64$1 7 #+8#"#, @@ ", #+8#"#, @@ 8,8 #+8#"#, @@ ##* ,#/ 0703#" #, $)4/$)441//)/!8* 7 )! ); $42@ ); $8 )! ); $42@ ); $#"*# "*#*/ 0703#, #," $)4/$)441//)/B#, 7 )! ); $42@ ); $"* )! ); $42@ ); $.,+ .#+88/ 0703#," +* ;647(4<);;4)66$1 7 ! 7" "/ 0703+* //74%4$'4)/ 7 *, )22 / 0703 ## /4341;) 7 ! = > *, )22,# ,#/ 0703## + %;<($/4$1 7 !#++!!# ( / < !++ )!*,!!* 6 3 </ 00!.#,, )!+#*!!* :$!" )!88,"!! ( C<)4!) < !,#"+ .#+/ 0703+ + ;(6/(1<419$1 7 +", 7 D : @ ."+ ."+/ 0703+ + ;46691/(1!//()14&7 ##:!, 6 C,#" ##:!, 6 C !+B+#,8 ##:!, 6 C.,+ ##:!, 6 C !8B+,+ ##:!, 6 C ,!B8,#8# ##:!, 6 C""+ ##:!, 6 C !B+,+ ##:!, 6 C8+ ##:!, 6 C++ ##:!, 6 C, #.,""#/ 0703+ +*" $ %4/6(9<'4$1 7 #*# 7 4- + +/ 0703+*" ",+ 4(41346( 466 7 (;*88" (;*88" (;*888 ,*/ 0703",+ +, /74/41( 1&66 7 #,8!$1 6 E @@ ##+ ##+/ 0703+, +*# ?(6414/); 7 *, )22"+ "+/ 0703+*# 7& !7& )6$64<4)3$4$1 7 *!$1 @ #+ #+/ 07037& ' / '64F$;64 $ 4/((6( 1&$1 7 +#,* 7 E ,, +#* 7.8 +#*" )!/2 0 +#+ # ! = > #.8##/ 0703' / 16$ $114(/1/$3461 4$1 7 8# % / 070316$ 5)1 5)1(/7;)7%()9$1 7 ,",+!$1 ;2.", .",/ 07035)1 # ;614'()6$'4'$/1441/4)*+*+ ** )4!2 ;: +. +./ 012*+*+ # ;4$%41:4) ($/;4/ *+*8 #+*8# @@ "* #+*8+ @@ ,** #8,/ 012*+*8 #" ;$/$1()( %&$1 *+*" 7 @2+ 7 2+8.#, 8.#,/ 012*+*" +", $/&41:$144)($/$(1('*+*, !8#" 2@ 8 8/ 012*+*, # (4)$6 76/($1 *+** *+ @ *!*+."",# +."",#/ 012*+** "8 ')//66(147) %)4$1 *8 ,** "* "*/ 012*8 #+ ?F'$/1466 *8 ** )4!2 ;: +. +./ 012*8 # 6/4$:41:$144)$1 *8 *,#++ 9 6 )00!@2.,+, .,+,/ 012*8 # 1$'$)/() ()/$(1 *8# *+"*#", @2C#8 #8/ 012*8# ## 964$11 4):)(1 66 *8 +8 $2@C2., +8 $2@C2+.* +8 $2@C2".,+ ! = > +".,"#+/ 012*8 ,.",*+/ 0 )@/ =>".,+88, + ! = > 1 DATE:October 12, 2020 TO:Honorable Mayor and City Councilmembers FROM:Dave Perrault, City Administrator SUBJECT:Approve Resolution 2020-048 Awarding HVAC Project to Air Express Budgeted Amount: Actual Amount: Funding Source: $303,800 $280,783 (Estimated) Building/Equipment Fund Council Should Consider The Council should consider approving resolution 2020-048 awarding the HVAC project to Air Express based on the recommendation from Paulson and Clark. Background The City Council previously authorized the scope of work for the HVAC project and authorized Paulson and Clark to assist the City in soliciting for bids. Ten bids were received and opened on September 15, 2020. Paulson and Clark reviewed the bids and is recommending Air Express as the lowest responsible bidder for the project. Attached to this memo are the bid tabulations (see Attachment A) and a memo from Paulson and Clark outlining their recommendation (see Attachment B). In addition to the base bid, Paulson and Clark is recommending Council approve a contingency on the project of five percent and additional controls related work. Budget Impact The project is budgeted in total at $350,000, the contract with Paulson and Clark is for $46,200, leaving $303,800 for the equipment and installation. The recommendation from Paulson and Clark including the contingency and additional controls work for Air Express comes in at $280,783, or $23,017 under the estimated cost. Attachment Attachment A: HVAC Bid Tabulation Attachment B: Recommendation by Paulson and Clark for Lowest Responsible Bidder Attachment C: Resolution 2020-048 Awarding the HVAC Project to Air Express CONSENT ITEM – 6B MEMORANDUM CONTRACTORAdd. #1Add. #2Bid BondResponsible Contractor AffidavitBase Bid Alternate #1Alliance MechanicalXX X X$337,911.00$24,148.00CorvalXX X X$313,250.00$25,235.00Pioneer PowerXX X X$319,000.00$24,100.00US MechanicalXX X X$378,000.00$24,900.00Cool Air MechanicalXXX$257,400.00Air Express IncXX X X$244,460.00$24,100.00Northern Air Corp.XX X X$282,500.00$24,000.00Peterson Sheet MetalXX X X$269,000.00$24,000.00RJ MechanicalXX X X$317,000.00$24,000.00Wenzel Plumbing & HeatingXX X X$342,250.00$24,500.00ARDEN HILLS HVAC REPLACEMENT- BID TABULATION 09/24/2020 Attachment A Project: $UGHQ+LOOV&LW\+DOO+9$&5HSODFHPHQW%LGV $SSDUHQW/RZ%LGGHU To: 'DYH3HUUDXOW±&LW\RI$UGHQ+LOOV Date: 2FWREHU 0U3HUUDXOW :HUHFHLYHGWHQELGVRQ6HSWHPEHUIRUWKH$UGHQ+LOOV&LW\+DOO+9$& 5HSODFHPHQWSURMHFW7KHORZELGDVUHDGDWWKHELGRSHQLQJZDVIURP$LU ([SUHVV,QF7KHDGGDOWHUQDWHSULFHIRUWKHDGGLWLRQFRQWUROZRUNZDV $LU([SUHVV,QFDFNQRZOHGJHGUHFHLYLQJERWKDGGHQGXPVSURYLGHGDELGERQGDQGWKH 5HVSRQVLEOH&RQWUDFWRU$IILGDYLW:HDOVRPHWZLWK$LU([SUHVVWRUHYLHZWKHELGDQGSURMHFW UHTXLUHPHQWV7KH\FRQILUPHGWKDWDOOZRUNZDVFRYHUHGLQWKHLUELGDQGIHOWFRQILGHQWLQ WKHLUDELOLW\WRFRPSOHWHWKHSURMHFW $VVXFKZHUHFRPPHQGDZDUGLQJWKHFRQWUDFWWR$LU([SUHVVLQJ,QF:HZRXOGDOVR UHFRPPHQGWKHFLW\FRXQFLODGGDFRQWLQJHQF\RIWRFRYHUDQ\XQIRUHVHHQ LVVXHVWKDWPD\DULVHGXULQJFRQVWUXFWLRQ:HDOVRIHHOWKHDOWHUQDWHSULFHDOVRSURYLGHVD JRRGYDOXHWRWKHRZQHU %DVH%LG &RQWLQJHQF\ $OWHUQDWH 7RWDO 7KDQN<RX 7UDYLV:LOOHPVVHQ3( 3DXOVRQ &ODUN(QJLQHHULQJ,QF $WWDFKPHQW% To view the final document, access adopted Resolutions via Arden Hills Public Laserfiche Weblink by visiting cityofardenhills.org and clicking on Archived Documents under Helpful Links on our main webpage. CITY OF ARDEN HILLS COUNTY OF RAMSEY STATE OF MINNESOTA RESOLUTION NO. 2020-048 RESOLUTION AWARDING HVAC PROJECT TO AIR EXPRESSS WHEREAS, pursuant to an advertisement for bids for the City Hall HVAC project, bids were received, opened, and tabulated according to the law; and WHEREAS, Paulson and Clark, the City’s consultant, reviewed and tabulated the bids; and WHEREAS, it appears that Air Express, Inc. is the lowest responsible bidder at $280,783.00, NOW, THEREFORE, BE IT RESOLVED by the City Council of the City of Arden Hills, Minnesota, that: 1. The Mayor and City Clerk are hereby authorized and directed to enter into a contract with Air Express, Inc. in the name of the City of Arden Hills for the City Hall HVAC project in the amount of $280,783.00. 2. The City Clerk is hereby authorized and directed to return forthwith to all bidders the deposits made with their bids, except that the deposits of the successful bidder and the next lowest bidder shall be retained until a contract has been signed. ADOPTED BY THE CITY COUNCIL OF THE CITY OF ARDEN HILLS THIS 12 DAY OF OCTOBER, 2020. ________________________________ David Grant, Mayor ATTEST: ______________________________ Julie Hanson, City Clerk Attachment C Page 1 of 2 DATE:October 12, 2020 TO:Honorable Mayor and City Councilmembers Dave Perrault, City Administrator FROM:Julie Hanson, City Clerk SUBJECT:2021-2026 Elections Administration Contract with Ramsey County Elections Budgeted Amount: Actual Amount: Funding Source: $27,400 (2021) $27,400 (2021) General Fund Council Should Consider The Council should consider approving the attached contract for election administration services with Ramsey County Elections for the years 2021-2026. Background Following City Council approval, the City of Arden Hills entered into its first contract agreement (2012-2016) with Ramsey County Elections for the administration of elections on behalf of the City. In 2016, the City Council extended the contract for an additional four years (2017-2020). The current contract with Ramsey County Elections is set to expire on December 31, 2020. Ramsey County Elections has provided the next contract installment which provides for election administration services for six years (2021-2026). Attached is a copy of said agreement. According to the terms of the contract, costs for election administration services will increase by approximately $7,830 a year for the first two years (2021 and 2022). This was previously noted in the preliminary budget proposed to the Council in August. For contract years 2023/2024 and 2025/2026, Ramsey County Elections will provide the final cost estimate to the participating cities by April of the preceding year (2022 and 2024 respectively). It should be noted that if the Council found the future contract increases unacceptable, it would have the option to terminate the contract for the following year no later than June 1st in the respective year. With the expansion of both no-excuse absentee voting and mail-in ballots, the manpower needed to properly administer the election process has grown significantly; to illustrate this trend, the County has accepted 63,388 mail-in ballots as of October 7, 2020, versus 24,892 cast in-total for CONSENT ITEM – 6C MEMORANDUM Page 2 of 2 the 2016 Presidential Election. It is expected that this trend will continue beyond just this current election year. The above-referenced increase in fees are reflective of the need to hire more election judges and properly compensate those individuals for their work, as well as to cover the costs associated with the large volume of mailed ballots, additional signage, and storage space for equipment. Budget Impact The new contract with Ramsey County represents an approximate increase of $7,830 over the 2020 budget, from $19,570 to $27,400 in 2021. $7,500 of this increase was included in the preliminary budget that was approved by the City Council in September. The 2021 budget will be adjusted as necessary prior to final approval. Attachment Attachment A: Letter and Agreement for Election Services TO: Julie Hanson, City of Arden Hills FROM: David Triplett, Ramsey County Elections Manager SUBJECT: Contract for Election Services DATE: September 29, 2020 The current contract and all renewals for election services between the City of Arden Hills and the Ramsey County Elections office expire on December 31, 2020. As a result, if you wish to continue this service, the City of Arden Hills and Ramsey County will need to execute a new contract. The new contract is attached. It will begin on January 1, 2021 and end on December 31, 2026. There are a few items we want you to be aware of: The increase in the cost schedule accounts for: x An increased hourly wage for election judges to bring the pay scale in alignment with other jurisdictions in the Twin Cities Metro Area, as well as the wage paid to Census workers and local businesses in Ramsey County. Election Judges have not received a raise in the hourly rate since 2016. Currently, precinct judges make $10 an hour. The increase will increase precinct judge wages to $15 an hour and will increase all other positions by $5 an hour. x Accommodate the increased volume of vote by mail and in-person early voting. This is primarily a statutory duty that applies to all municipalities. As you are aware, the increase in this activity has been prodigious this cycle – that aside, there has been a steady increase every year since 2012 and we project this to be increasingly popular beyond this cycle. We have provided this option for voters while maintaining Election Day voting access and resources. x Account for duties that are statutorily related to cities that were not identified as in the previous contract. Additionally: x All jurisdictions will share the same contract terms - terms and conditions of the contract are non- negotiable by individual municipality. x Contracts for precincts located outside of Ramsey County will no longer be offered. These precincts will need to be managed under a mutually agreeable method (such as a Joint Powers Agreement) between the corresponding county, municipality and Ramsey County. Attachment A The cost for your municipality to contract for election services with Ramsey County for the first term of 2021- 2022 will be $54,801.60, invoiced in quarterly payments. Ramsey County will provide an initial cost estimate for the 2023-2024 calendar years to you no later than April 1, 2022, and an initial cost estimate for the 2025-2026 calendar years by April 1, 2024. Please contact me directly by no later than Friday, October 9 if your municipality wishes to contract with Ramsey County for Election Services. Otherwise do not hesitate to contact me for further questions. We very much appreciate your business and hope to continue serving you and your residents in the years ahead. Sincerely, David Triplett Elections Manager - Ramsey County 90 Plato Blvd. W Saint Paul, MN 55107 651-266-2206 1 Agreement Between Ramsey County And the City of Arden Hills for Election Services This is an agreement between the County of Ramsey, through the Ramsey County Elections Office, 90 West Plato Boulevard, St. Paul, MN (“County”), and the City of Arden Hills (“City”) for the provision of election services by the County (“Agreement”). 1. Term This Agreement will be in effect for the period from January 1, 2021 through December 31, 2026 (“Initial Term”), unless earlier terminated pursuant to the provisions of this Agreement. 2. Renewal and Termination This Agreement may be renewed for one additional two-year period by written agreement of the parties, in the form of an amendment to this Agreement. An amendment for renewal of this Agreement must be executed by all parties no later than June 1, 2026 This Agreement may be terminated by any party by written notice to the other parties no later than June 1 of any year, effective on January 1 of the following year. Upon termination of this Agreement, the City-owned voting equipment and materials previously owned by the City related to elections will be returned to the City. 3. General Agreements a) This Agreement only applies to precincts located solely within Ramsey County. b) This Agreement only applies to regularly scheduled elections. c) The County will conduct all special elections required by law during the term of this Agreement on behalf of City. The costs of all special elections that are not held concurrently with a regularly scheduled State, County or City election will be billed to the City for the actual cost realized to conduct a special election. The City will also pay all costs applicable to any state special elections that are not conducted on the date of a regularly scheduled City or state election. d) If a City primary is required, the City will pay all costs applicable to the primary. The County shall invoice the City separately for the costs of the primary. e) The costs for Recounts for City elections will be billed separately from this agreement for the actual costs realized. f) The costs for Ranked Voting Reallocation for the City will be billed separately from this agreement for the actual costs realized. 2 4. County Responsibilities Except as otherwise provided in this Agreement, the County will provide all services, equipment, and supplies as required to perform on behalf of the City and all election-related duties of the City specified in this Agreement. These duties will include: a) Promote and advance the strategic priorities and values of Ramsey County: People, Integrity, Community, Equity and Leadership. b) Recruit, train, and supervise staff to carry out the duties specified in this Agreement. c) Conduct annual inspection of the polling places established by the City according to Minnesota Statutes section 204B.16 in order to verify compliance with all state and federal accessibility requirements; make suggestions about polling locations to City based on feedback from voters, election judges, the polling location’s administration, and annual surveys. d) Pay all rental costs for the Election Day, absentee, and early voting polling places. e) Recruit, train, assign, and pay election judges. Compensation to election judges will be in an amount as determined by the Ramsey County Board of Commissioners. f) Select and administer an election judge management system. g) Procure and provide interpreter services to be available at absentee, early voting, and Election Day locations in accordance with Section 203 of the federal Voting Rights Act. h) Carry out the duties of the city clerk described in Minnesota Election Law regarding the administration of the voting system and the requirements set-forth in the Joint Powers Agreement between the County and the municipalities in Ramsey County to administer the County’s voting systems. i) Program, layout, approve, and print the ballots for all City elections. j) Prepare and transport all election materials to and from each Election Day, absentee, and early voting polling place. Provide election signs, forms, supplies, voting equipment, and other related materials for each Election Day polling place. k) Provide on-street parking and metered parking for early voting, absentee, and Election Day polling places. l) Compile, audit, and report election results and election statistics for dissemination to the appropriate canvassing boards, the public, and the media. Provide copy of election abstract to be used by City for their canvass. m) Provide election-related information on the County web site relating to City elections. 3 n) Conduct recounts for City offices and ballot questions. o) Prepare, post, and publish notices of filing and election as required by Minnesota Statutes sections 205.13 and 205.16. Publish, post, and provide the sample ballots as required by Minnesota Statutes section 205.16 p) Administer all aspects of absentee voting carried out by the Clerk in Minnesota Chapter 203B, including all in-person absentee voting activities at absentee voting locations determined by the Ramsey County Auditor. q) Administer campaign finance reporting and economic disclosure activities designated to the city clerk in accordance with Minnesota Election Law. r) Perform all duties of the candidate filing officer, including the acceptance of affidavits of candidacy and petitions. s) Maintain a database and prepare maps of election districts and precinct boundaries. Provide maps in digital and print formats, available to the public. t) Retain all election records in accordance with Minnesota Election Law and data retention requirements. u) Conduct civic engagement events regarding voter registration, absentee voting, election judge recruitment, and election related civics. v) Recruit student elections judges and teacher liaisons as part of Ramsey County’s Student Election Judge Program. 5. City Responsibilities The City will perform the following election-related responsibilities: a) Provide the County with an inventory list of voting equipment and election related materials, owned by City, to be returned by the County upon termination of Agreement. b) Conduct the canvass of election results following every City election. c) Issue Certificates of Election in accordance with Minnesota Statutes sections 205.185 & 211A.05. d) Attend annual pre-election meetings held by the County and complete trainings required for state election officials as determined by the Minnesota Secretary of State. e) Send required mailed notice of levy referendum in accordance with Minnesota Statutes section 126C.17, subd. 9(b). 4 f) Provide recruitment information about serving as an election judge within City and on the City’s website. g) Provide the title and text of City questions to be placed on the ballot in accordance with Minnesota Statutes 205.16 subd.4 or sections 205A.05, subd.3 h) As needed, identify new locations the City would prefer to use as precinct polling places on Election Day. Annually approve polling places in accordance with Minnesota Statutes section 204B.16. Provide resolution of approved polling locations to the County by the December 31 deadline set forth in section 204B.16. i) Draft, schedule, and approve all resolutions required of the City in Minnesota Election Law to administer elections. j) Designate a person who will be the principal contact for the County. 6. Office Space and Equipment Storage The County will provide suitable office and warehouse space to conduct all election-related activities and for storage of election equipment and supplies. 7. Costs and Payment Payments to cover the costs incurred by the County in the performance of the provisions of this Agreement for regularly scheduled elections will be made by the City in eight equal quarterly amounts for a two-year budget period, for a total of 24 quarterly payments during the Initial Term of the Agreement. Payments will be due on March 31, June 30, September 30 and December 31 of each year. The cost of election services for Regular Elections for the 2021-2022 calendar years will be $54,801.60. The County will provide an initial cost estimate for the 2023-2024 calendar years to the City no later than April 1, 2022, and an initial cost estimate for the 2025-2026 calendar years by April 1, 2024. Such initial cost estimates will become final if the County does not provide an updated cost estimate by July 1 of the year the cost estimates are provided. Costs will be adjusted as necessary by the County to account for the following factors: 1) estimated voter turnout; 2) labor contracts and agreements for non-represented employees approved by the Ramsey County Board of Commissioners; 3) changes in the Consumer Price Index for the Minneapolis-Saint Paul metropolitan area, as determined by the U.S. Bureau of Labor Statistics for the previous two-year period; 4) changes in state, federal, County, or City legal requirements, as applicable; and 5) other factors having a significant impact on election costs. The County will notify the City of additional costs that it will incur as a result of changes to applicable election laws. The County will include and separately identify in any invoice for a regular election or a special election the cost that was incurred as a result of the enactment of new election laws. 5 8. Voting Systems The cost of the operation and maintenance of the voting system is not included in this Agreement and is the subject of a separate agreement. 9. Insurance Each party shall maintain such insurance as will protect such party from claims which may arise out of, or result from, the party’s actions under this Agreement.During the term of this Agreement, the County and City will maintain, through commercially available insurance or on a self-insurance basis, property insurance coverage on the voting equipment each owns, for the repair or replacement of the voting equipment if damaged or stolen. Each party shall be responsible for any deductible under its respective policy. Each party hereby waives and releases the other parties, their employees, agents, officials, and officers from all claims, liability, and causes of action for loss, damage to or destruction of the waiving party’s property resulting from fire or other perils covered in the standard property insurance coverage maintained by the parties. Furthermore, each party agrees that it will look to its own property insurance for reimbursement for any loss and shall have no rights of subrogation against the other parties. 10. Indemnification Each party to this Agreement will be responsible for its own acts and omissions, and the acts and omissions of its officials, employees, and agents, and the results thereof, to the extent authorized by law and shall not be responsible for the acts of the other party, its officials, employees, and agents, and the results thereof. Liability shall be governed by applicable law. Without limiting the foregoing, liability of the parties shall be governed by the provisions of Minnesota Statutes Chapter 466 (Tort Liability, Political Subdivisions) or other applicable law. This provision shall not be construed nor operate as a waiver of any applicable limits of or exceptions to liability set by law. This provision will survive the termination of this Agreement. 11. Data Practices All data created, collected, received, maintained, or disseminated for any purpose in the course of this Agreement is governed by the Minnesota Government Data Practices Act, any other applicable statute, or any rules adopted to implement the Act or statute, as well as federal statutes and regulations on data privacy. 12. Alteration Any alteration, variation, modification, or waiver of the provisions of this Agreement shall be valid only after it has been reduced to writing and duly signed by all parties. Any amendment must be approved no later than June 1 of any year for implementation on January 1 of the following year. 13. Dispute Resolution The Agreement shall be interpreted and construed according to the laws of the State of Minnesota. All litigation regarding this Agreement shall be venued in the appropriate State or Federal District Court in Ramsey County, Minnesota. 6 14. Severability The provisions of this Agreement are severable. If any part of this Agreement is rendered void, invalid or unenforceable, such rendering shall not affect the validity and enforceability of the remainder of this Agreement. 15. Legal Representation The Ramsey County Attorney's office will advise and represent the County in all election-related matters. 16. Independent Contractor It is agreed that nothing in this contract is intended or should be construed as creating the relationship of agents, partners, joint ventures, or associates between the parties hereto or as constituting the County as the employee of the City for any purpose or in any manner whatsoever. The County is an independent contractor and neither it, its employees, agents, nor its representatives are employees of the City. 17. Entire Agreement This Agreement shall constitute the entire agreement between the parties and shall supersede all prior oral and written negotiations. 7 IN WITNESS THEREOF, the parties have subscribed their names as of the last date written below. RAMSEY COUNTY By: Toni Carter, Chair Ramsey County Board of Commissioners Date: CITY OF ARDEN HILLS By: By: Janet Guthrie, Chief Clerk Ramsey County Board of Commissioners Date: Approval recommended: By: David Triplett Elections Manager Approved as to form: By: Assistant County Attorney By: Page 1 of 2 DATE:October 12, 2020 TO:Honorable Mayor and City Councilmembers David Perrault, City Administrator FROM:David Swearingen, Assistant City Engineer, Engineer in Training Todd Blomstrom, Public Works Director/City Engineer SUBJECT:Professional Services for Pavement Condition Data Collection Budgeted Amount: Actual Amount: Funding Source: $0 $20,114.00 Street Maintenance Council Should Consider The City Council is requested to consider approval of professional services with Infrastructure Management Services (IMS) for gathering pavement condition data in the amount of $20,114.00. Background/Discussion Pavement condition ratings are one of the main tools used for planning future street improvements and determining the best method for maintaining streets, such as seal coating, resurfacing or reconstruction. Pavement condition surveys have traditionally been conducted every three years and were last performed in 2017. In the past, ratings were established by field staff visually evaluating pavement surface conditions at selected sample locations and applying standard practices for identifying a pavement condition index between 1 and 100. This approach can be subjective and inconsistent due to variations between individuals performing the evaluation and the selected observation locations. Staff has previously noted concerns with the consistency and accuracy of existing pavement condition ratings. In an effort to improve the data collection process, staff has solicited a proposal from IMS to collect pavement condition ratings through automated vehicle mounted equipment using a laser- camera array that eliminates subjectivity of the data collection process. Pavement data can be easily transferred to the City’s ICON software which is used to store and evaluate the historical data of Arden Hills’ street system. The automated process by IMS will also improve safety by minimizing the time personnel are working on the streets collecting the necessary measurements needed through visual evaluation. CONSENT ITEM – 6D MEMORANDUM Page 2 of 2 Staff recommends authorizing the proposed professional services with IMS as outlined in the proposal and quotation provided in Attachment A. IMS anticipates that the data collection process would be completed by the end of November. Budget Impact The 2020 operating budget for Public Works street maintenance does not include a specific line item for pavement condition data collection. The street maintenance portion of the operating budget is anticipated to be under budget for 2020 with available capacity to cover the proposed fee of $20,114. The previous round of pavement data collection in 2017 was completed by a combination of an engineering consultant and public works staff at an estimated cost of approximately $11,000, not including internal staff time and equipment expenses. While the proposed automated process has a moderate increase in cost, staff believes the data will be more consistent and reliable. This will provide the Council and staff with better data to make informed decisions regarding future street improvements. Attachments Attachment A: Proposal and Quotation from IMS IMS 2020 Quote - Arden Hills page 1 4XRWDWLRQIRU 3URIHVVLRQDO6HUYLFHV 7R'DYLG6ZHDULQJHQ$VVW&LW\(QJLQHHU'DWH2FWREHU )URP'DQ:KLWH&OLHQW6HUYLFHV0DQDJHU3URMHFW$UGHQ+LOOV01 6XEMHFW3DYHPHQW0DQDJHPHQW6HUYLFHV&F 7KDQN \RX IRU WDNLQJ WKH WLPH WR UHYLHZ WKH SDYHPHQW GDWD FROOHFWLRQ VHUYLFHV RIIHUHG E\ ,06 ,QIUDVWUXFWXUH0DQDJHPHQW6HUYLFHV,06H[FHOVLQSDYHPHQWDQGDVVHWPDQDJHPHQWVROXWLRQVDQG FDQSURYLGHDIXOOVXLWHRIGDWDFROOHFWLRQDQGVRIWZDUHLPSOHPHQWDWLRQVHUYLFHV $VZHXQGHUVWDQGWKH&LW\RI$UGHQ+LOOVKDVPDQDJHG LWV URDGZD\V XWLOL]LQJ WKH *RRG3RLQWH VRIWZDUH DSSOLFDWLRQ 7KH JRDO LV WR SURYLGH WKH &LW\ ZLWK D SDYHPHQWFRQGLWLRQGDWDWKDWDOORZV&LW\VWDIIWRXWLOL]H WKH GDWD LQ WKH PRVW HIIHFWLYH ZD\ SRVVLEOH ,06 KDV SHUIRUPHG GDWD FROOHFWLRQ SURMHFWV IRU PDQ\ DJHQFLHV WKURXJKRXW WKH 0LGZHVW LQFOXGLQJ 0LQQHWRQND DQG 0RRUHKHDG01:DWHUWRZQ%UDQGRQ6LRX[)DOOVDQG 0LQQHKDKD&RXQW\6')DUJR1'DQGPDQ\PRUH 7KH &LW\ FXUUHQWO\ PDLQWDLQV DSSUR[LPDWHO\ FHQWHUOLQH PLOHVRI URDGZD\V DQG LV LQWHUHVWHG LQ SHUIRUPLQJDQDXWRPDWHGFRQGLWLRQDVVHVVPHQWRQWKHQHWZRUN7KHGDWDZLOOEHFROOHFWHGIROORZLQJWKH $670 ' GDWD FROOHFWLRQ SURWRFROV DQG ORQJLWXGLQDO SURILOH ZLOO EH UHSRUWHG DV WKH ,QWHUQDWLRQDO 5RXJKQHVV,QGH[,5,,06LVSURSRVLQJDVLQJOHSDVVWHVWEHFDXVHLWLVWKHPLQLPXPVXUYH\PLOHDJH UHTXLUHGWRPDLQWDLQDQHIIHFWLYHDQGFRPSUHKHQVLYHVXUYH\ZKLOHNHHSLQJDORZHUFRVWRIGDWDFROOHFWLRQ ,06LVUHDG\DQGDEOHWRSHUIRUPDGRXEOHSDVVWHVWRQDUWHULDODQGRUFROOHFWRUURDGZD\V 7KHSULPDU\REMHFWLYHLVWRSURYLGHWKH&LW\ZLWKWKHWRROVVNLOOVDQGLQIRUPDWLRQWRPDQDJHWKHLUURDGZD\ QHWZRUNLQWKHPRVWFRVWHIIHFWLYHPDQQHUWKDWSURYLGHVWKHUDWHSD\HUVRI$UGHQ+LOOVZLWKWKHRSWLPDO EOHQGRIOHYHORIVHUYLFHDQGDQQXDOH[SHQGLWXUHV:LWKDIOHHWRI/&065RDG6XUIDFH7HVWHUV567 DFURVVWKH8QLWHG6WDWHV,06KDVFRPSOHWHGPXOWLSOH$670'FHUWLILFDWLRQSURJUDPV2XUDSSURDFK DQGNH\VHUYLFHGLIIHUHQWLDWRULVEDVHGRQWKUHHWLPHSURYHQIXQGDPHQWDOV $QVZHUWKHTXHVWLRQVWKDWDUHEHLQJDVNHG±GRQ¶WRYHUHQJLQHHUWKHV\VWHPRUPDNHLWQHHGOHVVO\ FRPSOLFDWHG'DWDEDVHVDQGWKHDSSOLFDWLRQRIWHFKQRORJ\DUHPHDQWWRVLPSOLI\DVVHWPDQDJHPHQWQRW PDNHLWPRUHGLIILFXOW 6HUYLFHDQGTXDOLW\DUHSDUDPRXQWWRVXFFHVV±WKHULJKWEOHQGRIWHFKQLFDOO\FRUUHFWGDWDFRQGLWLRQ UDWLQJ DQG UHSRUWLQJ ZLOO SURYLGH WKH DJHQF\ ZLWK D ORQJWHUP VWDEOH VROXWLRQ 6HUYLFH WR WKH &OLHQW UHPDLQVRXUWRSSULRULW\ /RFDO FRQWURO DQG FRPPXQLFDWLRQV DUH NH\± LW LV LPSRUWDQW WKDW DOO VWDNHKROGHUV XQGHUVWDQG WKH LPSDFWVRIWKHLUGHFLVLRQVDQGKDYHWKHV\VWHPRXWSXWVUHDFWDFFRUGLQJO\:HH[FHOLQPDNLQJRXUVHOYHV UHDGLO\DYDLODEOH Attachment A &LW\RI$UGHQ+LOOV01 3DYHPHQW0DQDJHPHQW6HUYLFHV IMS 2020 Quote - Arden Hills page 2 2EMHFWLYH3DYHPHQW'DWD&ROOHFWLRQ ,06LVXQLTXHWRWKHLQGXVWU\DVDQREMHFWLYHDQG UHSHDWDEOH$670'GDWDFROOHFWLRQHIIRUWZLOO EHFRPSOHWHG7KH/&06567ZLOOEHXVHGWR SHUIRUP D VXUIDFH FRQGLWLRQ DVVHVVPHQW RI DOO &LW\VWUHHWV,QVWHDGRIXVLQJWKHVXEMHFWLYHIHHW RQ JURXQG RU ZLQGVKLHOG VDPSOLQJ PHWKRG DOO GDWDZLOOEHFROOHFWHGFRQWLQXRXVO\DQGUHFRUGHG LQ IRRW LQWHUYDOV LQ WKH IRUP RI D GHWDLOHG GDWDEDVHFRPSOHWHZLWK*36FRRUGLQDWHV7KH GDWDZLOOWKHQEHDJJUHJDWHGWRWKHVHFWLRQOHYHO WR GHYHORS D VHJPHQW 3&, VFRUH IROORZLQJ &LW\ VSHFLILF VHFWLRQLQJ DQG UHIHUHQFLQJ PHWKRGRORJ\ GHWHUPLQHGDIWHU,06DQG&LW\UHYLHZ *,6DQG3DYHPHQW0DQDJHPHQW/LQNDJH 7KH UROH RI *,6 LQ SDYHPHQW PDQDJHPHQW FDQQRWEHRYHUVWDWHG,WLVDSRZHUIXOWRROWKDW SURYLGHVWKHFDSDELOLW\WRKDQGOHDQGSUHVHQW YDVW DPRXQWV RI GDWD LQ DQ HIILFLHQW PDQQHU ,06ZLOOSURYLGHDOLQNEHWZHHQWKH&LW\¶V*,6 SURJUDPDQGWKHSDYHPHQWPDQDJHPHQWGDWD WR HQDEOH WKH &LW\ WR GLVSOD\ DQG JHQHUDWH FRORUFRGHG PDSV EDVHG XSRQ H[LVWLQJ SDYHPHQWFRQGLWLRQVVWUHHWUHKDELOLWDWLRQSODQV RU PRVW RI WKH GDWD LQ WKH SDYHPHQW PDQDJHPHQW SURJUDP $Q RXWSXW RI VXFK D SORWLVLOOXVWUDWHGLQWKHDGMDFHQWLPDJH 3URYLVLRQRI9LGHR 'LJLWDO,PDJHV ,Q FRQMXQFWLRQ ZLWK WKH VXUIDFH FRQGLWLRQ VXUYH\ HDFK WHVW VHFWLRQ LV UHFRUGHG RQ GLJLWDO YLGHR ZLWK D IRUZDUGIDFLQJ+'FDPHUDDQGXVHGDV SDUW RI WKH ,06 4XDOLW\ &RQWURO DQG 4XDOLW\$VVXUDQFHSURFHGXUHV $GGLWLRQDOFDPHUDVFDQEHPRXQWHGWR H[SDQGWKHYLHZLQJDUHDRUWRLQFOXGH ULJKW RI ZD\ DVVHW IHDWXUHV RI VSHFLDO LQWHUHVWWR WKH&LW\,06 FDQSURYLGH +' GLJLWDO LPDJHV DW ¶ LQWHUYDOV IRU YLHZLQJ LQ VHOHFWHG WKLUGSDUW\ VRIWZDUHDQGRUWKURXJKWKH&LW\¶V*,6 &LW\RI$UGHQ+LOOV01 3DYHPHQW0DQDJHPHQW6HUYLFHV IMS 2020 Quote - Arden Hills page 3 /&06567'HVFULSWLRQDQG'LVWUHVV,GHQWLILFDWLRQ 7KH,06IOHHWRISDYHPHQWSHUIRUPDQFH HTXLSPHQW LQFOXGHV VHYHQ /DVHU 5RDG 6XUIDFH 7HVWHUV IRXU RI ZKLFK DUH RXWILWWHG ZLWK WKH /&06 WHFKQRORJ\ ,06 DOVR KDV DFFHVV WR WZR '\QDIOHFW 'HYLFHV DQG IRXU 6LGHZDON 6XUIDFH 7HVWHUV)RUWKLVVXUYH\ZHSURSRVHWR XVHRQH/&06567FRXSOHGZLWK+' GLJLWDO LPDJHU\ DQG *36 FDSDELOLWLHV 7KH /&06 EDVHG 567 ZLWK LWV VHQVRUDUUDU\ LVFDSDEOHRIFROOHFWLQJD IXOO VXLWH RI $670 FRPSOLDQW SDYHPHQW FRQGLWLRQ GDWD FRPSOHWH ZLWK KLJK DFFXUDF\*36FRRUGLQDWHVDQGPXOWLSOHYLHZ+'GLJLWDOLPDJHVIRUERWKULJLGDQGIOH[LEOHSDYHPHQWVLQ UHDO WLPH 7KH /&06 HTXSPHQW SURYLGHV WKUHH GHPHQVLRQDO KLJKVSHHG PPOHYHO VFDQQLQJ DQG SDWWHUQ UHFRJQLWLRQ DQDO\VLV 6SHFLDOL]HG GDWD SURFHVVLQJ XVLQJ *,6 DV LWV EDFNERQH DOORZV WKH SDYHPHQWGDWDWREHTXLFNO\FKHFNHGIRUFRPSOHWHQHVVDQGTXDOLW\ 7KHPDLQFRPSRQHQWVRIWKH/&06HQKDQFHG567DUH x$ VHQVRU ' /&06 DUUD\ FRXSOHG ZLWK ,08¶V LQHUWLDO PHDVXUHPHQW XQLW DUH XWLOL]HG WR PHDVXUHSDYHPHQWURXJKQHVVUXWWLQJFUDFNLQJSRWKROHVEOHHGLQJJHRPHWULFVDQGPDQ\RWKHU FRPPRQ$670'VXUIDFHGLVWUHVVHV x$XWRPDWHGFUDFNSURILOLQJDQGSURGXFWLRQRIH[WHQWVHYHULW\EDVHGSDYHPHQWGLVWUHVVHVWKURXJK WKH'FUDFNSURILOHVRIWZDUH x8SWR+'GLJLWDOFDPHUDVDUHPRXQWHGIRUIRUZDUGVLGHUHDUDQGULJKWRIZD\YLHZV x$ELOLW\WRFROOHFWGXDOZKHHOSDWKURXJKQHVVWR,QWHUQDWLRQDO5RXJKQHVV,QGH[,5,VWDQGDUGV XVLQJ'SURILOHWHFKQRORJ\ x+LJKDFFXUDF\*OREDO3RVLWLRQLQJ6\VWHP*36UHFHLYHUZLWK2;76LQHUWLDOQDYLJDWLRQIRUJHR ORFDWLQJRISDYHPHQWDQGDVVHWLQIRUPDWLRQZLWKH[FHOOHQWDFFXUDF\ x'XDOGLVWDQFHPHDVXULQJLQVWUXPHQWVWRPHDVXUHOLQHDUGLVWDQFHVWRZLWKLQ x%XLOWLQVRIWZDUHDQGRQERDUGSURFHVVRUVWRGHYHORSURDGZD\LQYHQWRULHVWLPHFRGHLQWHJUDWLRQ DQGV\VWHPPRQLWRUV x,QWHJUDWHGWRXFKVFUHHQHYHQWERDUGXVHGIRUFDSWXULQJDGGLWLRQDOURDGZD\DWWULEXWHVRQWKHIO\RU HYHQH[SDQGLQJWKHURDGZD\GLVWUHVVGDWDWREHFDSWXUHG7KHWRXFKVFUHHQLVSURJUDPPHGZLWK DPRELOHPDSSLQJGHYLFHWRHQVXUHQDYLJDWLRQDQGURXWLQJLVDVHIILFLHQWDVSRVVLEOH$OOLQSXWV FDQEHSURJUDPPHGIRUDFTXLVLWLRQXVLQJDVWDQGDUGH[WHQWDQGVHYHULW\IRUPDW 7KH /DVHU &UDFN 0HDVXULQJ 6\VWHP /&06 DOVR DXWRPDWLFDOO\ FROOHFWV WUDQVYHUVH FUDFNLQJ EORFN FUDFNLQJDOOLJDWRUFUDFNLQJORQJLWXGLQDOFUDFNLQJUXWWLQJSRWKROHVIDXOWLQJURXJKQHVVJHRPHWULFVDQG WH[WXUH 7KH /&06 WHFKQRORJ\ DXWRPDWLFDOO\ GHWHFWV FUDFNV DQGPLQXWH YDULDQFHV LQ WKH SDYHPHQW VXUIDFHXVLQJDKRUL]RQWDOUHVROXWLRQRIPP7KXVWKH/&06JUHDWO\GLPLQLVKHVWKHVXEMHFWLYHQDWXUH RI3&,GDWDFROOHFWLRQSHUIRUPHGE\LPDJHEDVHGVXUYH\VRUHYHQSRLQWODVHUV &LW\RI$UGHQ+LOOV01 3DYHPHQW0DQDJHPHQW6HUYLFHV IMS 2020 Quote - Arden Hills page 4 &ROOHFWLQJ2EMHFWLYH&RQGLWLRQ'DWD 7KH/&06GDWDFROOHFWLRQDSSDUDWXVLVRQHRIWKHPRVWWHFKQRORJLFDOO\DGYDQFHGGHYLFHVDYDLODEOHIRU SDYHPHQWSHUIRUPDQFHDVVHVVPHQWV7KHWZRVHQVRUDUUD\FRPSOHWHVD'PLOOLPHWHUOHYHOVFDQQLQJRI WKHSDYHPHQWVXUIDFHVWKDWSDVVEHORZWKHODVHUDUUD\:LWKDKLJKVSHHGRQHPLOOLPHWHUUHVROXWLRQWKLV PHDQVWKH/&06GHYLFHGHSOR\VDFRQWLQXRXVVFDQRIODVHUSRLQWVDSSUR[LPDWHO\DFURVVDPHUH IRRWRISDYHPHQWPDNLQJLWRQHRIWKHPRVWKLJKUHVROXWLRQSDYHPHQWODVHUVFDQQHUVDYDLODEOH7KH RQERDUG SURFHVVLQJ VRIWZDUH WKHQ WDNHV LW D VWHS IXUWKHU E\ DQDO\]LQJ SDYHPHQW HOHYDWLRQ UDQJH LQWHQVLW\ DQG DXWRPDWLFDOO\ LGHQWLI\LQJ FUDFNLQJ UXWWLQJ URXJKQHVV LQ WKH IRUP RI ,5, SRWKROHV DQG EOHHGLQJ :KLOHDQ\ HQJLQHHULQJILUPFRXOGGHSOR\WKH /&06 HTXLSPHQW IRU GDWD FROOHFWLRQ SURFHVVLQJ WKH LQIRUPDWLRQ IRU GLVWUHVV TXDQWLILFDWLRQ UHTXLUHV D FRPSOHWH XQGHUVWDQGLQJ RI DXWRPDWHG WHFKQRORJLHV *,6 PDSSLQJ DQG GLVWUHVV PHDVXUHPHQW SURWRFROV IRXQG LQ VWDQGDUGV VXFK DV $670 ' 6LPSO\ UHYLHZLQJWKH/&06FUDFNLQJYHFWRUVFRORUHGFUDFNV ZLWK WKH KXPDQ H\HEDOO GLOXWHV WKH REMHFWLYLW\ RI WKH HTXLSPHQW ,06 HQJLQHHUV DQG WHFKQRORJLVWV KDYH GHYHORSHG D FRPSXWHUL]HGSURFHVVLQJDSSOLFDWLRQWKDWDXWRPDWLFDOO\ DSSOLHV DQ ´[´ JULG WR WKH /&06 GRZQZDUG LPDJHV ),6 ILOHV DQG XVHV SUHSURJUDPPHG JHRPHWULF DOJRULWKPV WR FODVVLI\ DQG TXDQWLW\ GLVWUHVVHVE\W\SH7KHVHDXWRPDWHGSURFHVVLQJURXWLQHVUHVXOWLQDQXQSDUDOOHOHGOHYHORIREMHFWLYLW\DQG HIILFLHQF\LQGLVWUHVVSDWWHUQUHFRJQLWLRQDQDO\VLV7KHLPDJHDERYHLOOXVWUDWHVWKHTXDQWLW\RIVHYHUDO GLVWUHVVHVDVZHOODVWKHSUHVHQFHRIDPDQKROHZKLFKZDVDXWRPDWLFDOO\VFUXEEHGIURPWKHGDWDVHW ,Q DGGLWLRQ WR WKH DXWR TXDQWLILFDWLRQ DQG FODVVLILFDWLRQ RI $670 ' GLVWUHVVHV WKH /&06 GHYLFH DOVR RSHUDWHV DV D &ODVV , SURILOH GHYLFH WKDW FROOHFWV ORQJLWXGLQDO SURILOH LQ WKH IRUP RI WKH ,QWHUQDWLRQDO 5RXJKQHVV ,QGH[ DQG WUDQVYHUVH SURILOH UXWWLQJ XVLQJ DGYDQFHG ' SURILOH ODVHU VFDQQLQJ WHFKQRORJ\ 7KH V\VWHP LV QRW VXEMHFW WR YHKLFOH ZDQGHU OLNH RWKHU DXWRPDWHG WHFKQRORJLHVDQGFRPSHQVDWHVIRUYDULDWLRQLQ GULYHU DELOLW\ 7KH SURFHVVLQJ VRIWZDUH FDQ FDOFXODWHUXWWLQJZLGWKDQGGHSWKIROORZLQJWKH $6+727DXW:LUHPHWKRGRORJ\7KHZKLWHVROLGOLQHVLQGLFDWHWKHUHZDVQRUXWWLQJLQWKHOHIWZKHHOSDWK DQG WKDW UXWWLQJ ZDV GHWHFWHG DQG PHDVXUHG LQ WKH ULJKW ZKHHO SDWK )LOWHUV FDQ DOVR EH DSSOLHG WR DFFRXQW IRU UHKDELOLWDWLRQ DFWLYLW\ RYHUODS ZKLFK FDQ EH DV PXFK DV D ó LQFK GHSHQGLQJ RQ WKH DSSOLFDWLRQ &LW\RI$UGHQ+LOOV01 3DYHPHQW0DQDJHPHQW6HUYLFHV IMS 2020 Quote - Arden Hills page 5 &UDFNLQJ)DXOWLQJ7H[WXUH%OHHGLQJ 3RWKROHV±7KH567 DOORZV,06WRFRQGXFWDQREMHFWLYHFUDFNVXUYH\WKXVLQFUHDVLQJ WKHDFFXUDF\RIDQRWKHUZLVHVXEMHFWLYHPDQXDOVXUYH\+LJK VSHHGODVHUVDQGDQRQERDUGSURFHVVLQJFRPSXWHUDFFXUDWHO\ PHDVXUHWKHVXUIDFHSURILOHRIWKHURDG,QFOXGHGLQWKLVSURILOH DUHDOOFUDFNVDQGIDXOWVDVVPDOODV´PPZLGHWKDWSDVV EHQHDWK WKH ODVHUV 3URFHVVLQJ VRIWZDUH WKHQ UHGXFHV DQG ILOWHUVWKLVLQIRUPDWLRQWRGHWHUPLQHWKHtotal number of cracks, crack width/depth, as well as the crack intervalSOXVIDXOWLQJLQIRUPDWLRQ)URPWKLVLQIRUPDWLRQTXDQWLILHG FUDFNGDWDFDQEHGHWHUPLQHGDWERWKWKHVDPSOHDQGVXPPDU\LQWHUYDOV&UDFNLGHQWLILFDWLRQLQFOXGHVDOO FUDFNLQJ VXFK DV DOOLJDWRU WUDQVYHUVH ORQJLWXGLQDO PDS DQGHGJH FUDFNLQJ ZKHUH DSSOLFDEOH 7KH /&06 GHYLFH LV DOVR FDSDEOH RI DXWRPDWLFDOO\ FROOHFWLQJ LGHQWLI\LQJ DQG UHSRUWLQJ VXSSOHPHQWDO GLVWUHVVHVVXFKDVEOHHGLQJRQDVSKDOWURDGZD\VDQGSRWKROHV 5XWWLQJ 7KH /&06 GHYLFH FROOHFW FRQWLQXRXV WUDQVYHUVH SURILOH GDWD DW PLOOLPHWHU UHVROXWLRQ DW KLJKZD\VSHHG7KLVFRQILJXUDWLRQLVIDUVXSHULRUWRRWKHUW\SHVRIYHKLFOHVWKDWXWLOL]HWKUHHODVHUVRU VRQLFWUDQVGXFHUVWRFDOFXODWH³UHODWLYHUXWWLQJ´(YHQILYHVHQVRUXQLWVDUHH[WUHPHO\VHQVLWLYHWRGULYHU HUURUVLQFHLWLVHVVHQWLDOLQWKLVFDVHWKDWWKHGULYHUNHHSWKHGDWDFROOHFWLRQYHKLFOH¶VZKHHOH[DFWO\LQWKH UXWWHGZKHHOWUDFNVDVVXPLQJWKDWWKH\ILW 7KH 7DXW ZLUH PHWKRG LV XVHG WR FDOFXODWH WKH UXW GHSWK LQ ERWK WKH ULJKW DQG OHIW ZKHHO WUDFN RQ D FRQWLQXRXV EDVLV (LWKHU WKH ULJKW RU GHHSHU RI WKH WZRZKHHOSDWK UXWV PD\ EH XVHG IRU UXW GHSWK FDOFXODWLRQVZLWKWKHDYHUDJHUXWGHSWKIRUWKDWZKHHOSDWKUHSRUWHGIRUHDFKVHFWLRQRut depth results, quantified by 3 - 4 severity thresholds (with break points at user-defined levels such as 0.25, 0.50 and 0.65 inches) and percentage of section will be provided for every segment. 5RXJKQHVV ±,QWHUQDWLRQDO 5RXJKQHVV ,QGH[ ,5, GDWD LV FDOFXODWHG LQ UHDOWLPH IURP FRQWLQXRXV ORQJLWXGLQDOSURILOHGDWDFROOHFWHGE\WKHYDQ¶V'SURILOHGHYLFH'DWDLVVLPXOWDQHRXVO\REWDLQHGIURP WKUHH GHYLFHV WR GHWHUPLQH WKH URDG SURILOH D SXOVH WUDQVGXFHUEDVHG GLVWDQFHPHDVXULQJ LQVWUXPHQW '0,KLJKVSHHG'ODVHUVHQVRUVRSHUDWLQJDW0+]DQGDQDFFHOHURPHWHULQFRQIRUPDQFHZLWK $670(7KH567XQLWFRQIRUPVWRD&ODVV,SURILOLQJGHYLFHDQGLWFDQDOVR³SDXVH´RYHUQRQYDOLG URDGZD\VHFWLRQVVXFKDVORFDOL]HGPDLQWHQDQFHDFWLYLWLHVUDLOURDGFURVVLQJVRUEULFNLQOD\VDQGQRW DIIHFWWKHRYHUDOO,5,YDOXH 'LVWRUWLRQV5DYHOLQJ3DWFKLQJ 2WKHU$WWULEXWHV±:KLOH WKH/&06DXWRPDWLFDOO\FROOHFWVWKHPDMRULW\RI$670' GLVWUHVVHVWKH567SODWIRUPFDQEHFRQILJXUHGWRFROOHFWWKH UHPDLQLQJGLVWUHVVHVUDYHOLQJGLVWRUWLRQVDQGSDWFKLQJXVLQJ WKHLQWHJUDWHG''&56%\PHDQVRIDWRXFKVFUHHQEDVHG WDEOHWFRPSXWHUKLJKO\WUDLQHG,06WHFKQLFLDQVLQSXWFKDQJHV LQREVHUYHGGLVWUHVVVHYHULWLHVDQGH[WHQWVRULGHQWLI\VSHFLILF URDGZD\DVVHWVRUDWWULEXWHVVXFKDVFXUEUHYHDORUOLSRIJXWWHU LQIRUPDWLRQ 7KH ''&56 LV LQWHJUDWHG LQWR WKH GDWD IORZ WKURXJKWLPHFRGH*36'0,GLVWDQFHDQGLQYHQWRU\FRQWURO7KHGDWDLVWKHQSRVWSURFHVVHGLQWKH RIILFHWRJHQHUDWHH[WHQWTXDQWLWLHVIRUHDFKREVHUYHGGLVWUHVVVHYHULW\OHYHOWKURXJKRXWHYHU\VXUYH\HG URDGVHFWLRQ &LW\RI$UGHQ+LOOV01 3DYHPHQW0DQDJHPHQW6HUYLFHV IMS 2020 Quote - Arden Hills page 6 5HFRPPHQGHG6RIWZDUH(DV\6WUHHW$QDO\VLV(6$6SUHDGVKHHW :KLOHWKHUHVXOWVRIWKHVXUYH\ZLOOFHUWDLQO\EHGRFXPHQWHGDQGERXQGLQWRDILQDOUHSRUWWKDWLOOXVWUDWHV WKHILQGLQJVRIWKHVXUYH\LWLVLPSHUDWLYHWKDW&LW\VWDIIKDYHDFFHVVWRWKHSDYHPHQWFRQGLWLRQDQG DQDO\VLVUHVXOWVZLWKRXWKDYLQJWREHFRPHVRIWZDUHH[SHUWV:KLOH,06LVDOHDGLQJH[SHUWZLWKPRVWUG SDUW\SDYHPHQWPDQDJHPHQWDSSOLFDWLRQVDVPHQWLRQHGLQWKHSUHYLRXVVHFWLRQZHKDYHHQJLQHHUHGD VLPSOH DQG HDV\ WR XVH ([FHO VSUHDGVKHHW WKDW XWLOL]HV WKH FRUH PHWULFV RI DQ\ JUHDW SDYHPHQW PDQDJHPHQWV\VWHPVXFKDVWKHDELOLW\WRSULRULWL]HDQGRSWLPL]HWKHPXOWL\HDUSODQV 7KH(DV\VWUHHW$QDO\VLV(6$VSUHDGVKHHWZLOOEHSURJUDPPHGWRGHYHORSDPXOWL\HDUPDLQWHQDQFH DQGUHKDELOLWDWLRQSODQXVLQJ³FRVWRIGHIHUUDO´DVDUHKDELOLWDWLRQFDQGLGDWHVHOHFWLRQFRQVWUDLQWLQDQHIIRUW WRLQWURGXFHFRVWEHQHILWWHFKQLTXHVLQWRWKH&LW\¶VSDYHPHQWPDQDJHPHQWSODQ7KLVZLOODOORZ$UGHQ +LOOV WR SURYLGH DQG GHPRQVWUDWH WKH PRVW HIIHFWLYH XVH RI DYDLODEOH IXQGV ,Q DGGLWLRQ WKH (6$ VSUHDGVKHHWZLOOKDYHUHIHUHQFHGGHWHULRUDWLRQFXUYHVIRUHDFKIXQFWLRQDOFODVVLILFDWLRQSDYHPHQWW\SH DQGHYHQSDYHPHQWVWUHQJWKUDWLQJ7KHSRZHURIKDYLQJWKHGDWDLQVXFKDQRSHQDUFKLWHFWXUHIDVKLRQ DOORZVWKH&LW\WRXWLOL]HUGSDUW\VRIWZDUHLQWKHIXWXUHLIGHVLUHG7KHVSUHDGVKHHWZLOODOVRFRQWDLQDIXOO VXLWH RI PDLQWHQDQFH DQG UHKDELOLWDWLRQ WHFKQLTXHV XQLW UDWHV DQG DVVRFLDWHG 3&, UHVHWV 7KH SDUDPHWHUVRIWKHDQDO\VLV3ULRULW\:HLJKWLQJ)DFWRUVFDQDOVREHPRGLILHGDQGUHSULRULWL]HGRQWKHIO\ DVZHOODVEHLQJDEOHWRSULRULWL]HWKHWRSWHQVWUHHWVQHHGLQJUHFRQVWUXFWLRQRUPDMRUUHKDELOLWDWLRQ7KLV ZLOO DOORZ WKH &LW\¶V GDWD WR HYROYH ZLWK WKH SULRULWLHV RI HOHFWHG RIILFLDOV DQG GHSDUWPHQW VWDII 3URJUDPPHG SULRULW\ ZHLJKWLQJ IDFWRUV LQFOXGH IXQFWLRQDO FODVVLILFDWLRQ SDYHPHQW W\SH DQG SDYHPHQW VWUHQJWKZKLOHDFWXDOFDQGLGDWHVHOHFWLRQLVEDVHGRQWKHLQFUHPHQWDOFRVWRIGHIHUUDO $V VHHQ LQ WKH LPDJH EHORZ WKH DQDO\VLV GDWD LQ WKH VSUHDGVKHHW LV VXSSOHPHQWHG ZLWK PDQ\ FHOOV KLJKOLJKWHG LQ \HOORZ 7KH \HOORZ KLJKOLJKWHG FHOOV VLPSO\ LQGLFDWH WKDW WKH\ DUH ³+27´ DQG FDQ EH PRGLILHGE\WKHHQGXVHU7ZRRIWKH\HOORZFHOOVVKRZQEHORZUHSUHVHQWWKH$QQXDO%XGJHWDQGWKH 3URMHFW ,' 7KH $QQXDO %XGJHW FHOO FDQ EH PRGLILHG ZLWK D QHZEXGJHW DQG WKH \HDU SODQ ZLOO DXWRPDWLFDOO\ UHSULRULWL]H RQ WKH IO\ :KLOH ,06 ZLOO KDYH DOUHDG\ DJJUHJDWHG WKH &LW\¶V VHJPHQWV LQWHUVHFWLRQWRLQWHUVHFWLRQ LQWR YLDEOH SURMHFWV PXOWLSOH VHJPHQWV VWUXQJ WRJHWKHU WR IRUP D ORJLFDO SURMHFW WKH XVHU KDV WKH DELOLW\ WR DJJUHJDWH DGGLWLRQDO VHJPHQWV LQWR D SURMHFW RU HYHQ UHPRYH D VHJPHQWIURPDSURMHFWZLWKRXWKDYLQJWREHFRPHDVRIWZDUHH[SHUW &LW\RI$UGHQ+LOOV01 3DYHPHQW0DQDJHPHQW6HUYLFHV IMS 2020 Quote - Arden Hills page 7 (6$)XQFWLRQDOLW\3URMHFW&RPSOHWLRQDQG3&,2YHUULGHV 7KH VSUHDGVKHHW DOVR DOORZV WKH &LW\ WR UHIUHVK WKH \HDU SODQ E\ HQWHULQJ WKH PDLQWHQDQFH DQG UHKDELOLWDWLRQZRUNFRPSOHWHG$VVHHQLQWKHLPDJHEHORZWKHVSUHDGVKHHWLVVXSSOHPHQWHGZLWK³3&, 2YHUULGH´IXQFWLRQDOLW\:KHQZRUNLVFRPSOHWHGRQDSDUWLFXODUVHJPHQWWKHXVHUVLPSO\LQVHUWVWKH RYHUULGH3&,YDOXHDORQJZLWKDGDWH7KHVSUHDGVKHHWWKHQUHPRYHVWKHVHJPHQWIURPWKH\HDUSODQ DQGXSGDWHVDOOUHIHUHQFHGQHWZRUN3&,DYHUDJHV 2WKHUIHDWXUHVRIWKH,06(DV\6WUHHW$QDO\VLVVSUHDGVKHHWDUHDVIROORZV x 5HGWULDQJOHWLSVWKDWWULJJHUDGLDORJXHER[H[SODLQLQJFHOOFRQWHQWV x $ELOLW\WRDGGQHZURDGVHJPHQWVDQGDWWULEXWHVRQWKHIO\ x 0RGLILDEOHGLVWUHVVLQGLFHVIRU$UGHQ+LOOVILHOGLQVSHFWLRQV x ,QSXWZRUNFRPSOHWHGDQGRYHUULGHVHJPHQWOHYHO3&,VFRUHV x 3ULRULWL]HE\QHLJKERUKRRGV]RQHVRUGLVWULFWV x $ELOLW\WRPRGLI\SURMHFWOHQJWKV±LQFOXGHVDJJUHJDWLQJDQGVSOLWV x &RPPLWSURMHFWVDQGIRUFH³0XVW'R¶V´RU³0XVW1HYHU'R´ x 3URJUDPYDU\LQJDQQXDOEXGJHWVRYHUD\HDUKRUL]RQ x &RPPLWDSHUFHQWDJHRIWKHEXGJHWWRVXUIDFHWUHDWPHQWVLIGHVLUHG x $XWRPDWHGUHKDESODQSULRULWL]DWLRQDQGRSWLPL]DWLRQ x 0DFURVWKDWDXWRPDWLFDOO\VRUWDQGILOWHUVLPSOHUHKDEDQGLQYHQWRU\OLVWV x $ELOLW\WRV\QFWKHVSUHDGVKHHWZLWKWKH'DWD9LHZHUWKRXJKD&69ILOHH[SRUW :KLOHWKHVSUHDGVKHHWLVQRWPHDQWWRUHSODFHSDYHPHQWPDQDJHPHQWV\VWHPVLWLVDQDOWHUQDWLYHIRU DJHQFLHVWKDWGRQRWZDQWWRPDLQWDLQWKHUHVRXUFHVRUVWDIIWRPDLQWDLQDGHGLFDWHGDSSOLFDWLRQ,ID GHGLFDWHGV\VWHPLVVWLOOGHVLUHG,06ZLOODVVHVVDOORWKHUDYDLODEOHUGSDUW\VROXWLRQV7KH(6$GDWD LQWHJUDWHV ZLWK *,6 DQG LV DOVR HDVLO\ H[SRUWDEOH WR EH WLHG LQWR 3$9(5 5RDG0DQDJHU /XFLW\ &DUWHJUDSK%HH+LYH&LW\ZRUNVRURWKHUVRIWZDUHVROXWLRQV 3DYHPHQW&RQGLWLRQ6XPPDU\ 7RGD\ 3&, &XUUHQW1HWZRUN3&, 6XUIDFH'LVWUHVV,QGH[6',5RXJKQHVV,QGH[5,3DYHPHQW&RQGLWLRQ,QGH[3&,3&,6XUYH\'DWH6WUHQJWK5DWLQJ&RQGLWLRQ5DWLQJ/RDG$VVRFLDWHG'HGXFWV/$''1RQ/RDG$VVRFLDWHG'HGXFWV1/$'3&,2YHUULGH3&,2YHUULGH'DWH&XUUHQW3&, 02' *RRG 02' )DLU 02' *RRG 02' 9*RRG 02' *RRG 6751* *RRG 02' *RRG 02' ([FHOOHQW :($. )DLU 02' ([FHOOHQW :($. 93RRU 02' ([FHOOHQW 02' 9*RRG &LW\RI$UGHQ+LOOV01 3DYHPHQW0DQDJHPHQW6HUYLFHV IMS 2020 Quote - Arden Hills page 8 $GGLWLRQDO6DPSOH,PDJHVRIWKH(6$,QWHUDFWLYH6SUHDGVKHHW)XQFWLRQDOLW\ 5XQQLQJDEXGJHWPRGHOZLWKLQ(6$LVDVHDV\DVW\SLQJLQ\RXUDQQXDOEXGJHWHDFK\HDUIRUWKHQH[W \HDUV$IWHUGRLQJVRWKHDSSOLFDWLRQZLOODXWRPDWLFDOO\UXQWKHPRGHODQGGHYHORSDQRSWLPL]HG\HDU UHKDELOLWDWLRQSODQWKDWLGHQWLILHVWKHVHOHFWHGUHKDEFDQGLGDWHVWKHLU\HDURIVHOHFWLRQDQGWKHLUFRVW 3URMHFWVDUHPXOWLSOHVHJPHQWVEORFNVWKDWKDYHEHHQDJJUHJDWHGWRJHWKHUWRIRUPDORJLFDOSURMHFWZLWKLQ WKHSDYHPHQWPDQDJHPHQWV\VWHP:KLOHFKDQJLQJWKHOLPLWVRUVL]HRIDSURMHFWLVRIWHQGLIILFXOWLQPDQ\ SDYHPHQWPDQDJHPHQWDSSOLFDWLRQVGRLQJVRLQ(6$LVDVVLPSOHDVHQWHULQJLQDQHZ³3URMHFW,'´ 1RWKLQJPRUHLVQHFHVVDU\ 7KH(6$DSSOLFDWLRQLVFRQILJXUHGZLWKWKH&LW\¶VDSSURSULDWHUHKDELOLWDWLRQDFWLYLWLHVDQGUHSUHVHQWVD YHU\FRPSUHKHQVLYHSDYHPHQWPDQDJHPHQWSURJUDPLQWKHIRUPRIDQ([FHO6SUHDGVKHHW$IXOOGHPR RIWKH(6$DSSOLFDWLRQFDQEHVFKHGXOHGZLWK&LW\VWDIILIGHVLUHG &LW\RI$UGHQ+LOOV01 3DYHPHQW0DQDJHPHQW6HUYLFHV IMS 2020 Quote - Arden Hills page 9 3URSRVHG%XGJHW 7KHGHWDLOHGEXGJHWSUHVHQWHGEHORZLVEDVHGRQWKH,06ZRUNSODQDQGGHOLYHUDEOHV,WUHSUHVHQWVD UHDOLVWLF EXGJHW WR FRPSOHWH WKH ZRUN DQG ZH DUH FRQILGHQW ZHFDQ PDLQWDLQ DQ RQWLPH RQEXGJHW DSSURDFKWRWKHDVVLJQPHQW 7KDQN\RXIRUFRQVLGHULQJ,06DVDYLDEOHVROXWLRQWR\RXUSDYHPHQWPDQDJHPHQWQHHGVDQGZHZLOO VWULYHWREHFRPHDQDVVHWDQGH[WHQVLRQRIWKH&LW\RI$UGHQ+LOOVVWDIIDQGWHDP,IDQ\TXHVWLRQVDULVH SOHDVHGRQRWKHVLWDWHWRFRQWDFWPHDWRUGZKLWH#LPVDQD\OVLVFRP 5HJDUGV ,06,QIUDVWUXFWXUH0DQDJHPHQW6HUYLFHV 'DQ:KLWH0%$ &OLHQW6HUYLFHV0DQDJHU 7DVN $FWLYLW\ 4XDQW 8QLWV 8QLW5DWH 7RWDO 3URMHFW,QLWLDWLRQ 3URMHFW,QLWLDWLRQ 6HWXS /6 1HWZRUN5HIHUHQFLQJ *,6/LQNDJH 70, 1HWZRUN,QYHQWRU\&KHFNV 6XUYH\0DS'HYHORSPHQW 70L )LHOG6XUYH\V 0RELOL]DWLRQ&DOLEUDWLRQ /6 567)LHOG'DWD&ROOHFWLRQ /6 'DWD0DQDJHPHQW 3DYHPHQW'DWD4$4&3URFHVVLQJ )RUPDW 70L 'HOLYHU\RI3&,&RQGLWLRQ'DWDDQG6XPPDU\5HSRUW*,6([FHO0DSV /6 3URMHFW0DQDJHPHQW /6 2SWLRQDO3URMHFW$FWLYLWLHV 3DYHPHQW$QDO\VLV%XGJHW6FHQDULRV(6$6SUHDGVKHHW <HDU5HSRUW /6 &LW\&RXQFLO0HHWLQJ:RUNVKRS3UHVHQWDWLRQ ($ '\QDIOHFW0RELOL]DWLRQ /6 D'HIOHFWLRQ7HVWLQJ $QDO\VLV 70L 3URYLVLRQRI+''LJLWDO,PDJHVDW)RRW,QWHUYDOV&HQWHU)RUZDUG9LHZ 70, 5LJKWRI:D\$VVHW,PDJH'DWD&ROOHFWLRQ*36 9LGHR$FTXLVLWLRQ 70L D$VVHW,QYHQWRU\ 'DWDEDVH'HYHORSPHQW$'$5DPSV 70L E$VVHW,QYHQWRU\ 'DWDEDVH'HYHORSPHQW6LGHZDONV 70L F$VVHW,QYHQWRU\ 'DWDEDVH'HYHORSPHQW&XUEV 70L G$VVHW,QYHQWRU\ 'DWDEDVH'HYHORSPHQW6LJQV 6XSSRUWV 70L H$VVHW,QYHQWRU\ 'DWDEDVH'HYHORSPHQW6WUHHW/LJKWV 70L I$VVHW,QYHQWRU\ 'DWDEDVH'HYHORSPHQW6WUHHW)XUQLWXUH 70L J$VVHW,QYHQWRU\ 'DWDEDVH'HYHO0DUNLQJV 6WULSLQJ 70L K$VVHW,QYHQWRU\ 'DWDEDVH'HYHORSPHQW7UDIILF6LJQDOV 70L $GGLWLRQDO2QVLWH0HHWLQJV ($ &ROOHFWLRQRI*36FURVVIDOOUDGLXVRIFXUYDWXUHDQGJUDGH 70, ,069XH:HEKRVWHG9LHZHU LQFOXGHV7HFK6XSSRUW /6 $UGHQ+LOOV3URMHFW7RWDO Page 1 of 2 CONSENT ITEM – 6E MEMORANDUM DATE: October 12, 2020 TO: Honorable Mayor and City Councilmembers Dave Perrault, City Administrator FROM: Mike Mrosla, Community Development Manager/City Planner PUBJECT: Metropolitan Livable Communities Act Participation Budgeted Amount: Actual Amount: Funding Source: N/A N/A N/A Council shall consider Motion to approve Resolution 2020-047 electing to continue participating in the local housing incentives account program under the Metropolitan Livable Communities Act. Background In 1995, the City has opted to participate in the Metropolitan Livable Community Act (LCA) programs. Participating in this program is voluntary; however, it provides the City with the opportunity to compete for grants and loans to support activities that help the City meet housing goals, remediate environmental contaminated sites, and support projects that link jobs, housing, and transit. The Livable Communities Program is based on cooperation and incentives to achieve both regional and local goals. Through this program, the City received $200,000 in 2006 to remediate contamination at the Traverse Business Center property,and $75,000 for the Twin Cities Army Ammunition Plant (TCAAP) property reuse planning in 2002. All cities that participate in the LCA program are required to establish affordable and life-cycle housing goals for the next decade (2021 through 2030). As part of the 2040 Comprehensive Plan approval process, the City already acknowledged that the City’s share of the future regional affordable housing need was 373 new affordable housing units. This number was calculated by the Metropolitan Council and was based on information such as available land, access to jobs, and access to transit. In recognition of many city’s limited resources to create new affordable housing, the Metropolitan Council has shifted from one target affordable housing number to a target range for affordable housing. The new target range of affordable housing units in Arden Hills is 205 to 373 new units over ten years. The life-cycle housing target range for Arden Hills is 860 new units. Page 2 of 2 Both affordable and life-cycle housing are consistent with the City’s 2040 Comprehensive Plan and zoning regulations, provided the TCAAP property redevelops in accordance with the 2040 Comprehensive Plan. If a city is not able to meet the affordable housing goals by 2030, there are no repercussions. However, if a city does not participate in the program, the city is not eligible for certain grant programs, including the Livable Communities Demonstration Account (LCDA), Local Housing Incentive Account (LHIA), and Tax Base Revitalization Account (TBRA). The LCDA and TBRA grants in particular could be useful for redevelopment projects and TCAAP. Budget Impact: N/A Attachments: A. Resolution 2020-047 To view the final document, access adopted Resolutions via Arden Hills Public Laserfiche Weblink by visiting cityofardenhills.org and clicking on Archived Documents under Helpful Links on our main webpage. CITY OF ARDEN HILLS COUNTY OF RAMSEY STATE OF MINNESOTA RESOLUTION NO. 2020-047 RESOLUTION ELECTING TO PARTICIPATE IN THE LOCAL HOUSING INCENTIVES ACCOUNT PROGRAM UNDER THE METROPOLITAN LIVABLE COMMUNITIES ACT CALENDAR YEARS 2021 THROUGH 2030 WHEREAS,the Metropolitan Livable Communities Act (Minnesota Statutes sections 473.25 to 473.255) establishes a Metropolitan Livable Communities Fund which is intended to address housing and other development issues facing the metropolitan area defined by Minnesota Statutes section 473.121; and WHEREAS,the Metropolitan Livable Communities Fund, comprising the Tax Base Revitalization Account, the Livable Communities Demonstration Account, the Local Housing Incentive Account and the Inclusionary Housing Account, is intended to provide certain funding and other assistance to metropolitan-area municipalities; and WHEREAS,a metropolitan-area municipality is not eligible to receive grants or loans under the Metropolitan Livable Communities Fund or eligible to receive certain polluted sites cleanup funding from the Minnesota Department of Employment and Economic Development unless the municipality is participating in the Local Housing Incentives Account Program under Minnesota Statutes section 473.254; and WHEREAS, the Metropolitan Livable Communities Act requires that each municipality establish affordable and life-cycle housing goals for that municipality that are consistent with and promote the policies of the Metropolitan Council as provided in the adopted Metropolitan Development Guide; and WHEREAS, a metropolitan-area municipality can participate in the Local Housing Incentives Account Program under Minnesota Statutes section 473.254 if: (a) the municipality elects to participate in the Local Housing Incentives Program; (b) the Metropolitan Council and the municipality successfully negotiate new affordable and life-cycle housing goals for the municipality; (c) the Metropolitan Council adopts by resolution the new negotiated affordable and life-cycle housing goals for the municipality; and (d) the municipality establishes it has spent or will spend or distribute to the Local Housing Incentives Account the required Affordable and Life- Attachment A 2 Cycle Housing Opportunities Amount (ALHOA) for each year the municipality participates in the Local Housing Incentives Account Program. NOW, THEREFORE, BE IT RESOLVED by the City Council of the City of Arden Hills, Minnesota, that: 1. Elects to participate in the Local Housing Incentives Program under the Metropolitan Livable Communities Act for calendar years 2021 through 2030. 2. Agrees to the following affordable and life-cycle housing goals for calendar years 2021 through 2030: Affordable Housing Goals Range Life-Cycle Housing Goal 205 – 373 0 - 860 3. Will prepare and submit to the Metropolitan Council a plan identifying the actions it plans to take to meet its established housing goals. PASSED AND ADOPTED BY THE CITY COUNCIL OF THE CITY OF ARDEN HILLS THIS 12th DAY OF OCTOBER, 2020. ________________________________ David Grant, Mayor Attest: ______________________________ Julie Hanson, City Clerk Page 1 of 2 NEW BUSINESS – 9A MEMORANDUM DATE: October 12, 2012 TO: Honorable Mayor and City Councilmembers Dave Perrault, City Administrator FROM:Mike Mrosla, Community Development Manager/City Planner SUBJECT: Extending the Application Submittal Period for Small Business Emergency Assistance Grant Program Budgeted Amount: Actual Amount: Funding Source: N/A $150,000 CARES Act Council Should Consider A motion to adopt resolution 2020-049 extending the application submittal period for the Small Business Emergency Assistance Grant Program in response to the COVID-19 pandemic. Background At its September 28meeting, the City Council adopted resolution 2020-046 removing the minimum employment criteria and reopening the application window for the Small Business Emergency Assistance Grant Program starting Tuesday, September 29 through Tuesday, October 6, 2020. Staff received four (4) new applications during the recent application period. During the duration of the program staff has received 22 applications. Staff has also been contacted by two (2) business that would like to apply following the closing of the recent application period. Should Council want to extend the application window till Friday, October 23, 2020 to allow for additional time for businesses to apply for the grant a resolution has been provided for consideration. If approved, staff will promote the extension through emails, the website, social media and site visits. Social distancing and face coverings are worn during site visits. Next Steps At the second City Council meeting in October a New Business discussion item about offering additional funding to previously awarded grantees should funding be available. Budget Impact The city had made available $150,000 from the CARES Act Funds for the proposed Small Business Emergency Assistance Grant Program. Council shall consider The following are motion language options for the City Council to consider. Page 2 of 2 1. Approval: A motion to adopt resolution 2020-049 extending the application window for the Small Business Emergency Assistance Grant Program. 2. Denial: Motion to deny a motion to adopt resolution 2020-049 extending the application window for the Small Business Emergency Assistance Grant Program. 3. Table: Motion to table a motion to adopt resolution 2020-049 extending the application window for the Small Business Emergency Assistance Grant Program. Attachments A. Resolution No. 2020-049 To view the final document, access adopted Resolutions via Arden Hills Public Laserfiche Weblink by visiting cityofardenhills.org and clicking on Archived Documents under Helpful Links on our main webpage. CITY OF ARDEN HILLS COUNTY OF RAMSEY STATE OF MINNESOTA RESOLUTION NO. 2020-049 RESOLUTION EXTENDING THE APPLICATION SUBMITTAL PERIOD FOR SMALL BUSINESS EMERGENCY ASSISTANCE GRANT PROGRAM WHEREAS, the federal and state governments have provided federal financial assistance through the Federal Coronavirus Aid, Relief, and Economic Security (CARES) Act to Minnesota cities impacted by the COVID-19 pandemic, The funds are now available and the City is required to expend all of its funds by November 15, 2020, and; WHEREAS, one of the eligible costs for use of the federal funding is to provide financial assistance to local businesses that have been financially impacted by the pandemic, and; WHEREAS, the City Council at its August 24, 2020 meeting approved establishing a small business emergency assistance grant program to provide financial assistance to its local businesses in accordance with CARES Act funding and guidelines, and; WHEREAS, the application submittal period closed on Tuesday, October 6, 2020, NOW, THEREFORE, BE IT RESOLVED by the City Council of the City of Arden Hills, Minnesota, that: 1. The Small Business Emergency Assistance Grant Program application submittal period be extended until the 23 rd day of October 2020. ADOPTED BY THE CITY COUNCIL OF THE CITY OF ARDEN HILLS THIS 12th DAY OF OCTOBER 2020. ______________________________ David Grant, Mayor ATTEST: ______________________________ Julie Hanson, City Clerk Attachment A City of Arden Hills City Council Meeting for October 12, 2020 P:\Planning\Planning Cases\2020\20-010 4200 Round Lake Road PP PUD\CC Packets Page 1 of 9 UNFINISHED BUSINESS – 10A MEMORANDUM DATE: October 12, 2020 TO: Honorable Mayor and City Councilmembers Dave Perrault, City Administrator FROM:Mike Mrosla, Community Development Manager/City Planner SUBJECT: Planning Case # 20-010 Applicant: Scannell Properties Property Location: 4200 Round Lake Road Request: Master Planned Unit Development, Conditional Use Permit, Site Plan and Preliminary/Final Plat Budgeted Amount: Actual Amount: Funding Source: N/A N/A N/A Council shall consider: Adopting motions to approve, table or deny Planning Case 20-010 for Scannell Properties proposed development at 4200 Round Lake Road. Background The City Council previously discussed Planning Case 20-010 at their meeting on September 28, 2020. This application was tabled to allow Council to visit sites where the proposed metal material is used and to allow staff time to work with the Applicant on a landscaping plan and minimum caliper inches. Staff has worked with the Applicant on these items and is bringing this planning case back for further review by the City Council. Scannell Properties (“Applicant”) is proposing to construct a 250,000 square foot office and warehouse facility on the existing vacant land located at 4200 Road Lake Road (“Subject Property”). The Applicant is also requesting to subdivide the subject parcel into two (2) lots of record. The Subject Property is zoned GB, Gateway Business District and is guided as Light Industrial & Office on the Land Use Plan. Plan Evaluation A full evaluation of the proposal was presented to the City Council on September 28, 2020. The following paragraphs focus on outstanding items and revised information submitted after the City Council meeting. City of Arden Hills City Council Meeting for September 28, 2020 P:\Planning\Planning Cases\2020\20-010 4200 Round Lake Road PP PUD\CC Packets Page 2 of 9 A. District Provisions 1320.13- Flexibility requested According to City Code Section 1320.13, office uses cannot occupy less than 25 percent of a project's total floor area and not more than 50 percent. In addition, warehousing and wholesaling uses shall not exceed 75 percent of the building in which it is located. While the final tenants are unknown at this time, the Applicant is anticipating to attract a wide variety of light industrial tenants with uses including office, manufacturing, research and development, and/or warehousing. The Applicant is requesting flexibility to increase this requirement for warehousing and wholesaling to 85 percent and the remaining 15 percent dedicated to non-warehouse uses such as a combination of uses including-but-not-limited-to office, manufacturing, production, R&D, lab and/or showroom. The Applicant would like to further discuss the Council proposed 80 percent warehouse and 20 percent office split. B. Minimum Caliper Inches – Flexibility Requested Tree mitigation is not required as the current site has no trees deemed significant per City Code. The Zoning Code requires that a minimum number of caliper inches of trees be provided based on the gross square footage of the building on the property. A single story building in excess of thirty (30) feet in height shall be considered a two-story building for the purposes of determining gross square footage. The proposed building would be considered two-stories, and includes 499,552 gross square feet. This requires a minimum of 1,561 caliper inches or 624 two inch caliper trees. The proposed site is limited to where trees can be planted onsite due the wetlands and overhead power lines. The Applicant was previously proposing 310 caliper inches or 110 trees. In response to City Council comments the Applicant has added 100 caliper inches or 31 trees in the areas identified in the image below. The total proposed is 410 caliper inches or 210 trees. Staff has reviewed City Code and has spoken with the City Attorney and given the request for flexibility via the PUD process the Council could request off-site tree planting or fee in lieu for the minimum caliper inches standard. The Applicant would like to further discuss this with the Council at the upcoming meeting. City of Arden Hills City Council Meeting for September 28, 2020 P:\Planning\Planning Cases\2020\20-010 4200 Round Lake Road PP PUD\CC Packets Page 3 of 9 C.Aesthetics - Flexibility Requested The GB district requires materials and colors selected for any individual building shall be compatible with other buildings in the GB District. The Applicant is proposing to use a color palette similar to the existing buildings on Gateway Boulevard. In addition, the GB district requires the exterior materials be a mixture of brick, stone, glass or any combination thereof, except trim and accessories may be metal. The Applicant is requesting to utilize a combination of painted pre-cast, glass, architectural metal panels with concealed fasteners, and thin brick veneer. Since the September 28, 2020 City Council meeting the Applicant worked with staff to provide Council with real-world examples of the proposed metal material. Below is a picture of the proposed metal material from the Applicant submitted material board. City of Arden Hills City Council Meeting for September 28, 2020 P:\Planning\Planning Cases\2020\20-010 4200 Round Lake Road PP PUD\CC Packets Page 4 of 9 Requested Action 1. Conditional Use Permit A Conditional Use Permit is required for a warehousing use within the GB District. City Code Section 1355.04 Subd. 3 of the Arden Hills Zoning Code lists the criteria for evaluating a Conditional Use Permit. The Planning Commission and City Council should consider the effect of the proposed use upon the health, safety, convenience and general welfare of the owners and occupants of the surrounding land and the community, in general, including but not limited to the following factors and findings: 1.Existing and anticipated traffic and parking conditions; A traffic study was required and was completed by Kimley-Horn and Associates. The proposed trip generation is fairly low based on the Applicants proposed use of an office/warehouse use. The traffic study only had one (1) recommended improvement. The recommendation requests Ramsey County to add five (5) seconds to the signal timing for Round Lake Road and Hwy 96 to allow for more northbound left turns during the PM peak hour. As a condition of approval the Applicant shall work with Ramsey County to add five (5) seconds to the signal timing for Round Lake Road and Hwy 96 to allow for more northbound left turns during the PM peak hour prior to the issuance of a certificate of occupancy. 2. Noise, glare, odors, vibration, smoke, dust, air pollution, heat, liquid or solid waste, and other nuisance characteristics; The proposed use does not conflict with the business functions of the existing businesses and will not pose a significant detrimental risk or nuisance to the health, safety, and general welfare of occupants of surrounding lands. 3. Drainage; City of Arden Hills City Council Meeting for September 28, 2020 P:\Planning\Planning Cases\2020\20-010 4200 Round Lake Road PP PUD\CC Packets Page 5 of 9 The proposed site plan does not negatively impact drainage on adjacent properties and the submitted stormwater onsite meets the quantity and quality standards. 4. Population density; The proposed project does not increase population density. 5. Visual and land use compatibility with uses and structures on surrounding land; The GB district requires materials and colors selected for any individual building shall be compatible with other buildings in the GB District. The Applicant is proposing to use a color palette similar to the existing buildings on Gateway Boulevard. 6. Adjoining land values; The proposed development is not anticipated to negatively impact adjacent property values. 7. Park dedications where applicable; The cash contribution fee shall be seven and a half (7.5) percent of the fair market value of the unimproved land or $230,910.00. The City may require the payment prior to the release of the Final Plat or at a later time under terms agreed upon in the development agreement. Park dedication for Lot 2 will be determined at the time of development. 8. Orderly development of the neighborhood and the City within the general purpose and intent of the Zoning Code and the Comprehensive Development Plan for the City. Planning Case 20-010 for Scannell Properties proposed development at 4200 Round Lake is consistent with the purpose and intent of the R-2 Zoning District and with the policies within the City’s Comprehensive Plan. Suggested Findings of Fact: The Planning Commission reviewed this application at their September 9, 2020, meeting and have offered the following findings of fact for your consideration: 1. The Applicant has submitted an application for a Planned Unit Development, Conditional Use Permit and Preliminary/Final Plat at the Subject Property 4200 Round Lake Road. 2. The Applicant is proposing a 250,000 square foot office and warehouse facility on the Subject Property. 3. The Applicant has submitted a preliminary and final plat to plat two (2) properties. City of Arden Hills City Council Meeting for September 28, 2020 P:\Planning\Planning Cases\2020\20-010 4200 Round Lake Road PP PUD\CC Packets Page 6 of 9 4. Flexibility through the PUD process has been requested in the following areas: district provisions, lot area, lot dimensions, parking setbacks, building height, minimum caliper inches, aesthetics, perennials and shrubberies. 5. The proposed development plan meets or exceeds the minimum requirements of the City Code in the following areas: building setbacks, landscape coverage, parking, planting islands, street trees, tree selection, floor area ratio, drainage wetlands and flood plain tree selection, lighting, screening. 6. Where the plan is not in conformance with the City Code, flexibility has been requested by the Applicant and/or conditions have been placed on an approval that would mitigate the nonconformity. 7. A traffic study has been completed for the proposed use and suggests that Ramsey County to add five (5) seconds to the signal timing for Round Lake Road and Hwy 96 to allow for more northbound left turns during the PM peak hour. 8. Existing public facilities and shall be able to absorb the additional demand for public services needed for the proposed use. 9. The Subject Property is located with the Gateway Business (“GB”) District and is guided as Light Industrial & Office on the 2040 Land Use Plan. 10. The proposed Preliminary Plat and Final Plat are consistent with the Arden Hills Zoning Map and the 2040 Comprehensive Plan. 11. The application is not anticipated to create a negative impact on the immediate area or the community as a whole. Options and Motion Language The Planning Commission reviewed this application at their September 9, 2020 meeting. At that time, they recommended approval of Summit Development’s application for a Site Plan Review, Planned Unit Development, Conditional Use Permit, Preliminary Plat and Final Plat by a 7-0 vote. The following are motion language options for the City Council to consider. A Conditional Use Permit is required for warehousing uses within the Gateway Business District. 1. Approval: Motion to adopt Resolution 2020-045, approving the Conditional Use for Planning Case 20-010 at 4200 Round Lake Road, based on the findings of fact and the submitted materials. 2. Denial: Motion to deny Resolution 2020-045, for a Conditional Use for Planning Case 20-010 at 4200 Round Lake Road, based on the following findings of fact: findings to deny should specifically reference the reasons for denial and why those reasons cannot be mitigated. 3. Table: Motion to table Resolution 2020-045, for a Conditional Use for Planning Case 20-010 at 4200 Round Lake Road for the following reasons: a specific reason and/or information request should be included with a motion to table. Planned Unit Development, Site Plan, Preliminary and Final Plat 1. Recommend Approval with Conditions: Motion to recommend approval of Planning Case 20- 010 for a Planned Unit Development, Site Plan Review, Preliminary and Final Plat at 4200 Round Lake Road, based on the findings of fact and submitted plans, subject to the following conditions: City of Arden Hills City Council Meeting for September 28, 2020 P:\Planning\Planning Cases\2020\20-010 4200 Round Lake Road PP PUD\CC Packets Page 7 of 9 1. The project shall be completed in accordance with the plans submitted and as amended by the conditions of approval. Any significant changes to the plans, as determined by the City Planner, shall require review and approval by the City Council. 2. The Preliminary Plat approval shall expire six months from the date of the City Council approval unless the Final Plat has recorded with Ramsey County or a time extension granted by the City Council. 3. The Applicant shall record the Final Plat with Ramsey County and a copy shall be provided to the City within sixty (90) days of the City’s approval. 4. The Applicant shall be financially responsible for all applicable water and sanitary charges. Rates applied shall be those in effect at the time of Final Plat approval and shall be memorialized in the Development Agreement. 5. A Development Agreement shall be prepared by the City Attorney and subject to City Council approval. The Development Agreement shall be fully executed prior to release of a building permit. 6. The Applicant shall submit a park dedication fee that shall be seven and a half (7.5) percent of the fair market value of the unimproved land and subject to the approval of the City Council. The park dedication fee shall be submitted prior to the release of the Final Plat. 7. Survey monuments shall be placed and installed at all block corners, angle points, points of curves in streets, and at intermediate points as shown on the Final Plat. Pipes or steel rods shall be placed at the corners of each lot. 8. The final plat shall provide dedication of a 60-ft wide right of way for Gateway Boulevard on Lot 2, Block 1 overlying the area currently encumbered by existing drainage and utility easement. 9. Prior to the issuance of a grading and erosion permit, planning staff shall approve in writing the final landscaping plan. 10. Prior to the issuance of a grading and erosion permit, engineering staff shall approve in writing the final location of the loading driveway access to align with adjacent commercial driveway or provide adequate offset distance. 11. A cross easement access and maintenance agreement for the proposed share access on Lot 2 shall be submitted and memorialized in the Development Agreement. 12. Site Plan approval shall be required for the construction of the proof of parking area. 13. All light poles, including base, shall be a maximum of 25 feet in height and shall be shoebox style, downward directed, with high-pressure sodium lamps or LED and flush lenses. Other than wash or architectural lighting, attached security lighting shall be shoebox style, downward directed with flush lenses. If complaints are received the lighting adjacent to residential uses shall utilize house shields as directed by the City. In addition, any lighting under canopies (building entries) shall be recessed and use a flush lens. 14. A right of way permit shall be required for work performed within the City right of way. 15. A grading as-built and utility as-built plan shall be provided to the City upon completion of grading and utility work. 16. No exterior storage shall be permitted. 17. This approval does not include signs. A separate sign permit is required for all proposed signage. All signage shall meet the requirements of Sign District 6. City of Arden Hills City Council Meeting for September 28, 2020 P:\Planning\Planning Cases\2020\20-010 4200 Round Lake Road PP PUD\CC Packets Page 8 of 9 18. Prior to the issuance of a building permit, a landscape financial security of $50,000.00 dollars shall be submitted. Landscape financial security is held for two full growing seasons. 19. All rooftop or ground mounted mechanical equipment shall be hidden from view with the same materials used on the building in accordance with City Code requirements. 20. All fencing and retaining wall materials shall be complementary to the building materials and shall be approved in writing by the Planning Division prior to issuance of a building permit. Retaining walls greater than four (4) feet in height shall be engineered and detailed calculations shall be submitted to the City. 21. Prior to City Council consideration, the Applicant shall submit a materials board to be approved in writing by staff. 22. A Grading and Erosion permit shall be obtained from the City’s Engineering Department prior to commencing any grading, land disturbance or utility activities. The Developer shall be responsible for obtaining any permits necessary from other agencies, including but not limited to, MPCA, Rice Creek Watershed District, and Ramsey County, MNDOT prior to the start of any site activities. 23. The Applicant shall be responsible for protecting the proposed on-site storm sewer infrastructure and components and any existing storm sewer from exposure to any and all stormwater runoff, sediments and debris during all construction activities. Temporary stormwater facilities shall be installed to protect the quality aspect of the proposed and existing stormwater facilities prior to and during construction activities. Maintenance of any and all temporary stormwater facilities shall be the responsibility of the Applicant. 24. Prior to the issuance of the Grading and Erosion permit, the Engineering Department shall review and approve final grading and utility plans in writing. Plans shall be amended to include detail drawings for connection to the sanitary sewer system in Gateway Boulevard, restoration of utility cuts within public streets, and inclusion of City details 3401, 3402, 3408, and 4000. 25. Any future trash enclosures shall utilize wooden gates and be constructed on three sides using the same materials and patterns used on the building. Locations shall be approved by the Planning Department. 26. The Applicant shall provide an executed copy of the City’s standard stormwater maintenance and easement agreement prior to approval of the Development Agreement. 27. All disturbed boulevards shall be restored with sod. 28. All areas of the site, where practical, shall be sodded or seeded and maintained. The property owner shall mow and maintain all site boulevards to the curb line of the public streets. 29. Overnight trailer parking is prohibited onsite other than along the dock wall within the concrete dock apron. 30. The Applicant shall work with Ramsey County to add five (5) seconds to the signal timing for Round Lake Road and Hwy 96 to allow for more northbound left turns during the PM peak hour prior to the issuance of a certificate of occupancy. 31. Warehousing and wholesaling shall not exceed 85 percent of the floor area tenant. The remaining 15 percent of floor area shall be non-warehouse uses such as a combination of uses including-but-not-limited-to office, manufacturing, production, research and development, lab and/or showroom per tenant. City of Arden Hills City Council Meeting for September 28, 2020 P:\Planning\Planning Cases\2020\20-010 4200 Round Lake Road PP PUD\CC Packets Page 9 of 9 2. Recommend Approval without Conditions: Motion to recommend approval of Planning Case 20-010 for a Planned Unit Development, Site Plan Review, Preliminary and Final Plat at 4200 Round Lake Road, based on the findings of fact and submitted plans in the report to the Planning Commission. 3. Recommend Denial: Motion to recommend denial of Planning Case 20-010 for a Planned Unit Development, Site Plan Review, Preliminary and Final Plat at 4200 Round Lake Road based on the following findings of fact: the Planning Commission should identify findings to deny should specifically reference the reasons for denial and why those reasons cannot be mitigated. 4. Table: Motion to table Planning Case 20-010 for a Planned Unit Development, Site Plan Review, Preliminary and Final Plat at 4200 Round Lake Road for the following reasons: the Planning Commission should identify a specific reason and/or information request should be included with a motion to table. Deadline for Agency Actions The City of Arden Hills received the completed application for this request on August 29, 2020. Pursuant to Minnesota State Statute, the City must act on this request by October 28, 2020 (60 days), unless the City provides the Petitioner with written reasons for an additional 60 day review period. The City may, with the consent of the Applicant, extend the review period beyond the initial 120 days. Budget Impact NA Attachments A. Revised Landscaping Plan B. Ramsey County Estimated Tax Value C. Resolution 2020-045 D. PowerPoint Presentation K:\TWC_LDEV\Scannell\Arden Hills, MN\3 Design\CAD\PlanSheets\L1-LANDSCAPE PLAN.DWG October 05, 2020 - 11:59amSHEETNOT FOR CONSTRUCTION71155-200422020 KIMLEY-HORN AND ASSOCIATES, INC.767 EUSTIS STREET, SUITE 100, ST. PAUL, MN 55114RAHRAH/ JH1 CITY SUBMITTAL 5/1/20202 CITY SUBMITTAL 7/20/20203 WATERSHED UPDATE 7/24/20204 WATERSHED UPDATE 8/21/20205 LANDSCAPE UPDATE 10/02/2020MINIMUM LANDSCAPE LOT AREA REQUIRED: 339,674 SF970,496 SF LOT AREA *0.35MINIMUM LANDSCAPE LOT AREA PROVIDED: 652,668 SFTREE RATIO (BUILDING STORIES: 2)SIZE: 6-7' HT 8-10' HT 11-14' HT(2.5-3") (3.5-4") (4.5-6")REQUIRED: 50% 30% 20%PROPOSED: 50% 30% 20%LANDSCAPE REQUIREMENTSSTREET TREES REQUIRED - GATEWAY BLVD: 30 TREES1484 LF / 50 =STREET TREES PROVIDED - GATEWAY BLVD: 71 TREESPERENNIALS/SHRUBS REQUIRED: 65,266 SF652,668 SF LANDSCAPE AREA * 0.1 =PERENNIAL/SHRUBS PROVIDED: 2,888 SFREQUIRED PLANTING ISLANDS: 11,177 SF111,769 SF PARKING AREA *0.1PROVIDED PLANTING ISLANDS: 6,178 SF(MINIMUM 150 SF)REQUIRED PLANTING ISLAND TREES: 33 TREES33 PLANTING ISLANDS x 1 TREEPROVIDED PLANTING ISLANDS: 34 TREESDIVERSE SELECTION REQUIRED: FULL COMPLIMENT OF OVERSTORY,ORNAMENTAL, AND EVERGREEN TREES, SHRUBBERY, AND GROUNDCOVERS PROVIDING YEAR-ROUND COLOR AND INTERESTDIVERSE SELECTION PROVIDED: FULL COMPLIMENT OF OVERSTORY,ORNAMENTAL, AND EVERGREEN TREES, SHRUBBERY, AND GROUNDCOVERS PROVIDING YEAR-ROUND COLOR AND INTERESTSCREENING REQUIRED - LOAD SERVICE: MAY INCLUDE A COMBINATIONOF THE FOLLOWING - BERMS, SHRUBS TREES AT A HEIGHT AND DEPTHCONSISTENT WITH THE HEIGHT AND SIZE OF THE AREA TO BE SCREENED.NATURAL MATERIALS TO ACHIEVE 60% OPACITY YEAR ROUND ATMATURITY.SCREENING PROVIDED- LOAD SERVICE: A COMBINATION OF BERMS,SHRUBS TREES AT A HEIGHT AND DEPTH CONSISTENT WITH THE HEIGHTAND SIZE OF THE AREA TO BE SCREENED. PLANT MATERIALS TO ACHIEVE60% OPACITY YEAR ROUND AT MATURITY.MINIMUM CALIPER INCHES REQUIRED: 1,561 IN.499,552 BUILDING GROSS SQUARE FOOTAGE / 320*MINIMUM CALIPER INCHES PROVIDED: 410 IN.*A SINGLE STORY BUILDING IN EXCESS OF THIRTY (30) FEET IN HEIGHTSHALL BE CONSIDERED A TWO-STORY BUILDING FOR THE PURPOSESOF DETERMINING GROSS SQUARE FOOTAGE.NORTH55555 K:\TWC_LDEV\Scannell\Arden Hills, MN\3 Design\CAD\PlanSheets\L1-LANDSCAPE PLAN.DWG October 05, 2020 - 11:56amSHEETNOT FOR CONSTRUCTION71155-200422020 KIMLEY-HORN AND ASSOCIATES, INC.767 EUSTIS STREET, SUITE 100, ST. PAUL, MN 55114RAHRAH/ JH1 CITY SUBMITTAL 5/1/20202 CITY SUBMITTAL 7/20/20203 WATERSHED UPDATE 7/24/20204 WATERSHED UPDATE 8/21/20205 LANDSCAPE UPDATE 10/02/2020DOUBLE SHREDDED HARDWOOD MULCHNOTES:2X ROOT BALL WIDTHSOD4" TOPSOILPREPARED PLANTING BED ANDBACKFILL SOIL(THOROUGHLY LOOSENED)NOTES:1. SCARIFY SIDES AND BOTTOM OF HOLE.2. PROCEED WITH CORRECTIVE PRUNING OF TOP AND ROOT.3. REMOVE CONTAINER AND SCORE OUTSIDE OF SOIL MASS TO REDIRECTAND PREVENT CIRCLING FIBROUS ROOTS. REMOVE OR CORRECT STEMGIRDLING ROOTS.4. PLUMB AND BACKFILL WITH PLANTING SOIL.5. WATER THOROUGHLY WITHIN 2 HOURS TO SETTLE PLANTS AND FILLVOIDS.6. BACK FILL VOIDS AND WATER SECOND TIME.7. PLACE MULCH WITHIN 48 HOURS OF THE SECOND WATERING UNLESSSOIL MOISTURE IS EXCESSIVE.8. MIX IN 3-4" OF ORGANIC COMPOST.1. SCARIFY SIDES AND BOTTOM OF HOLE.2. PROCEED WITH CORRECTIVE PRUNING.3. SET PLANT ON UNDISTURBED NATIVE SOIL ORTHOROUGHLY COMPACTED PLANTING SOIL.INSTALL PLANT SO THE ROOT FLARE IS AT OR UPTO 2" ABOVE THE FINISHED GRADE WITH BURLAPAND WIRE BASKET, (IF USED), INTACT.4. SLIT REMAINING TREATED BURLAP AT 6"INTERVALS.5. BACKFILL TO WITHIN APPROXIMATELY 12" OF THETOP OF THE ROOTBALL, THEN WATER PLANT.REMOVE THE TOP 1/3 OF THE BASKET OR THE TOPTWO HORIZONTAL RINGS WHICHEVER ISGREATER. REMOVE ALL BURLAP AND NAILS FROMTHE TOP 1/3 OF THE BALL. REMOVE ALL TWINE.REMOVE OR CORRECT STEM GIRDLING ROOTS.6. PLUMB AND BACKFILL WITH PLANTING SOIL.7. WATER THOROUGHLY WITHIN 2 HOURS TOSETTLE PLANTS AND FILL VOIDS.8. BACK FILL VOIDS AND WATER SECOND TIME.9. PLACE MULCH WITHIN 48 HOURS OF THE SECONDWATERING UNLESS SOIL MOISTURE IS EXCESSIVE.10. FINAL LOCATION OF TREE TO BE APPROVED BYOWNER.PLANTING SOILTREE PLANTING DETAILSCALE: N.T.S.L1041SHRUB / PERENNIAL PLANTING DETAILSCALE: N.T.S.3FINISHED GRADE AT LAWN, 1/2" BELOW TOP OF DIVIDER.LAWN SIDE"BLACK DIAMOND" EDGING BYVALEEY VIEW SPECIALTIES CO.USE 20 FT. LENGTHS. USEKNURLED CONNECTOR AT SPLICES, USE CORNER, TEE, VEE, OR WIDEANBLE CONNECTORS AT ANGLE10" X 7/8" METAL ANCHORSTAKES AT 48" O.C., AND ATCHANGES.EACH END.PLASTIC DIVIDER:FINISHED GRADE ATSHRUBS/ PERENNIALS, 1" BELOW TOPOF DIVIDER.PLANTING BEDPOLY EDGER DETAILSCALE: N.T.S.L1044SPADED EDGE DETAILSCALE: 1-1/2"=1'L1046MULCH AT PLANTING AREASPADED EDGE "V" SHAPED, 4" WIDTH,4" DEPTH, MORE VERTICAL ON LAWNSIDELAWN GRASSFINISHED GRADEBUILDING, EXTERIOR WALLPROVIDE POSITIVE DRAINAGEAWAY FROM BUILDINGSPECIFIED ROCK MULCH1.5' MAINTENANCE STRIPEDGER, AS SPECIFIEDSOIL MIX TO BE MINIMUMOF 4" BELOW EDGING TOPTO ALLOW FOR ADEQUATELIP FOR MULCH.SPECIFIED SOIL MIXFINISH GRADE FOR LAWNMAINTENANCE STRIP DETAILSCALE: 1-1/2"=1'L10454"1"NOTE:1. EXTENDED EXCAVATION AND BACKFILL SOIL TO A POINT DOWNSLOPEEQUAL TO OR LOWER IN ELEVATION THAN THE BOTTOM OF THE HOLEDIRECTLY BENEATH THE PLANT TO INSURE ADEQUATE DRAINAGE INHEAVY SOILS. GRANULAR SOIL MUST BE ADDED AS BACKFILL IN AREASOF POOR DRAINAGE.STEEP SLOPE PLANTINGSCALE: N.T.S.L1042EXISTING GRADECUT AREAPLANT ACCORDING TOPLANTING DETAILSAPPLICABLE AS SHOWNBACKFILL AREA1. CONTRACTOR SHALL CONTACT COMMON GROUND ALLIANCE AT 811 OR CALL811.COM TOVERIFY LOCATIONS OF ALL UNDERGROUND UTILITIES PRIOR TO INSTALLATION OF ANY PLANTSOR LANDSCAPE MATERIAL.2. ACTUAL LOCATION OF PLANT MATERIAL IS SUBJECT TO FIELD AND SITE CONDITIONS.3. NO PLANTING WILL BE INSTALLED UNTIL ALL GRADING AND CONSTRUCTION HAS BEENCOMPLETED IN THE IMMEDIATE AREA.4. ALL SUBSTITUTIONS MUST BE APPROVED BY THE LANDSCAPE ARCHITECT PRIOR TOSUBMISSION OF ANY BID AND/OR QUOTE BY THE LANDSCAPE CONTRACTOR.5. CONTRACTOR SHALL PROVIDE TWO YEAR GUARANTEE OF ALL PLANT MATERIALS. THEGUARANTEE BEGINS ON THE DATE OF THE LANDSCAPE ARCHITECT'S OR OWNER'S WRITTENACCEPTANCE OF THE INITIAL PLANTING. REPLACEMENT PLANT MATERIAL SHALL HAVE A ONEYEAR GUARANTEE COMMENCING UPON PLANTING.6. ALL PLANTS TO BE SPECIMEN GRADE, MINNESOTA-GROWN AND/OR HARDY. SPECIMEN GRADESHALL ADHERE TO, BUT IS NOT LIMITED BY, THE FOLLOWING STANDARDS:ALL PLANTS SHALL BE FREE FROM DISEASE, PESTS, WOUNDS, SCARS, ETC.ALL PLANTS SHALL BE FREE FROM NOTICEABLE GAPS, HOLES, OR DEFORMITIES.ALL PLANTS SHALL BE FREE FROM BROKEN OR DEAD BRANCHES.ALL PLANTS SHALL HAVE HEAVY, HEALTHY BRANCHING AND LEAFING.CONIFEROUS TREES SHALL HAVE AN ESTABLISHED MAIN LEADER AND A HEIGHT TO WIDTHRATIO OF NO LESS THAN 5:3.7. PLANTS TO MEET AMERICAN STANDARD FOR NURSERY STOCK (ANSI Z60.1-2014 OR MOSTCURRENT VERSION) REQUIREMENTS FOR SIZE AND TYPE SPECIFIED.8. PLANTS TO BE INSTALLED AS PER MNLA & ANSI STANDARD PLANTING PRACTICES.9. PLANTS SHALL BE IMMEDIATELY PLANTED UPON ARRIVAL AT SITE. PROPERLY HEEL-INMATERIALS IF NECESSARY; TEMPORARY ONLY.10. PRIOR TO PLANTING, FIELD VERIFY THAT THE ROOT COLLAR/ROOT FLAIR IS LOCATED AT THETOP OF THE BALLED & BURLAP TREE. IF THIS IS NOT THE CASE, SOIL SHALL BE REMOVEDDOWN TO THE ROOT COLLAR/ROOT FLAIR. WHEN THE BALLED & BURLAP TREE IS PLANTED, THEROOT COLLAR/ROOT FLAIR SHALL BE EVEN OR SLIGHTLY ABOVE FINISHED GRADE.11. OPEN TOP OF BURLAP ON BB MATERIALS; REMOVE POT ON POTTED PLANTS; SPLIT AND BREAKAPART PEAT POTS.12. PRUNE PLANTS AS NECESSARY - PER STANDARD NURSERY PRACTICE AND TO CORRECT POORBRANCHING OF EXISTING AND PROPOSED TREES.13. WRAP ALL SMOOTH-BARKED TREES - FASTEN TOP AND BOTTOM. REMOVE BY APRIL 1ST.14. STAKING OF TREES AS REQUIRED; REPOSITION, PLUMB AND STAKE IF NOT PLUMB AFTER ONEYEAR.15. THE NEED FOR SOIL AMENDMENTS SHALL BE DETERMINED UPON SITE SOIL CONDITIONS PRIORTO PLANTING. LANDSCAPE CONTRACTOR SHALL NOTIFY LANDSCAPE ARCHITECT FOR THENEED OF ANY SOIL AMENDMENTS.16. BACKFILL SOIL AND TOPSOIL TO ADHERE TO MN/DOT STANDARD SPECIFICATION 3877 (SELECTTOPSOIL BORROW) AND TO BE EXISTING TOP SOIL FROM SITE FREE OF ROOTS, ROCKS LARGERTHAN ONE INCH, SUBSOIL DEBRIS, AND LARGE WEEDS UNLESS SPECIFIED OTHERWISE.MINIMUM 4" DEPTH TOPSOIL FOR ALL LAWN GRASS AREAS AND 12" DEPTH TOPSOIL FOR TREE,SHRUBS, AND PERENNIALS.17. MULCH TO BE AT ALL TREE, SHRUB, PERENNIAL, AND MAINTENANCE AREAS. TREE AND SHRUBPLANTING BEDS SHALL HAVE 4" DEPTH OF DOUBLE SHREDDED HARDWOOD MULCH. DOUBLESHREDDED HARDWOOD MULCH TO BE USED AROUND ALL PLANTS WITHIN TURF AREAS.PERENNIAL AND ORNAMENTAL GRASS BEDS SHALL HAVE 2" DEPTH DOUBLE SHREDDEDHARDWOOD MULCH. MULCH TO BE FREE OF DELETERIOUS MATERIAL AND COLORED DARKWALNUT, OR APPROVED EQUAL. ROCK MULCH TO BE RIVER ROCK, 1 1/2" TO 3" DIAMETER, ATMINIMUM 3" DEPTH, OR APPROVED EQUAL. ROCK MULCH TO BE ON COMMERCIAL GRADEFILTER FABRIC, BY TYPAR, OR APPROVED EQUAL WITH NO EXPOSURE. MULCH AND FABRIC TOBE APPROVED BY OWNER PRIOR TO INSTALLATION. MULCH TO MATCH EXISTING CONDITIONS(WHERE APPLICABLE).18. EDGING TO BE COMMERCIAL GRADE VALLEY-VIEW BLACK DIAMOND (OR EQUAL) POLY EDGINGOR SPADED EDGE, AS INDICATED. POLY EDGING SHALL BE PLACED WITH SMOOTH CURVES ANDSTAKED WITH METAL SPIKES NO GREATER THAN 4 FOOT ON CENTER WITH BASE OF TOP BEADAT GRADE, FOR MOWERS TO CUT ABOVE WITHOUT DAMAGE. UTILIZE CURBS AND SIDEWALKSFOR EDGING WHERE POSSIBLE. SPADED EDGE TO PROVIDE V-SHAPED DEPTH AND WIDTH TOCREATE SEPARATION BETWEEN MULCH AND GRASS. INDIVIDUAL TREE, SHRUB, ORRAIN-GARDEN BEDS TO BE SPADED EDGE, UNLESS NOTED OTHERWISE. EDGING TO MATCHEXISTING CONDITIONS (WHERE APPLICABLE).19. ALL DISTURBED AREAS TO BE SODDED OR SEEDED, UNLESS OTHERWISE NOTED. SOD TO BESTANDARD MINNESOTA GROWN AND HARDY BLUEGRASS MIX, FREE OF LAWN WEEDS. ALLTOPSOIL AREAS TO BE RAKED TO REMOVE DEBRIS AND ENSURE DRAINAGE. SLOPES OF 3:1 ORGREATER SHALL BE STAKED. SEED AS SPECIFIED AND PER MN/DOT SPECIFICATIONS. IF NOTINDICATED ON LANDSCAPE PLAN, SEE EROSION CONTROL PLAN.20. PROVIDE IRRIGATION TO ALL PLANTED AREAS ON SITE. IRRIGATION SYSTEM TO BEDESIGN/BUILD BY LANDSCAPE CONTRACTOR. LANDSCAPE CONTRACTOR TO PROVIDE SHOPDRAWINGS TO LANDSCAPE ARCHITECT FOR APPROVAL PRIOR TO INSTALLATION OF IRRIGATIONSYSTEM. CONTRACTOR TO PROVIDE OPERATION MANUALS, AS-BUILT PLANS, AND NORMALPROGRAMMING. SYSTEM SHALL BE WINTERIZED AND HAVE SPRING STARTUP DURING FIRSTYEAR OF OPERATION. SYSTEM SHALL HAVE ONE-YEAR WARRANTY ON ALL PARTS AND LABOR.ALL INFORMATION ABOUT INSTALLATION AND SCHEDULING CAN BE OBTAINED FROM THEGENERAL CONTRACTOR.21. CONTRACTOR SHALL PROVIDE NECESSARY WATERING OF PLANT MATERIALS UNTIL THE PLANTIS FULLY ESTABLISHED OR IRRIGATION SYSTEM IS OPERATIONAL. OWNER WILL NOT PROVIDEWATER FOR CONTRACTOR.22. REPAIR, REPLACE, OR PROVIDE SOD/SEED AS REQUIRED FOR ANY ROADWAY BOULEVARDAREAS ADJACENT TO THE SITE DISTURBED DURING CONSTRUCTION.23. REPAIR ALL DAMAGE TO PROPERTY FROM PLANTING OPERATIONS AT NO COST TO OWNER.LANDSCAPE NOTESNOTE: PLANT QUANTITIES SHOWN ARE FOR THE CONVENIENCE OF THE OWNER AND JURISDICTIONAL REVIEW AGENCIES. THE CONTRACTOR IS RESPONSIBLE FOR VERIFYING ALL PLANTQUANTITIES PER PLAN AND FIELD CONDITIONS.5555555555 10/9/2020 Beacon - Ramsey County, MN - Property Tax: 213023310032 https://beacon.schneidercorp.com/application.aspx?app=RamseyCountyMN&PageType=Report&Page=PropertyTax&KeyValue=213023310032 1/3 Pay Property Taxes Parcel ID 213023310032 Parcel Status Active PropertyAddress 4200WestROUNDLAKERD ARDEN HILLS, MN 55112 Sec/Twp/Rng 21/030/023 Brief TaxbDescription Lot 1 Block 1 of TRAVERSE BUSINESS CENTER EXTHATPARTOFLOT1BLK1INT.I.1210 (Note: Not to be usedbon legal documents) Parcel Area 20.80 Acres ParcelbWidth 0 Feet ParcelDepth 0Feet (Note: Width and Depth represent buildable area of lot in the case of irregularly shaped lots) Tax ClassiØcation 3A-Commercial/Industrial/Public Utility Roll Type Real Property Municipality ARDENHILLS School District ISD #621 Watershed RICE CREEK W/S TIF District LandUseCode 400C -COMMERCIALVACANTLAND * The Tax ClassiØcation is the Assessor OfØce’s determination of the use of the property and is not the same as the property’s zoning. * Please contact the zoning authority for information regarding zoning. * To determine whether your property is Abstract or Torrens, call 651-266-2050 *Multi-ParcelLinkdisplaysadditionalparcelsthatarelinkedtogetherforcomputationofnettaxcapacity Pleaserefertodisclaimeratbottomofthispage Type Name Address Owner North American Land Company Llc 1851 Buerkle Rd White Bear Lake MN 55110-5246 First Half Due 05-15-2020 AmountDue $53,200.00 Penaltyb&bFeesb(thrubcurrentbmonth)$0.00 Sub Total $53,200.00 Payments Made ($53,200.00) BalanceDue $0.00 Total Due bbbb$53,200.00 Second Half Due 10-15-2020 AmountDue $53,200.00 Penaltyb&bFeesb(thrubcurrentbmonth)$0.00 Sub Total $53,200.00 Payments Made $0.00 BalanceDue $53,200.00 b bb 2020 Payable 2019 Payable 2018 Payable 2017 Payable 2016 Payable EstimatedMarketValue $3,078,800 $3,078,800 $3,078,800 $3,078,800 $3,078,800 b Taxable Market Value $3,078,800 $3,078,800 $3,078,800 $3,078,800 $3,078,800 b Net Tax Amount $106,400.00 $105,466.00 $108,262.00 $112,616.00 $116,106.00 + SpecialAssessments $0.00 $0.00 $0.00 $0.00 $0.00 =TotalTaxes $106,400.00 $105,466.00 $108,262.00 $112,616.00 $116,106.00 + Penalty $0.00 $0.00 $0.00 $0.00 $0.00 + Interest $0.00 $0.00 $0.00 $0.00 $0.00 + Fees $0.00 $0.00 $0.00 $0.00 $0.00 - AmountPaid $53,200.00 $105,466.00 $108,262.00 $112,616.00 $116,106.00 =OutstandingBalance $53,200.00 $0.00 $0.00 $0.00 $0.00 PayPropertyTax Summary View Multi-Parcel Link 213023340009 Taxpayers Current Tax Year *Information listed is as of yesterday. For speciØc payoff information contact Property Tax Info at 651-266-2000 TaxSummary 10/9/2020 Beacon - Ramsey County, MN - Property Tax: 213023310032 https://beacon.schneidercorp.com/application.aspx?app=RamseyCountyMN&PageType=Report&Page=PropertyTax&KeyValue=213023310032 2/3 Note: + sign indicates a multiple year assessment. Click on the + to view additional years. Note: This property has a deferred special assessment. Contact Property Tax Info for more information: 651-266-2000 b Assess # Year Description Initial Amount Principal Interest Installment Amount Remaining Balance Deferred b S-252014100 2020 ROUND LAKE ROAD AREA IMPROVEMENT bbb b bYes b Note: Installment amount is the amount that will be included in the property tax total for the referenced payable year. Remaining Balance is the amount eligible for prepayment. Prepayment must be paid in full by November 15th of the current year. Please call the City of Saint Paul General Assessment line for payoff amounts or additional information concerning any Saint Paul assessment. You can reach them at 651-266- 8858 or go to Assessment Lookup. Suburban property owners should call 651-266-2000 for detailed assessment information. Tax Year Business Date Effective Date Transaction Type Tax Amount Special Assessment Penalty Interest Fees Overpayment Total 2020 5/14/2020 5/14/2020 Payment ($53,200.00) $0.00 $0.00 $0.00 $0.00 $0.00 ($53,200.00) 2020 2/23/2020 b Original Charge $106,400.00 $0.00 $0.00 $0.00 $0.00 $0.00 $106,400.00 2019 10/12/2019 10/12/2019 Payment ($52,733.00) $0.00 $0.00 $0.00 $0.00 $0.00 ($52,733.00) 2019 5/16/2019 5/15/2019 Payment ($52,733.00) $0.00 $0.00 $0.00 $0.00 $0.00 ($52,733.00) 2019 2/28/2019 b Original Charge $105,466.00 $0.00 $0.00 $0.00 $0.00 $0.00 $105,466.00 2018 10/16/2018 10/15/2018 Payment ($54,131.00) $0.00 $0.00 $0.00 $0.00 $0.00 ($54,131.00) 2018 5/14/2018 5/14/2018 Payment ($1,230.00) $0.00 $0.00 $0.00 $0.00 $0.00 ($1,230.00) 2018 3/5/2018 12/30/2017 Apply Advance ($52,901.00) $0.00 $0.00 $0.00 $0.00 $52,901.00 $0.00 2018 2/28/2018 b Original Charge $108,262.00 $0.00 $0.00 $0.00 $0.00 $0.00 $108,262.00 2018 1/3/2018 12/30/2017 Payment $0.00 $0.00 $0.00 $0.00 $0.00 ($52,901.00) ($52,901.00) Date eCRV # Sale Price State Study Recommendation State Study Reject Reason Cnty Stdy Rec 10/2/2014 269744 $4,125,000 Y b Y Pay Property Taxes 2020 Value Notice Tax Statement Payment Stubs Proposed Tax Statement 2019 Value Notice Tax Statement Payment Stubs Proposed Tax Statement 2018 Value Notice Tax Statement Payment Stubs Proposed Tax Statement 2017 Value Notice Tax Statement Payment Stubs Proposed Tax Statement 2016 Value Notice Tax Statement The Property Tax Refund Program is administered by the State of Minnesota. For information regarding the program, please call 651-296-3781 or visit the website here Form M1PR(Property Tax Refund) Special Assessments Tax Transaction History Sales Pay Property Tax Statements and Notices State of Minnesota 10/9/2020 Beacon - Ramsey County, MN - Property Tax: 213023310032 https://beacon.schneidercorp.com/application.aspx?app=RamseyCountyMN&PageType=Report&Page=PropertyTax&KeyValue=213023310032 3/3 No data available for the following modules: Delinquent Taxes, Service Company and Lender, Photos. Version 2.3.90 Theinformationinthiswebsiterepresentscurrentdatafromaworking Ølewhichisupdateddaily(seeLastDataUploadatbottomofpage for the timing of the last update). Information is believed reliable, but its accuracy cannot be guaranteed. No warranty, expressed or implied, is provided for the data herein, or its use. User Privacy Policy GDPRPrivacyNotice Last Data Upload: 10/9/2020, 6:05:06 AM Developedby 1 CITY OF ARDEN HILLS COUNTY OF RAMSEY STATE OF MINNESOTA RESOLUTION NO. 2020-045 RESOLUTION APPROVING A CONDITIONAL USE PERMIT FOR THE SUBJECT PROPERTY AT 4200 ROUND LAKE ROAD WHEREAS, City Staff received a land use application for 4200 Round Lake Road (“Subject Property”) for a Conditional Use Permit request on May 1, 2020; WHEREAS, the Subject Property is located in the GB, Gateway Business District and is guided as Light Industrial & Office on the Land Use Plan; WHEREAS, the Applicant has requested a Conditional Use Permit in order to operate a warehouse use; WHEREAS, the City’s obligation has been met where the Arden Hills Planning Commission duly held a public hearing on September 9th, 2020. All persons present at said meeting were given an opportunity to be heard and present written statements; WHEREAS the Planning Commission considered the recommendation of the City Staff that this request be approved and, as such voted 7-0 in favor of the request; and, NOW, THEREFORE, BE IT RESOLVED THAT THE CITY COUNCIL OF THE CITY OF ARDEN HILLS: Hereby adopts Resolution 2020-045 approving Planning Case 20-010 for a Conditional Use Permit request at the Subject Property 4200 Round Lake Road to operate a warehouse use based on the findings of fact and the submitted plans in the July 27th, 2020 Report to the City Council, as amended by the following conditions: 1. The project shall be completed in accordance with the plans submitted and as amended by the conditions of approval. Any significant changes to the plans, as determined by the City Planner, shall require review and approval by the City Council. 2. The Preliminary Plat approval shall expire six months from the date of the City Council approval unless the Final Plat has recorded with Ramsey County or a time extension granted by the City Council. 3. The Applicant shall record the Final Plat with Ramsey County and a copy shall be provided to the City within sixty (90) days of the City’s approval. 2 4. The Applicant shall be financially responsible for all applicable water and sanitary charges. Rates applied shall be those in effect at the time of Final Plat approval and shall be memorialized in the Development Agreement. 5. A Development Agreement shall be prepared by the City Attorney and subject to City Council approval. The Development Agreement shall be fully executed prior to release of a building permit. 6. The Applicant shall submit a park dedication fee that shall be seven and a half (7.5) percent of the fair market value of the unimproved land and subject to the approval of the City Council. The park dedication fee shall be submitted prior to the release of the Final Plat. 7. Survey monuments shall be placed and installed at all block corners, angle points, points of curves in streets, and at intermediate points as shown on the Final Plat. Pipes or steel rods shall be placed at the corners of each lot. 8. The final plat shall provide dedication of a 60-ft wide right of way for Gateway Boulevard on Lot 2, Block 1 overlying the area currently encumbered by existing drainage and utility easement. 9. Prior to the issuance of a grading and erosion permit, planning staff shall approve in writing the final landscaping plan. 10. Prior to the issuance of a grading and erosion permit, engineering staff shall approve in writing the final location of the loading driveway access to align with adjacent commercial driveway or provide adequate offset distance. 11. A cross easement access and maintenance agreement for the proposed share access on Lot 2 shall be submitted and memorialized in the Development Agreement. 12. Site Plan approval shall be required for the construction of the proof of parking area. 13. All light poles, including base, shall be a maximum of 25 feet in height and shall be shoebox style, downward directed, with high-pressure sodium lamps or LED and flush lenses. Other than wash or architectural lighting, attached security lighting shall be shoebox style, downward directed with flush lenses. If complaints are received the lighting adjacent to residential uses shall utilize house shields as directed by the City. In addition, any lighting under canopies (building entries) shall be recessed and use a flush lens. 14. A right of way permit shall be required for work performed within the City right of way. 15. A grading as-built and utility as-built plan shall be provided to the City upon completion of grading and utility work. 16. No exterior storage shall be permitted. 17. This approval does not include signs. A separate sign permit is required for all proposed signage. All signage shall meet the requirements of Sign District 6. 18. Prior to the issuance of a building permit, a landscape financial security of $50,000.00 dollars shall be submitted. Landscape financial security is held for two full growing seasons. 19. All rooftop or ground mounted mechanical equipment shall be hidden from view with the same materials used on the building in accordance with City Code requirements. 20. All fencing and retaining wall materials shall be complementary to the building materials and shall be approved in writing by the Planning Division prior to issuance 3 of a building permit. Retaining walls greater than four (4) feet in height shall be engineered and detailed calculations shall be submitted to the City. 21. Prior to City Council consideration, the Applicant shall submit a materials board to be approved in writing by staff. 22. A Grading and Erosion permit shall be obtained from the City’s Engineering Department prior to commencing any grading, land disturbance or utility activities. The Developer shall be responsible for obtaining any permits necessary from other agencies, including but not limited to, MPCA, Rice Creek Watershed District, and Ramsey County, MNDOT prior to the start of any site activities. 23. The Applicant shall be responsible for protecting the proposed on-site storm sewer infrastructure and components and any existing storm sewer from exposure to any and all stormwater runoff, sediments and debris during all construction activities. Temporary stormwater facilities shall be installed to protect the quality aspect of the proposed and existing stormwater facilities prior to and during construction activities. Maintenance of any and all temporary stormwater facilities shall be the responsibility of the Applicant. 24. Prior to the issuance of the Grading and Erosion permit, the Engineering Department shall review and approve final grading and utility plans in writing. Plans shall be amended to include detail drawings for connection to the sanitary sewer system in Gateway Boulevard, restoration of utility cuts within public streets, and inclusion of City details 3401, 3402, 3408, and 4000. 25. Any future trash enclosures shall utilize wooden gates and be constructed on three sides using the same materials and patterns used on the building. Locations shall be approved by the Planning Department. 26. The Applicant shall provide an executed copy of the City’s standard stormwater maintenance and easement agreement prior to approval of the Development Agreement. 27. All disturbed boulevards shall be restored with sod. 28. All areas of the site, where practical, shall be sodded or seeded and maintained. The property owner shall mow and maintain all site boulevards to the curb line of the public streets. 29. Overnight trailer parking is prohibited onsite other than along the dock wall within the concrete dock apron. 30. The Applicant shall work with Ramsey County to add five (5) seconds to the signal timing for Round Lake Road and Hwy 96 to allow for more northbound left turns during the PM peak hour prior to the issuance of a certificate of occupancy. 31. Warehousing and wholesaling shall not exceed 85 percent of the floor area tenant. The remaining 15 percent of floor area shall be non-warehouse uses such as a combination of uses including-but-not-limited-to office, manufacturing, production, research and development, lab and/or showroom per tenant. PASSED AND ADOPTED BY THE CITY COUNCIL OF THE CITY OF ARDEN HILLS THIS 28th DAY OF SEPTEMBER, 2020. ________________________________ Mayor 4 Attest: ______________________________ City Clerk Planning Case # 20-010 – Public Hearing RequiredApplicant: Scannell PropertiesProperty Location: 4200 Round Lake Road Request: Master Planned Unit Development, Conditional Use Permit, Site Plan and Preliminary/Final PlatPark Dedication: Cash contributions Zoning: GB, Gateway Business District Land Use: Light Industrial & Office Lot Size: 26.08 Acres Use - District Provisions 1320.13: OU8acSite Impacts Screening and Trees:Minimum Caliper InchesCalculationsTwo-story building for the purposes of determining gross square footage499,552 GSFMinimum caliper inches required1,561 Cal In. or 6242” treesProposed caliper inches 410 Cal In or 210 treesSingle story building under 30 feet for the purposes of determining gross square footage250,000 GSFMinimum caliper inches required 781.25 Cal In. or 391 2” trees Aesthetics: Suggested Findings ofFact:Staff offers the following findings of fact for consideration:1. The Applicant has submitted an application for a Planned Unit Development, Conditional Use Permit and Preliminary/Final Plat atthe Subject Property 4200 Round LakeRoad.2. TheApplicant is proposing a 250,000 square foot office and warehouse facility on the SubjectProperty.3. TheApplicant has submitted a preliminary and final plat to plat two (2)properties.4. Flexibility through the PUD process has been requested in the following areas: district provisions, lot area, lot dimensions, parkingsetbacks, building height, minimum caliper inches, aesthetics, perennials andshrubberies.5. The proposed development plan meets or exceeds the minimum requirements of the City Code in the following areas: buildingsetbacks, landscape coverage, parking, planting islands, street trees, tree selection, floor area ratio, drainage wetlands and flood plaintree selection, lighting, screening.6. Where the plan is not in conformance with the City Code, flexibility has been requested by the Applicant and/or conditions havebeen placed on an approval that would mitigate the nonconformity.7. Atraffic study has been completed for the proposed use and suggeststhat Ramsey County to add five (5) seconds to the signal timingfor Round Lake Road and Hwy 96 to allow for more northboundleft turns during the PM peakhour.8. Existing public facilities and shall be able to absorb the additional demand for public services needed for the proposeduse.9. The Subject Property is located with the Gateway Business (“GB”) District and is guided as Light Industrial & Office on the 2040Land Use Plan.10. The proposed Preliminary Plat and Final Plat are consistent with theArden Hills Zoning Map and the 2040 ComprehensivePlan.11. The application is not anticipated to create a negative impact on the immediate area or the community as awhole. Motion OptionsCUP:1. Approval:Motion to adopt Resolution 2020-045, approving the Conditional Use for Planning Case 20-010 at 4200 Round LakeRoad, based on the findings of fact and the submittedmaterials.2. Denial: Motion to deny Resolution 2020-045, for a Conditional Usefor Planning Case 20-010 at 4200 Round Lake Road, based on thefollowing findings of fact:findings to deny should specificallyreference the reasons for denial and why those reasons cannot bemitigated.3. Table: Motion to table Resolution 2020-045, for a Conditional Usefor Planning Case 20-010 at 4200 Round Lake Road for the followingreasons:a specific reason and/or information request should beincluded with a motion totable. Motion Options Planned Unit Development, Site PlanReview, Preliminary and FinalPlat:•Recommend Approval with Conditions:Motion to recommend approvalofPlanningCase 20-010 for a Planned Unit Development, SitePlan Review, PreliminaryandFinal Plat at 4200 Round Lake Road, based on the findings of fact andsubmitted plans, subject to the 31 Conditions ofapproval.•Recommend Approval without Conditions: Motion to recommend approvalofPlanning Case 20-010 for a Planned Unit Development, Site PlanReview,Preliminary and Final Plat at 4200 Round Lake Road, based on the findings offactand submitted plans in the report to the PlanningCommission.•RecommendDenial: Motion to recommend denialof Planning Case 20-010 foraPlanned Unit Development, SitePlan Review, Preliminary and Final Plat at4200Round Lake Road based on the following findings of fact: the PlanningCommissionshould identify findings to deny should specifically reference the reasons for denialand why those reasons cannot be mitigated.•Table:Motion to tablePlanning Case 20-010 for a Planned Unit Development,SitePlan Review, Preliminary and Final Plat at 4200 Round Lake Road for thefollowingreasons: the Planning Commission should identify a specific reason and/orinformation request should be included with a motion to table. 1. The project shall be completed in accordance with the plans submitted and as amendedby theconditions of approval. Any significant changes to the plans, as determined by the City Planner,shall require review and approval by the CityCouncil.2. The Preliminary Plat approval shall expire six months from the date of the City Council approvalunless the Final Plat has recorded with Ramsey County or a time extension granted by the CityCouncil.3. The Applicant shall record the Final Plat with Ramsey County and a copy shall be provided to theCity within sixty (90) days of the City’s approval.4. The Applicant shall be financially responsible for all applicable water and sanitary charges. Ratesapplied shall be those in effect at the time of Final Plat approval and shall be memorialized in theDevelopmentAgreement.5. A Development Agreement shall be prepared by the City Attorney and subject to City Councilapproval. The Development Agreement shall be fully executed prior to release of a buildingpermit.6. The Applicant shall submit a park dedication fee that shall be seven and a half (7.5) percent of thefair market value of the unimproved land and subject to the approval of the City Council. The parkdedication fee shall be submitted prior to the release of the FinalPlat.7. Survey monuments shall be placed and installed at all block corners, anglepoints, points of curvesin streets, and at intermediate points as shown on the Final Plat. Pipes or steel rods shall be placedat the corners of each lot.8. The final plat shall provide dedication of a 60-ft wide right of way for Gateway Boulevard on Lot2, Block 1 overlying the area currently encumbered by existing drainage and utility easement.9. Prior to the issuance of a grading and erosion permit, planning staff shall approve in writing thefinal landscapingplan.10.Prior to the issuance of a grading and erosion permit, engineering staff shall approve in writing thefinal location of the loading driveway access to align with adjacent commercial driveway orprovide adequate offsetdistance.Conditions ofApproval 11. Across easement access and maintenance agreement for the proposed share access on Lot 2shall be submitted and memorialized in the Development Agreement.12.Site Plan approval shall be required for the construction of the proof of parking area.13.All light poles, including base, shall be a maximum of 25 feet in height and shall be shoeboxstyle, downward directed, with high-pressure sodium lamps or LED and flush lenses. Otherthan wash or architectural lighting, attached security lighting shall be shoebox style,downward directed with flush lenses. If complaints are received the lighting adjacent toresidential uses shall utilize house shields as directed by the City. In addition, any lightingunder canopies (building entries) shall be recessed and use a flush lens.14.A right of way permit shall be required for work performed within the City right of way.15.A grading as-built and utility as-built plan shall be provided to the City upon completion of grading and utility work.16.No exterior storage shall be permitted.17.This approval does not include signs. A separate sign permit is required for all proposed signage. All signage shall meet the requirements of Sign District 6.18.Prior to the issuance of a building permit, a landscape financial security of $50,000.00 dollarsshall be submitted. Landscape financial security is held for two full growing seasons.19.All rooftop or ground mounted mechanical equipment shall be hidden from view with thesame materials used on the building in accordance with City Code requirements.20.All fencing and retaining wall materials shall be complementary to the building materials andshall be approved in writing by the Planning Division prior to issuance of a building permit.Retaining walls greater than four (4) feet in height shall be engineered and detailedcalculations shall be submitted to the City. 21. Prior to City Council consideration, the Applicant shall submit a materials board to be approved in writingbystaff.22.A Grading and Erosion permit shall be obtained from the City’s Engineering Department prior to commencingany grading, land disturbance or utility activities. The Developer shall be responsible for obtaining any permitsnecessary from other agencies, including but not limited to, MPCA, Rice Creek Watershed District,andRamsey County, MNDOT prior to the start of any site activities.23.The Applicant shall be responsible for protecting the proposed on-site storm sewer infrastructure andcomponents and any existing storm sewer from exposure to any and all stormwater runoff, sediments anddebris during all construction activities. Temporary stormwater facilities shall be installed to protectthequality aspect of the proposed and existing stormwater facilities prior to and during construction activities.Maintenance of any and all temporary stormwater facilities shall be the responsibility of theApplicant.24.Prior to the issuance of the Grading and Erosion permit, the Engineering Department shall review and approvefinal grading and utility plans in writing. Plans shall be amended to include detail drawings for connection tothe sanitary sewer system in Gateway Boulevard, restoration of utility cuts within public streets, and inclusionof City details 3401, 3402, 3408, and4000.25.Any future trash enclosures shall utilize wooden gates and be constructed on three sides using the samematerials and patterns used on the building. Locations shall be approved by the Planning Department.26.The Applicant shall provide an executed copy of the City’s standard stormwater maintenance and easementagreement prior to approval of the Development Agreement.27.All disturbed boulevards shall be restored with sod.28.All areas of the site, where practical, shall be sodded or seeded and maintained. The property owner shallmow and maintain all site boulevards to the curb line of the public streets.29.Overnight trailer parking is prohibited onsite other than along the dock wall within the concrete dock apron.30.The Applicant shall work with Ramsey County to add five (5) seconds to the signal timing for Round LakeRoad and Hwy 96 to allow for more northbound left turns during the PM peak hour prior to the issuance of acertificate ofoccupancy.31.Warehousing and wholesaling shall not exceed 85 percent of the floor area tenant. The remaining 15 percent offloor area shall be non-warehouse uses such as a combination of uses including-but-not-limited-to office,manufacturing, production, research and development, lab and/or showroom per tenant.