The URL can be used to link to this page

Home My WebLink About08-09-21-RAPPROVAL OF AGENDA PUBLIC INQUIRIES/INFORMATIONAL This is an opportunity for citizens to bring to the Council ’s attention any items not currently on the agenda which are relevant to the City. In addressing the Council, you must first state your name and address for the record. To allow adequate time for each person wishing to address the Council, speakers must limit their comments to three (3) minutes. Written documents may be distributed to the Council prior to the meeting to allow a more timely presentation. Speakers should not use obscene, profane, or threatening language, or make personal attacks. Matters of litigation involving the City shall not be discussed during Public Inquiry by citizens or Council. The Council may not respond to speaker comments, engage in a debate, or take any action on the issues raised by citizens, but may direct City staff to research or follow up on an issue, if desired by Council. If Council directs further review by staff, the results of that review will be presented at a following regular Council meeting. RESPONSE TO PUBLIC INQUIRIES PUBLIC PRESENTATIONS Twin Cities Gateway Visitors Bureau Presentation Allen Stauffacher, Twin Cities Gateway Visitors Bureau MEMO.PDF ATTACHMENT A.PDF STAFF COMMENTS Transportation Update David Swearingen, Interim Public Works Director MEMO.PDF APPROVAL OF MINUTES July 12, 2021 Special City Council Work Session 07 -12 -21 -SWS.PDF July 12, 2021 Regular City Council 07 -12 -21 -R.PDF CONSENT CALENDAR Those items listed under the Consent Calendar are considered to be routine by the City Council and will be enacted by one motion under a Consent Calendar format. There will be no separate discussion of these items, unless a Councilmember so requests, in which event, the item will be removed from the general order of business and considered separately in its normal sequence on the agenda. Motion To Approve Claims And Payroll Gayle Bauman, Finance Director MEMO.PDF Motion To Approve Amendment To Urban Requalification Joint Cooperation Agreement Dave Perrault, City Administrator MEMO.PDF ATTACHMENT A.PDF Motion To Approve New Tobacco License –Cub Discount Liquor, 3715 Lexington Avenue N Julie Hanson, City Clerk MEMO.PDF Motion To Adopt Resolution 2021 -043 Approving Charitable Gambling License For Spring Lake Park Lions At Welsch ’s Big Ten Tavern Julie Hanson, City Clerk MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF ATTACHMENT C.PDF Motion To Approve Change Order No. 8 And Final Payment –Northwest Asphalt, Inc. –2018 Street And Utility Improvements Project David Swearingen, Interim Public Works Director MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF ATTACHMENT C.PDF Motion To Approve Payment No. 1 –Pember Companies –2021 Concrete Improvements Project David Swearingen, Interim Public Works Director MEMO.PDF ATTACHMENT A.PDF Motion To Approve Resolution 2021 -044 Receiving Feasibility Report And Calling For Public Hearing On Improvements –Lexington Avenue Reconstruction Project (Traffic Signal At Target Road) David Swearingen, Interim Public Works Director MEMO.PDF WEBSITE ATTACHMENT A.PDF ATTACHMENT B.PDF ATTACHMENT C.PDF Motion To Approve Payment No. 2 –C&L Excavating, Inc. –2021 PMP Street And Utility Improvements Project David Swearingen, Interim Public Works Director MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF PULLED CONSENT ITEMS Those items that are pulled from the Consent Calendar will be removed from the general order of business and considered separately in its normal sequence on the agenda. PUBLIC HEARINGS NEW BUSINESS UNFINISHED BUSINESS COUNCIL/STAFF COMMENTS ADJOURN Mayor: David Grant Councilmembers: Brenda Holden Fran Holmes Dave McClung Steve Scott Regular City Council Agenda August 9, 2021 7:00 p.m. City Hall Address: 1245 W Highway 96 Arden Hills MN 55112 Phone: 651 -792 -7800 Website : www.cityofardenhills.org City Vision Arden Hills is a strong community that values its unique environmental setting, strong residential neighborhoods, vital business community, well -maintained infrastructure, fiscal soundness, and our long -standing tradition as a desirable City in which to live, work, and play. This meeting will be streamed live on local Cable Channel 16 and available for playback on our website. CALL TO ORDER 1. 2. 3. 4. 4.A. Documents: 5. 5.A. Documents: 6. 6.A. Documents: 6.B. Documents: 7. 7.A. Documents: 7.B. Documents: 7.C. Documents: 7.D. Documents: 7.E. Documents: 7.F. Documents: 7.G. Documents: 7.H. Documents: 8. 9. 10. 11. 12. APPROVAL OF AGENDAPUBLIC INQUIRIES/INFORMATIONALThis is an opportunity for citizens to bring to the Council ’s attention any items not currently on the agenda which are relevant to the City. In addressing the Council, you must first state your name and address for the record. To allow adequate time for each person wishing to address the Council, speakers must limit their comments to three (3) minutes. Written documents may be distributed to the Council prior to the meeting to allow a more timely presentation. Speakers should not use obscene, profane, or threatening language, or make personal attacks. Matters of litigation involving the City shall not be discussed during Public Inquiry by citizens or Council. The Council may not respond to speaker comments, engage in a debate, or take any action on the issues raised by citizens, but may direct City staff to research or follow up on an issue, if desired by Council. If Council directs further review by staff, the results of that review will be presented at a following regular Council meeting.RESPONSE TO PUBLIC INQUIRIESPUBLIC PRESENTATIONSTwin Cities Gateway Visitors Bureau Presentation Allen Stauffacher, Twin Cities Gateway Visitors BureauMEMO.PDF ATTACHMENT A.PDF STAFF COMMENTS Transportation Update David Swearingen, Interim Public Works Director MEMO.PDF APPROVAL OF MINUTES July 12, 2021 Special City Council Work Session 07 -12 -21 -SWS.PDF July 12, 2021 Regular City Council 07 -12 -21 -R.PDF CONSENT CALENDAR Those items listed under the Consent Calendar are considered to be routine by the City Council and will be enacted by one motion under a Consent Calendar format. There will be no separate discussion of these items, unless a Councilmember so requests, in which event, the item will be removed from the general order of business and considered separately in its normal sequence on the agenda. Motion To Approve Claims And Payroll Gayle Bauman, Finance Director MEMO.PDF Motion To Approve Amendment To Urban Requalification Joint Cooperation Agreement Dave Perrault, City Administrator MEMO.PDF ATTACHMENT A.PDF Motion To Approve New Tobacco License –Cub Discount Liquor, 3715 Lexington Avenue N Julie Hanson, City Clerk MEMO.PDF Motion To Adopt Resolution 2021 -043 Approving Charitable Gambling License For Spring Lake Park Lions At Welsch ’s Big Ten Tavern Julie Hanson, City Clerk MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF ATTACHMENT C.PDF Motion To Approve Change Order No. 8 And Final Payment –Northwest Asphalt, Inc. –2018 Street And Utility Improvements Project David Swearingen, Interim Public Works Director MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF ATTACHMENT C.PDF Motion To Approve Payment No. 1 –Pember Companies –2021 Concrete Improvements Project David Swearingen, Interim Public Works Director MEMO.PDF ATTACHMENT A.PDF Motion To Approve Resolution 2021 -044 Receiving Feasibility Report And Calling For Public Hearing On Improvements –Lexington Avenue Reconstruction Project (Traffic Signal At Target Road) David Swearingen, Interim Public Works Director MEMO.PDF WEBSITE ATTACHMENT A.PDF ATTACHMENT B.PDF ATTACHMENT C.PDF Motion To Approve Payment No. 2 –C&L Excavating, Inc. –2021 PMP Street And Utility Improvements Project David Swearingen, Interim Public Works Director MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF PULLED CONSENT ITEMS Those items that are pulled from the Consent Calendar will be removed from the general order of business and considered separately in its normal sequence on the agenda. PUBLIC HEARINGS NEW BUSINESS UNFINISHED BUSINESS COUNCIL/STAFF COMMENTS ADJOURN Mayor:David GrantCouncilmembers:Brenda HoldenFran HolmesDave McClungSteve Scott Regular City Council AgendaAugust 9, 20217:00 p.m. City Hall Address:1245 W Highway 96Arden Hills MN 55112Phone:651 -792 -7800Website:www.cityofardenhills.orgCity VisionArden Hills is a strong community that values its unique environmental setting, strong residential neighborhoods, vital business community, well -maintained infrastructure, fiscal soundness, and our long -standing tradition as a desirable City in which to live, work, and play.This meeting will be streamed live on local Cable Channel 16 and available for playback on our website.CALL TO ORDER1.2.3.4.4.A.Documents: 5. 5.A. Documents: 6. 6.A. Documents: 6.B. Documents: 7. 7.A. Documents: 7.B. Documents: 7.C. Documents: 7.D. Documents: 7.E. Documents: 7.F. Documents: 7.G. Documents: 7.H. Documents: 8. 9. 10. 11. 12. APPROVAL OF AGENDAPUBLIC INQUIRIES/INFORMATIONALThis is an opportunity for citizens to bring to the Council ’s attention any items not currently on the agenda which are relevant to the City. In addressing the Council, you must first state your name and address for the record. To allow adequate time for each person wishing to address the Council, speakers must limit their comments to three (3) minutes. Written documents may be distributed to the Council prior to the meeting to allow a more timely presentation. Speakers should not use obscene, profane, or threatening language, or make personal attacks. Matters of litigation involving the City shall not be discussed during Public Inquiry by citizens or Council. The Council may not respond to speaker comments, engage in a debate, or take any action on the issues raised by citizens, but may direct City staff to research or follow up on an issue, if desired by Council. If Council directs further review by staff, the results of that review will be presented at a following regular Council meeting.RESPONSE TO PUBLIC INQUIRIESPUBLIC PRESENTATIONSTwin Cities Gateway Visitors Bureau Presentation Allen Stauffacher, Twin Cities Gateway Visitors BureauMEMO.PDFATTACHMENT A.PDFSTAFF COMMENTSTransportation UpdateDavid Swearingen, Interim Public Works DirectorMEMO.PDFAPPROVAL OF MINUTESJuly 12, 2021 Special City Council Work Session07-12 -21 -SWS.PDFJuly 12, 2021 Regular City Council07-12 -21 -R.PDFCONSENT CALENDARThose items listed under the Consent Calendar are considered to be routine by the City Council and will be enacted by one motion under a Consent Calendar format. There will be no separate discussion of these items, unless a Councilmember so requests, in which event, the item will be removed from the general order of business and considered separately in its normal sequence on the agenda.Motion To Approve Claims And PayrollGayle Bauman, Finance DirectorMEMO.PDFMotion To Approve Amendment To Urban Requalification Joint Cooperation Agreement Dave Perrault, City AdministratorMEMO.PDFATTACHMENT A.PDF Motion To Approve New Tobacco License –Cub Discount Liquor, 3715 Lexington Avenue N Julie Hanson, City Clerk MEMO.PDF Motion To Adopt Resolution 2021 -043 Approving Charitable Gambling License For Spring Lake Park Lions At Welsch ’s Big Ten Tavern Julie Hanson, City Clerk MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF ATTACHMENT C.PDF Motion To Approve Change Order No. 8 And Final Payment –Northwest Asphalt, Inc. –2018 Street And Utility Improvements Project David Swearingen, Interim Public Works Director MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF ATTACHMENT C.PDF Motion To Approve Payment No. 1 –Pember Companies –2021 Concrete Improvements Project David Swearingen, Interim Public Works Director MEMO.PDF ATTACHMENT A.PDF Motion To Approve Resolution 2021 -044 Receiving Feasibility Report And Calling For Public Hearing On Improvements –Lexington Avenue Reconstruction Project (Traffic Signal At Target Road) David Swearingen, Interim Public Works Director MEMO.PDF WEBSITE ATTACHMENT A.PDF ATTACHMENT B.PDF ATTACHMENT C.PDF Motion To Approve Payment No. 2 –C&L Excavating, Inc. –2021 PMP Street And Utility Improvements Project David Swearingen, Interim Public Works Director MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF PULLED CONSENT ITEMS Those items that are pulled from the Consent Calendar will be removed from the general order of business and considered separately in its normal sequence on the agenda. PUBLIC HEARINGS NEW BUSINESS UNFINISHED BUSINESS COUNCIL/STAFF COMMENTS ADJOURN Mayor:David GrantCouncilmembers:Brenda HoldenFran HolmesDave McClungSteve Scott Regular City Council AgendaAugust 9, 20217:00 p.m. City Hall Address:1245 W Highway 96Arden Hills MN 55112Phone:651 -792 -7800Website:www.cityofardenhills.orgCity VisionArden Hills is a strong community that values its unique environmental setting, strong residential neighborhoods, vital business community, well -maintained infrastructure, fiscal soundness, and our long -standing tradition as a desirable City in which to live, work, and play.This meeting will be streamed live on local Cable Channel 16 and available for playback on our website.CALL TO ORDER1.2.3.4.4.A.Documents:5.5.A.Documents:6.6.A.Documents:6.B.Documents:7.7.A.Documents:7.B.Documents: 7.C. Documents: 7.D. Documents: 7.E. Documents: 7.F. Documents: 7.G. Documents: 7.H. Documents: 8. 9. 10. 11. 12. APPROVAL OF AGENDAPUBLIC INQUIRIES/INFORMATIONALThis is an opportunity for citizens to bring to the Council ’s attention any items not currently on the agenda which are relevant to the City. In addressing the Council, you must first state your name and address for the record. To allow adequate time for each person wishing to address the Council, speakers must limit their comments to three (3) minutes. Written documents may be distributed to the Council prior to the meeting to allow a more timely presentation. Speakers should not use obscene, profane, or threatening language, or make personal attacks. Matters of litigation involving the City shall not be discussed during Public Inquiry by citizens or Council. The Council may not respond to speaker comments, engage in a debate, or take any action on the issues raised by citizens, but may direct City staff to research or follow up on an issue, if desired by Council. If Council directs further review by staff, the results of that review will be presented at a following regular Council meeting.RESPONSE TO PUBLIC INQUIRIESPUBLIC PRESENTATIONSTwin Cities Gateway Visitors Bureau Presentation Allen Stauffacher, Twin Cities Gateway Visitors BureauMEMO.PDFATTACHMENT A.PDFSTAFF COMMENTSTransportation UpdateDavid Swearingen, Interim Public Works DirectorMEMO.PDFAPPROVAL OF MINUTESJuly 12, 2021 Special City Council Work Session07-12 -21 -SWS.PDFJuly 12, 2021 Regular City Council07-12 -21 -R.PDFCONSENT CALENDARThose items listed under the Consent Calendar are considered to be routine by the City Council and will be enacted by one motion under a Consent Calendar format. There will be no separate discussion of these items, unless a Councilmember so requests, in which event, the item will be removed from the general order of business and considered separately in its normal sequence on the agenda.Motion To Approve Claims And PayrollGayle Bauman, Finance DirectorMEMO.PDFMotion To Approve Amendment To Urban Requalification Joint Cooperation Agreement Dave Perrault, City AdministratorMEMO.PDFATTACHMENT A.PDFMotion To Approve New Tobacco License –Cub Discount Liquor, 3715 Lexington Avenue NJulie Hanson, City ClerkMEMO.PDFMotion To Adopt Resolution 2021 -043 Approving Charitable Gambling License For Spring Lake Park Lions At Welsch ’s Big Ten TavernJulie Hanson, City ClerkMEMO.PDFATTACHMENT A.PDFATTACHMENT B.PDFATTACHMENT C.PDFMotion To Approve Change Order No. 8 And Final Payment –Northwest Asphalt, Inc. –2018 Street And Utility Improvements Project David Swearingen, Interim Public Works DirectorMEMO.PDFATTACHMENT A.PDFATTACHMENT B.PDFATTACHMENT C.PDFMotion To Approve Payment No. 1 –Pember Companies –2021 Concrete Improvements ProjectDavid Swearingen, Interim Public Works DirectorMEMO.PDFATTACHMENT A.PDFMotion To Approve Resolution 2021 -044 Receiving Feasibility Report And Calling For Public Hearing On Improvements –Lexington Avenue Reconstruction Project (Traffic Signal At Target Road)David Swearingen, Interim Public Works DirectorMEMO.PDFWEBSITE ATTACHMENT A.PDFATTACHMENT B.PDF ATTACHMENT C.PDF Motion To Approve Payment No. 2 –C&L Excavating, Inc. –2021 PMP Street And Utility Improvements Project David Swearingen, Interim Public Works Director MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF PULLED CONSENT ITEMS Those items that are pulled from the Consent Calendar will be removed from the general order of business and considered separately in its normal sequence on the agenda. PUBLIC HEARINGS NEW BUSINESS UNFINISHED BUSINESS COUNCIL/STAFF COMMENTS ADJOURN Mayor:David GrantCouncilmembers:Brenda HoldenFran HolmesDave McClungSteve Scott Regular City Council AgendaAugust 9, 20217:00 p.m. City Hall Address:1245 W Highway 96Arden Hills MN 55112Phone:651 -792 -7800Website:www.cityofardenhills.orgCity VisionArden Hills is a strong community that values its unique environmental setting, strong residential neighborhoods, vital business community, well -maintained infrastructure, fiscal soundness, and our long -standing tradition as a desirable City in which to live, work, and play.This meeting will be streamed live on local Cable Channel 16 and available for playback on our website.CALL TO ORDER1.2.3.4.4.A.Documents:5.5.A.Documents:6.6.A.Documents:6.B.Documents:7.7.A.Documents:7.B.Documents:7.C.Documents:7.D.Documents:7.E.Documents:7.F.Documents:7.G.Documents: 7.H. Documents: 8. 9. 10. 11. 12. Page 1 of 1 PUBLIC PRESENTATION – 4A MEMORANDUM DATE: August 9, 2021 TO: Honorable Mayor and City Councilmembers FROM: Allen Stauffacher, Twin Cities Gateway Visitors Bureau SUBJECT: Twin Cities Gateway Visitors Bureau Presentation Budgeted Amount: Actual Amount: Funding Source: N/A N/A N/A Council Should Consider Motions to approve, table, or deny the following: • NO ACTION IS REQUIRED ON THIS ITEM All items need a simple majority for action unless otherwise noted. Background Allen Stauffacher of the Twin Cities Gateway Visitors Bureau will be making a presentation to the City Council and informing them of options for the City to become a member of the organization. No decision is needed from the City Council for this item, but if the City Council would like to discuss further they could direct Staff to put this item on a future worksession or regular meeting for official action. Budget Impact N/A Attachments Attachment A: Presentation from Twin Cities Gateway Visitors Bureau Arden Hills City Council Presentation •Anoka •Blaine •Coon Rapids •Fridley •Ham Lake •Lino Lakes •Mounds View •New Brighton •Shoreview *23 Properties Monday August 9, 2021 TOURISM IN MINNESOTA •$14.4 billion in gross sales •Almost $40 million per day •254,000 full & part-time jobs •11% of private sector employment •$5.1 billion in salaries and wages •$930 million in sales tax revenues •17% of all MN sales taxes Anoka County = $555 million / 12,612 jobs Ramsey County = $2.04 billion / 28,026 jobs Bunker Beach Coon Rapids What happens when more visitors come to town? Magic Happens! TOURISM IS ECONOMIC DEVELOPMENT’S “FIRST DATE” Tourism attracts new residents Tourism attracts a strong workforce Tourism attracts new businesses Tourism attracts new development What Happens When More Visitors Come to Town? The perception of the community is enhanced What Happens When More Visitors Come to Town? The community attracts a strong workforce What Happens When More Visitors Come to Town? New Businesses are Attracted 21%24%17%16%16%6% Lodging Food / Bev Retail Recreation Transport Other Lodging F & B Retail Recreation Transport Other What Happens When More Visitors Come to Town? 79% of Spending is on “Main Street” & 21% on Lodging TCG STRATEGIC OBJECTIVES: •Reach identified target markets •Drive hotel page website traffic •Increase non-peak period business •Leverage resources via partnerships •Maximize prospect engagement Bunker Hills Midwest Living / USA Today Travel Guide TWIN CITIES GATEWAY SPORTS MARKETING HOME OF The National Sports Center-World’s Largest Amateur Sports Facility •TCG area has more indoor rinks, soccer fields and ball fields than any other CVB in the State. •Target USA Cup and 3M PGA Tournament estimated 55-65 million dollars in economic impact last month •Regularly attend sports shows to promote our area along with a Sports section on the TCG website that includes facilities and calendar •Work with member city park directors for facility availability and promotions. August 2021 5-8: US A Softball MONSTA Girls fast Pitch Nationals @ Rice Creek Park Shoreview 6‐8: USA International Hockey Cup @ NSC Super Rink 6‐9: USA Ultimate Open/YCC @ NSC 7-8: USSSA State Softball Championships @ Sand Creek Coon Rapids 8: Stockyard Days Golf Tournament @ Brightwood Hills New Brighton 13-15: Hockey Fest @ NSC Blaine 13‐15: Northland Hockey Group ‐Combat Cup @ NSC Super Rink 13‐15: Flag Football Regional @ NSC 14: 3v3 Street Futbol Red Bull 3×3 @ NSC 20‐22: Easton Cup @ NSC Super Rink 20‐22: Bluehawks Baseball Tournament @ Airport Park 21: Festival in the Park 5K Fun Run @ Mounds View 27-28: Minnesota College Athletic Conference Cross Over Volleyball Tournament @ Anoka-Ramsey College Coon Rapids 27‐29: Summer Finale BHS Boys/Jeff Thompson Memorial Soccer Jam @ NSC 27‐29: Northland Hockey ‐TPI @ NSC Super Rink 28‐29: Sliding into Fall Baseball Classic @ Airport Park •Anoka •Blaine •Coon Rapids •Fridley •Ham Lake •Lino Lakes •Mounds View •New Brighton •ShoreviewTCG Grants to the Member Cities range from $5,000 to $24,000 TWIN CITIES GATEWAY BOARD OF DIRECTORS Meets Quarterly as of 2022 Each city gets a city appointed representative. Additional representation based on lodging receipts TWIN CITIES GATEWAY SPENDS MORE MONEY ON MARKETING THEIR MEMBER CITIES THAN ANY OTHER CVB IN MINNESOTA TCG FACT THANK YOU Questions ? Marketing & Communications Strategic Goals REACH IDENTIFIED TARGET MARKETS DRIVE HOTEL PAGE WEBSITE TRAFFIC INCREASE NON-PEAK PERIOD BUSINESS LEVERAGE RESOURCES VIA PARTNERSHIPS MAXIMIZE PROSPECT ENGAGEMENT Website: Blogs I Event Pages I Partner Pages or Listings •Digital Display: Retargeting I Native Advertising I Foot Traffic Tracking •Paid Search: Search Engine Marketing (SEM) •Organic Search: Search Engine Optimization (SEO) •Email: Leisure E-newsletter •Print: Map I Leisure Ads •Public Relations: Leisure-focused local TV segments •Social Media: Facebook I Instagram I Twitter I LinkedIn Marketing & Communication Channels Website Content 20 E-Newsletter •15,000 Subscribers •Monthly E-blasts •Marketing: Interstitial Ad on homepage & Facebook Ads Marketing – Website Analytics Marketing –Google Analytics Social Media 26 Social Media Paid Social Media Launched two paid social media campaigns in June: •70.3K impressions across Facebook & Instagram Public Relations Marketing –Print Advertising 30 Meetings & Events Marketing 31 Contact Us Al Stauffacher Director Email: Al@tcgateway.com Phone: 612-269-0441 Natalie Conrad Director of Marketing & Communications Email: Natalie@tcgateway.com Phone: 651-399-1814 Thank you! Page 1 of 1 STAFF COMMENTS – 5A MEMORANDUM DATE: TO: FROM: August 9, 2021 Honorable Mayor and City Councilmembers Dave Perrault, City Administrator David Swearingen, Interim Public Works Director/City Engineer SUBJECT: Transportation Update Budgeted Amount: Actual Amount: Funding Source: $ $ $ A verbal update will be provided at the City Council meeting. Approved: August 9, 2021 CITY OF ARDEN HILLS, MINNESOTA SPECIAL CITY COUNCIL WORK SESSION JULY 12, 2021 5:15 P.M. - ARDEN HILLS CITY HALL CALL TO ORDER/ROLL CALL Pursuant to due call and notice thereof, Mayor Grant called to order the City Council Work Session at 5:15 p.m. Present (Closed Item): Mayor David Grant, Councilmembers Brenda Holden, Fran Holmes, and Steve Scott via telephone: Councilmember Dave McClung Also present: City Administrator Dave Perrault, Interim Public Works Director David Swearingen, City Attorney Joel Jamnik and Elisa Hatlevig, Jandine, Logan & O’Brien, P.L.P.P. Present (Open Item): Mayor David Grant, Councilmembers Brenda Holden, Fran Holmes, and Steve Scott via telephone: Councilmember Dave McClung Also present: City Administrator Dave Perrault, Senior Planner Jessica Jagoe and City Clerk Julie Hanson 1. AGENDA ITEMS A. Sunram Litigation Discussion (Closed per Minn. Stat. 13D.05, Subd. 3(b) Attorney-Client Privilege) The City Council received an update from Elisa Hatlevig regarding the Sunram litigation. B. Chicken Ordinance Discussion Senior Planner Jagoe stated at the January 19, 2021 Work Session, the City Council provided staff with guidance on general parameters for consideration of a proposed chickens ordinance. Staff was directed to prepare language to be presented to the Council. Following previous discussions of the Council on the keeping of chickens, staff has prepared draft ordinance language with new language added in red font for Council review. Staff suggests in order to incorporate language into the City ordinance to allow for the keeping of chickens and address the regulations ARDEN HILLS CITY COUNCIL SPECIAL WORK SESSION – JULY 12, 2021 2 discussed by the Council that two Chapters of the city code be amended. Those applicable Chapters and Sections are as follows: • Municipal Code Chapter 4 – Animals and Pets o Amend - Section 400.01, Definitions o Add - Section 410.01 Subd. 3, Chickens License • Zoning Code Chapter 1325 – General Regulations o Amend – Section 1325.07 Subd. 7.A., Location for Buildings Housing Farm Animals Senior Planner Jagoe explained regarding coop setbacks, the general agreement of the Council was to include language similar to the City of Lakeville which was “The coop and run shall be located closer to the principal dwelling upon the property to which the administrative permit is issued than any other residential dwelling on an abutting property.” The Council should discuss further if there is a preference to add language more specific to require a license holder to maintain a minimum setback. Additionally, there was deliberation at the work session on size of the coop and should this structure count towards the maximum number of accessory structures. There seemed to be general agreement that the coop should count as an accessory structure, but no limitations (i.e. minimum or maximum) were set for size. These are two areas that the Council may want to discuss further in review of draft ordinance language. Senior Planner Jagoe reported otherwise, the draft ordinance language presented includes the consensus of comments from the January work session. This is the first ordinance presented to the Council for review. Staff is seeking direction on draft language and next steps. It should be noted that an ordinance amendment to the Zoning Code does require a public hearing. Councilmember Holden questioned what the difference was between a run and a pen. Senior Planner Jagoe stated a run and a pen were the same term. Further discussion ensured regarding the minimum size for a run/pen and exercise yard. Mayor Grant reported he would like to see the Council be specific as to what the size of the run in order to keep the pen humane. He noted the minimum size at this time was 30 square feet for three birds. Councilmember Holden asked how the City defined an exercise yard. Senior Planner Jagoe reported an exercise yard was a fenced in area for birds to be in when supervised. Councilmember Holden indicated this would allow for fenced in back yards to serve as exercise yards. Mayor Grant recommended the Council define how much space is required within the exercise yard. ARDEN HILLS CITY COUNCIL SPECIAL WORK SESSION – JULY 12, 2021 3 Councilmember Holden stated she supported the numbers on Page 4 in Attachment B. Councilmember Holmes questioned if the exercise yard should have a maximum and minimum size with setbacks. She indicated this would allow for 10 foot setbacks from chain link fences. Councilmember Scott commented he did not have a problem with chickens walking up to chain link fences. Senior Planner Jagoe discussed the screening language within the Ordinance that addressed fencing that had to be used within a coop. She noted the Council had previously discussed requiring screening around the coop. Councilmember Holmes stated she supported the coop, run and exercise yard all being screened. She noted this would also keep chicks safe. Councilmember Holden commented she thought the screening was for the coop and the run. Councilmember McClung indicated he agreed with Councilmember Holmes that all three areas should be screened. Councilmember Scott reported the city of Minneapolis allows chickens and their lots are smaller than the lots in Arden Hills. Councilmember Holden anticipated the people who would keep chickens would do a good job and she wanted the animals to have enough space to be healthy. Councilmember Holmes supported a six foot privacy fence being in place for the exercise yard as was written in the urban recommendations. Mayor Grant questioned what the minimum and maximum coop size should be. He stated the minimum square footage at this time was four square feet per bird and three birds were allowed. Councilmember Holden suggested coops be no more than 20 to 25 square feet in size. Mayor Grant commented this sounds reasonable. He recommended the coops range from 12 to 25 square feet in size. The Council discussed the setbacks that should be followed for chicken coops, pens and exercise yards. Councilmember Holden expressed concern that coops may be closer to a neighbor’s house than the property owner’s house and this was a concern for her. City Administrator Perrault suggested the language read: The outer limit of the coop must be closer to the principal dwelling structure than the abutting neighbor. The Council supported this recommendation. ARDEN HILLS CITY COUNCIL SPECIAL WORK SESSION – JULY 12, 2021 4 Councilmember Holden commented her only other concern was with how the properties in the southwest portion of the City would be able to support chickens if they already have a detached garage, and a shed on their property. She anticipated language could be written to allow residents with a single car detached garage and a shed to also have a chicken coop. Mayor Grant recommended that this language apply to all neighborhoods in the City and not just the southwest portion of Arden Hills. Councilmember Holden suggested this language apply to properties in Arden Hills that have a single car detached garage and storage shed with the maximum allowed square footage being 720 square feet. Councilmember Holmes recommended a license be required in order to allow the City to have the ability to revoke the chicken keeping license if the property owner was not following all rules and regulations. Councilmember Holden asked if property owners would be given 10 days to bring the property into compliance, like with other code enforcement issues. City Administrator Perrault reported the City would have to give them some amount of time to remedy the situation. Councilmember Holden recommended that coops be removed if the property owner was no longer keeping chickens. She asked if the City was going to require property owners to receive neighbor consent. Councilmember Holmes stated this was a recommendation from the urban recommendations. She suggested the City manage this process so as to not create additional friction between neighbors. Mayor Grant commented there was value in neighbors establishing relationships with their neighbors as well. Councilmember Scott agreed. Councilmember Holmes indicated this was a tough situation. She discussed the issues her neighborhood has had with unruly dogs and how the neighbors have had to work it out noting somethings things get tense. City Administrator Perrault stated the Council would have to consider how the City defines neighbors and if this includes just the houses on each side and directly behind. Councilmember Holden supported this definition. Councilmember Holmes agreed, especially if the property owner was required to have 100% consent. She commented the Council may want to see what other cities require for consent. ARDEN HILLS CITY COUNCIL SPECIAL WORK SESSION – JULY 12, 2021 5 Councilmember Holden reported if the City is required to gain consent from the adjacent neighbors the fee for the license will have to be set accordingly because this would require staff time and resources. Mayor Grant recommended staff speak with the city of New Brighton regarding their chicken ordinance. He explained the Council should consider how to manage chicken coops that back up to a City park. Councilmember Holden questioned how much people are charged when their animals are picked up and brought to animal control. City Administrator Perrault stated the fee that is charged is given to the shelter that houses the dogs. Councilmember Holmes asked if animal control would pick up stray chickens. City Administrator Perrault reported this would be managed by animal control. The Council directed staff to make the necessary changes and to speak with adjacent cities regarding their ordinance in order to respond to the concerns raised by the Council at a future worksession meeting. 2. COUNCIL/STAFF COMMENTS Councilmember Holden asked if a letter had been sent to the Round Lake residents. Mayor Grant explained he had the understanding that not everyone was informed. He recommended a mailing be sent from the City to everyone adjacent to Round Lake, both residents and businesses. Councilmember Holden recommended information also be posted on the City’s website. City Administrator Perrault requested the Council think about when to hold the Commission/ Committee picnic. Councilmember Holden suggested a date also be picked for the Public Works staff appreciation day. Mayor Grant reported special accommodations are being made for Councilmember McClung’s attendance via telephone and he noted he would state this at the upcoming regular Council meeting. ARDEN HILLS CITY COUNCIL SPECIAL WORK SESSION – JULY 12, 2021 6 ADJOURN Mayor Grant adjourned the City Council Work Session at 6:55 p.m. __________________________ __________________________ Julie Hanson David Grant City Clerk Mayor Approved: August 9, 2021 CITY OF ARDEN HILLS, MINNESOTA REGULAR CITY COUNCIL MEETING JULY 12, 2021 7:00 P.M. - ARDEN HILLS CITY COUNCIL CHAMBERS CALL TO ORDER/ROLL CALL Pursuant to due call and notice thereof, Mayor David Grant called to order the regular City Council meeting at 7:00 p.m. Present: Mayor David Grant, Councilmembers Brenda Holden, Fran Holmes, Dave McClung (attending remotely) and Steve Scott Absent: None Also present: City Administrator Dave Perrault; Interim Public Works Director David Swearingen; Senior Planner Jessica Jagoe; Planning Consultant Jane Kansier; Finance Director Gayle Bauman; and City Clerk Julie Hanson PLEDGE OF ALLEGIANCE 1. APPROVAL OF AGENDA MOTION: Councilmember Holden moved and Councilmember Holmes seconded a motion to approve the meeting agenda as presented. A roll call vote was taken. The motion 4-0-1 (Councilmember McClung was absent for the vote). 2. PUBLIC INQUIRIES/INFORMATIONAL None. 3. RESPONSE TO PUBLIC INQUIRIES None. 4. STAFF COMMENTS A. COVID-19 Update ARDEN HILLS CITY COUNCIL – JULY 12, 2021 2 City Administrator Perrault provided the Council with an update on how the City was responding to COVID-19. He encouraged residents to visit the City’s website for the most current and up to date information regarding COVID-19. He reported the Minnesota Department of Health and CDC also had websites with current guidelines and recommendations. He stated City staff has returned to City Hall, which was now open to the public operating under summer hours (Monday through Thursday 7:30 a.m. to 5:00 p.m. and Friday 7:30 a.m. to 11:30 a.m.). He explained all City Council, Planning Commission and other committee meetings would now be held in person. Mayor Grant directed staff to stop providing COVID-19 updates due to the fact meetings were being held in person and City staff was back at City Hall. B. Transportation Update Interim Public Works Director Swearingen reported the 2021 PMP project was underway and noted utility work was being done on Glen Paul. He explained Gerald Avenue was ground up last week and utility work would begin next week. He encouraged residents to visit the City’s website for the most up to date information regarding this project. Interim Public Works Director Swearingen stated the Hamline Avenue crosswalk improvements began last Tuesday. He anticipated this project would be completed in two weeks. Interim Public Works Director Swearingen explained bridge work would begin on County Road E over Minnesota State Highway 51 on Wednesday. C. Night to Unite Update City Clerk Hanson stated Night to Unite would be held on Tuesday, August 3, 2021. She encouraged residents to register their neighborhood gatherings with the Ramsey County Sheriff’s Office and noted information regarding this event along with a link to register was posted on the City’s website. She explained 16 events had already been registered in Arden Hills with 97 total registered events in Ramsey County. Mayor Grant read a proclamation in full for the record declaring Tuesday, August 3, 2021 as Night to Unite in the City of Arden Hills. 5. APPROVAL OF MINUTES A. June 14, 2021 Special Executive (Closed) B. June 14, 2021, Regular City Council MOTION: Councilmember Holden moved and Councilmember Holmes seconded a motion to approve the June 14, 2021, Special Executive (Closed) meeting minutes; and June 14, 2021, Regular City Council meeting minutes as amended. A roll call vote was taken. The motion carried (5-0). ARDEN HILLS CITY COUNCIL – JULY 12, 2021 3 6. CONSENT CALENDAR A. Motion to Approve Consent Agenda Item - Claims and Payroll B. Motion to Approve Resolution 2021-036 Supporting Arden Hills Bonding Request C. Motion to Authorize Green Lights Recycling, Inc. Clean Up Day Proposal Agreement D. Motion to Approve Assignment of Development Agreement AHSL Partners LLC (Trident Development) E. Motion to Approve Resolution 2021-037 Accepting a Donation from the Arden Hills Foundation F. Motion to Approve Acquiring Sanitary Sewer Easement – Bethel University G. Motion to Approve Development Agreement – Arden Hills RE, LLC (New Perspective Senior Living) H. Motion to Approve Changer Order No. 1 and Payment No. 1 – C&L Excavating, Inc. – 2021 PMP Street and Utility Improvements I. Motion for Authorization to Begin Recruitment Process for a Senior Engineering Technician J. Motion to Approve Payment #6 to Air Express, Inc. – City Hall HVAC Replacement Project MOTION: Councilmember Holden moved and Councilmember Holmes seconded a motion to approve the Consent Calendar as presented and to authorize execution of all necessary documents contained therein. A roll call vote was taken. The motion carried (5-0). 7. PULLED CONSENT ITEMS None. 8. PUBLIC HEARINGS A. Vacation of Easement – Arden Hills RE, LLC (New Perspective Senior Living) – Planning Case 21-015 Senior Planner Jagoe stated at the January 28 and February 8, 2021 meetings, Arden Hills RE, LLC on behalf of New Perspective Senior Living received required approvals from the Council to construct a four (4) story, 146-unit senior housing building which will include independent living, assisted living, and memory care. The applicant is requesting to vacate the existing sanitary sewer easement due to the new sanitary sewer line alignment as approved within the development plans for this project. Bethel University will be dedicating a new sanitary sewer easement to the City in satisfaction of ordinance requirement. The proposed sewer easement vacation is located along the westerly edge of Lot 1, Block 1, 2 Pine Tree North plat. The Interim Public Works Director has reviewed the proposed easement vacation and provided a memo in support of the vacation request. A request for a Vacation of Easement requires a public hearing before the City Council. Mayor Grant opened the public hearing at 7:17 p.m. ARDEN HILLS CITY COUNCIL – JULY 12, 2021 4 With no one coming forward to speak, Mayor Grant closed the public hearing at 7:18 p.m. 9. NEW BUSINESS A. Resolution 2021-038 – Vacation of Easement – Arden Hills RE, LLC (New Perspective Senior Living) – Planning Case 21-015 Senior Planner Jagoe stated this item was introduced by staff under Item 8A. Staff discussed the options available to the Council and recommended approval of the request. MOTION: Councilmember Holden moved and Councilmember Holmes seconded a motion to adopt Resolution #2021-038 – Approving a Vacation of Sewer Easement lying within Lot 1, Block 1, Pine Tree North Plat. A roll call vote was taken. The motion carried (5-0). 10. UNFINISHED BUSINESS A. Resolution 2021-039 – Variance at 3493 Siems Court – Planning Case 20-17 Planning Consultant Kansier stated in September of 2020, Kye Samuelson (“Applicant”) requested a Variance in order to construct an accessory structure near the shoreline of 3493 Siems Court (“Subject Property”) within the Shore Impact Zone of Lake Johanna. The Applicant requested a variance to build a 120 square foot accessory storage structure that encroached eighteen (18) inches into the Shore Impact Zone of Lake Johanna. The proposed structure exceeded the eight (8) foot height limitation at ten (10) feet, six (6) inches. The rationale for the variance was that the structure would be used for the storage of modern day recreational water equipment and the hardship was due to the rear yard topography. The Subject Property is zoned R- 1, Single Residential District, is located in the Shoreland Management District, and is guided as Low Density Residential on the Land Use Plan. Planning Consultant Kansier explained at the October 7, 2020 Planning Commission meeting the Applicant requested a variance to build a 120 square foot accessory storage structure that encroached eighteen (18) inches into the Shore Impact Zone of Lake Johanna. The proposed structure exceeded the eight (8) foot height limitation at ten (10) feet, six (6) inches. The Planning Commission voted to table the request to allow the Applicant to revise their plans to better conform to the Shoreland Ordinance provisions. Planning Consultant Kansier reported the Applicant took the Planning Commissions comments under consideration and submitted revised plans for a smaller structure that would not encroach into the Shore Impact Zone. The Applicant is now proposing to construct structure a nine and a half (9.5) feet tall and ninety-three and a half (93.5) square feet in size. However, the proposed structure still required a variance due to the proposed height and area that exceeded current ordinance standards. At its December 9, 2020 meeting the Planning Commission reviewed and discussed this application. The Planning Commission voted 4-3 to approve the planning case. The City Council reviewed this request at its January 11, 2021 meeting. ARDEN HILLS CITY COUNCIL – JULY 12, 2021 5 Planning Consultant Kansier commented the City Council voted unanimously to table this planning case to allow them to review the existing accessory structure size standards for the Shoreland District. The Applicant signed a 6-month Extension Form, requiring the City Council to take action on the variance request by July 12, 2021. On June 28, 2021, the City Council approved Ordinance 2021-004, amending the requirements for accessory structures in the Shoreland District. This amendment increased the maximum size of an accessory structure to 100 square feet, and applied screening and design standards. The amendment did not increase the maximum height. Planning Consultant Kansier reviewed the Plan Evaluation and offered the following Findings of Fact: 1. City Staff received a land use application for a request to build an accessory structure for storage at the Subject Property 3493 Siems Court. 2. Storage of personal items is a permitted use for an accessory structure in the R-1 Single Family Residential District. 3. The Subject Property has a steep downward slope in the rear yard that prevents the Applicant from building on much of the site. 4. The Subject Property meets the minimum lot size, width, and length requirements for the R-1 District. 5. The Applicant is requesting flexibility with the maximum height for an accessory storage shed located within the Ordinary High Water Level (OHWL) setback requirement for Lake Johanna. 6. The rear yard setback requirement for a proposed accessory structure is determined by the OWHL of Lake Johanna. 7. The proposed structure is located 25.2 feet within the OHWL setback from Lake Johanna which is 50 feet. 8. The proposed storage structure would be located outside the Shore Impact Zone of Lake Johanna. 9. One (1) storage shed is permitted with the OHWL setback requirement of Lake Johanna as long as it does not exceed 100 square feet in size and eight (8) feet in height. 10. The proposed structure exceeds the height at nine (9) feet six (6) inches tall and exceeds the area dimension at 93.5 square feet. 11. The proposed structure would otherwise conform to all other requirements and standards of the R-1 district. 12. A variance may be granted if enforcement of a provision in the zoning ordinance would cause the landowner practical difficulties. Planning Consultant Kansier explained the Planning Commission recommended approval by a 4-3 vote of Planning Case 20-017 for a Variance at 3493 Siems Court, based on the findings of fact and the submitted plans in the December 9, 2020 Report to the Planning Commission, as amended by conditions. Based on the recent amendment to the Zoning Ordinance, the only variance requested at this time is a variance to the height of the structure. The following conditions were recommended for approval of the Variance: 1. A Zoning Permit for an accessory structure shall be issued prior to commencement of construction. ARDEN HILLS CITY COUNCIL – JULY 12, 2021 6 2. The structure shall be rotated on the site so the maximum width of the accessory structure, as viewed from the water, does not exceed ten (10) feet. 3. The exterior materials of the proposed addition shall be consistent or complementary in color, texture and quality with those visible on the existing structure. 4. The Applicant shall provide a landscaping plan indicating structure shall be screened a minimum of 50 percent by opaque vegetation or topography on the three walls seen from the lake with ecologically suited landscaping landward of the ordinary high water level from the lake. Planning staff shall review and approve the screening plan prior to the issuance of Zoning Permit. 5. The proposed accessory structure shall conform to all other standards and regulations in the City Code. Councilmember Scott asked if the applicant agreed to rotate the building 90 degrees and questioned why staff was making this a requirement. Planning Consultant Kansier commented the applicant was aware of the provision and noted the provision would lessen the visual impact of the structure from the water. Councilmember Holden indicated she would not be able to support this variance request. Councilmember Holmes stated if the variance were not approved the structure would have to be eight feet tall. She inquired if some sort of land use plan would be required to review a structure that was eight feet tall. Planning Consultant Kansier explained a zoning permit would be required for this type of structure. Councilmember Scott reported if the roof were changed from a pitched roof to a flat roof, the applicant would meet the City’s requirements, however, this would be less visually appealing. He indicated he has been to the property and met with the applicant. He thanked the applicant for spending time and the expense of altering the plans to make this building visually appealing. He stated he would be offering his support of the 17 inch variance. Councilmember Holmes explained the reason the City kept the structure height at eight feet within the Ordinance was because the City wanted to minimize the impact from the lake. She commented “visually appealing” was in the eye of the beholder, because those passing by this structure may not find it visually appealing. She stated she would like to see the building height at eight feet and not nine and a half feet. Councilmember Holden asked if a pitched roof could be put on the shed to have the total structure height being eight feet. Planning Consultant Kansier reported this would mean the side walls would have to be shorter, in order have the peak of the structure at eight feet. Councilmember McClung stated he would not be supporting this variance noting he would like to see the City Council stick to the Shoreland Ordinance. ARDEN HILLS CITY COUNCIL – JULY 12, 2021 7 Mayor Grant commented this structure was 17 inches too high. He indicated the Council reviewed the Shoreland Ordinance for almost two months. He questioned if the applicant was fully aware of the variance request given the new requirements within the Shoreland Ordinance. Planning Consultant Kansier stated she did not have conversations specifically regarding this, but noted the applicant spoke about building height and was aware of the City’s requirements. MOTION: Councilmember Holmes moved and Councilmember Holden seconded a motion to deny Planning Case 20-017 for a Variance at 3493 Siems Court, based on the following Findings of Fact: 1.) The City Council spent considerable time reviewing and redrafting the Ordinance for accessory structures in the shore impact zone. 2.) The City Council increased the allowable size for accessory structures in the shore impact zone. 3.) The City Council decided not to increase the structure height due to weighing the needs of residents versus those enjoying the lake. 4.) There are no practical difficulties for this variance request. Councilmember Scott stated the reason the Council considers variances individually, was because it allows the Council to consider each request based on the unique attributes of the property. He noted this property was very steeply sloped and the proposed building would not obstruct a view from the home or the lake based on the additional 17 inches in building height. He indicated he would not be supporting the motion on the floor. Councilmember Holden commented this was not a unique property on the lake. She stated after working with the DNR for over six weeks on the Shoreland Ordinance, she indicated she would like to see the City Council stick to the Ordinance and not support the variance. She feared that if this variance were approved, numerous requests would be made in the future from lakeshore property owners. Mayor Grant indicated he would be supporting the motion on the floor. While he appreciated the fact the applicant had come back with adjusted plans, he believed there were ways for the applicant to meet the Ordinance requirements. Councilmember Holden clarified the applicant had not modified his plans since last fall. Planning Consultant Kansier reported the plans were adjusted in October, but no adjustments have been made since that time. Mayor Grant questioned what options the applicant would have regarding an accessory structure if this variance were denied. Planning Consultant Kansier explained the applicant would not be able to bring a variance request before the Council for another six months, unless it was a substantially different request. She commented another option would be for the applicant to bring an accessory structure request that meets the City’s requirements. ARDEN HILLS CITY COUNCIL – JULY 12, 2021 8 A roll call vote was taken. The motion to deny Planning Case 20-017 for a Variance at 3493 Siems Court carried 4-1 (Councilmember Scott opposed). 11. COUNCIL COMMENTS Councilmember McClung explained he recently visited the Ramsey County mobile refuse/waste site at the Public Works site. He encouraged residents to take advantage of this resource. Councilmember Scott also reported the Ramsey County mobile household waste site was up and running at the Public Works site every Friday and Saturday for the remainder of July. Councilmember Scott stated he joined Councilmember Holmes and City Administrator Perrault at a Hot Dog with a Deputy event last week. He noted this event was held at Arden Manor Park. He thanked the Ramsey County Sheriff’s office for hosting this event. Councilmember Holmes thanked City Administrator Perrault and Interim Public Works Director Swearingen for addressing the weed concerns in the Venus neighborhood. Councilmember Holden commented the Army Restoration Advisory Board (RAB) would be holding a public hearing regarding Round Lake remediation on July 20 and requested staff notify the properties that surround Round Lake. Councilmember Holden reported the flower beds along County Road 96 were in great condition. She thanked staff for their efforts. Mayor Grant stated he noticed the railroad bed south of Chatham was graded on both sides of the track. He requested staff investigate this and report back to the Council. Mayor Grant indicated he noticed the brown mulch that has been put in place throughout the City by the ICWC workers. He explained these crews have been doing great work in the community. ADJOURN MOTION: Councilmember Holden moved and Councilmember Holmes seconded a motion to adjourn. A roll call vote was taken. The motion carried (5-0). Mayor Grant adjourned the Regular City Council Meeting at 7:50 p.m. __________________________ __________________________ Julie Hanson David Grant City Clerk Mayor CONSENT ITEM 7A MEMORANDUM DATE: August 9, 2021 TO: Honorable Mayor and City Councilmembers Dave Perrault, City Administrator FROM: Gayle Bauman, Finance Director Pang Silseth, Accounting Analyst SUBJECT: Budgeted Amount: Actual Amount: Funding Source: N/A N/A N/A Council Should Consider Motion to approve, table or deny the following:  Claims and Payroll Listing All items need a simple majority for action unless otherwise noted. Background Payroll is processed biweekly and accounts payable is processed weekly. Budget Impact N/A Attachments 2021 Payroll #16 ……………………………………………………………. $106,770.45 Total Payroll $106,770.45 Paid Claims—07/17/2021 through 07/30/2021 (Check Nos. 50211-50241 and ACH Checks) ……………………………... $437,497.84 Total Accounts Payable $437,497.84 Total Claims $544,268.29 CITY OF ARDEN HILLS PAYROLL # 16 CHECKS DATED: 08/06/21 Biweekly: 07/17/21 - 07/30/21 EMPLOYEE DEDUCTIONS AMT.Payment Method FIT 6,829.77 EFT SIT 3,063.64 EFT FICA Oasdi 4,636.87 EFT FICA Medicare 1,084.45 EFT TOTAL TAXES 15,614.73 Health Premium 1,528.96 A/P Check* Dental Premium 169.48 A/P Check* FSA Health Care Reimb. 0.00 A/P Check* FSA Dependent Care Reimb. 0.00 A/P Check* TOTAL FLEXIBLE SPENDING 1,698.44 HSA Health Saving 355.00 Health Care Savings Plan-Retirement 0.00 EFT Health Care Savings Plan-2% 446.17 EFT Health Care Savings Plan-4% 429.25 EFT TOTAL HEALTH SAVINGS 1,230.42 PERA 3,781.26 EFT ICMA 2,333.70 EFT Central Pension Fund-Union 614.40 A/P Check* MN State Retirement System 750.00 EFT TOTAL RETIREMENT 7,479.36 IUOE 49 Dues (Union) 140.00 A/P Check* LTD/STD Insurance 990.34 A/P Check* PERA Life Insurance 24.00 A/P Check* Life/Addl/Dep Life 33.74 A/P Check* Life/Addl non-tax 5.40 A/P Check* UNUM 19.51 A/P Check* AFLAC 22.76 EFT TOTAL VOLUNTARY 1,235.75 Total Employee Deductions 27,258.70 Net Payroll 0.00 Direct Deposit 50,756.43 EFT Gross Payroll Tie-Out 78,015.13 Plus City Paid Benefit 28,755.32 TOTAL PAYROLL COST 106,770.45 FICA TIE-OUT Gross Payroll 78,015.13 Less Total FSA 1,698.44 Less Total H.SA 1,230.42 Less Voluntary Ins 28.16 Less Non Taxable Reimbursement 270.00 Net P/R Subject to FICA 74,788.11 FICA Oasdi @ 6.20% 4,636.87 FICA Medicare @ 1.45% 1,084.45 Note: Federal and State Payroll Tax obligations are satisfied by means of utilizing the US Bank Easy Tax Deposit Service. Transfers are typically made up to two days after the payroll date. * A/P Checks can be found on the ACCOUNTS PAYABLE Check Approval report. Checks may be paid this week or the following week. 81.70 81.70 1,000.00 4,362.99 421.74 4,784.73 17,167.57 1,000.00 5,721.32 16,824.92 342.65 CITY BENEFIT 4,636.87 1,084.45 Accounts Payable User: Printed: pang.silseth 8/4/2021 3:23 PM Checks by Date - Detail by Check Date Check No Check DateVendor NameVendor No Check Amount Invoice No ReferenceDescription 0243 METROPOLITAN COUNCIL-WASTE WATER07/23/2021ACH 0001126648 Waste Water-August 70,596.57 70,596.57Total for this ACH Check for Vendor 0243: 0327 STAPLES INC 07/23/2021ACH 3481616732 supplies 236.42 236.42Total for this ACH Check for Vendor 0327: 0381 ICMA RETIREMENT CORPORATION 07/23/2021ACH 45649 Q3 2021 Plan Fee 250.00 250.00Total for this ACH Check for Vendor 0381: 0382 ICMA RETIREMENT TRUST - 106944 07/23/2021ACH PR 21-15 PR Batch 00200.07.2021 ICMA Employee Percent 401PR Batch 00200.07.2021 ICMA Employee Percent 401 365.51 PR 21-15 PR Batch 00200.07.2021 ICMA Employer Percent 401PR Batch 00200.07.2021 ICMA Employer Percent 401 421.74 787.25Total for this ACH Check for Vendor 0382: 0387 ICMA RETIREMENT TRUST #302482 07/23/2021ACH PR 21-15 PR Batch 00200.07.2021 ICMA Employee DeductionPR Batch 00200.07.2021 ICMA Employee Deduction 1,811.54 PR 21-15 PR Batch 00200.07.2021 ICMA Employee PercentPR Batch 00200.07.2021 ICMA Employee Percent 243.55 2,055.09Total for this ACH Check for Vendor 0387: 0750 VERIZON WIRELESS 07/23/2021ACH 9883826981 service 7/11-8/10 945.96 945.96Total for this ACH Check for Vendor 0750: 10224 HANNAH YOKOM 07/23/2021ACH 07152021 Valentine Hills Track 841.25 841.25Total for this ACH Check for Vendor 10224: 10442 SPRINGBROOK HOLDING COMPANY LLC07/23/2021ACH TM INV-004188 Meter Reading Upgrade 358.00 358.00Total for this ACH Check for Vendor 10442: 10461 LAURA HAMMER 07/23/2021ACH 07152021 Valentine Hills Track 841.25 841.25Total for this ACH Check for Vendor 10461: 3698 SHAILA CUNNINGHAM 07/23/2021ACH 7132021 Spring Yoga 600.00 600.00Total for this ACH Check for Vendor 3698: Page 1AP Checks by Date - Detail by Check Date (8/4/2021 3:23 PM) Check No Check DateVendor NameVendor No Check Amount Invoice No ReferenceDescription 5665 METERING & TECHNOLOGY SOLUTION INC07/23/2021ACH 19919 Boston Scientific Meter 661.82 661.82Total for this ACH Check for Vendor 5665: 7025 ON SITE COMPANIES -OSSTC INC 07/23/2021ACH 0001161589 Restrooms 7/10-8/6 622.00 622.00Total for this ACH Check for Vendor 7025: 7506 PRESBYTERIAN HOMES OF ARDEN HILLS LLC07/23/2021ACH 2021-01 75% TIF 1st Half 2021 141,440.12 141,440.12Total for this ACH Check for Vendor 7506: 8032 PACE ANALYTICAL FIELD SVC INC 07/23/2021ACH 1221-4778 May Drinking Water 851.25 851.25Total for this ACH Check for Vendor 8032: 0131 BEISSWENGERS DO IT BEST 07/23/202150211 473461 saw bar and chains 143.45 143.45Total for Check Number 50211: 1033 COMCAST 07/23/202150212 44271.0821 Service 7/21-8/20 6.57 6.57Total for Check Number 50212: 10405 DALEY ELECTRIC LLC 07/23/202150213 210330 service to truck lift 172.50 172.50Total for Check Number 50213: 0841 EHLERS & ASSOCIATES INC.07/23/202150214 87371 TIF Reporting 669.38 87371 TIF Reporting 669.37 1,338.75Total for Check Number 50214: 0176 FRATTALLONES HARDWARE INC 07/23/202150215 093300/A supplies 25.17 25.17Total for Check Number 50215: 1193 FURTHER INC 07/23/202150216 15757241 Participant Fee-July 45.00 45.00Total for Check Number 50216: 10218 HR GREEN INC 07/23/202150217 144832 Engineering Svcs-June 6,531.25 144832 Engineering MS4 Permit-June 95.00 144832 Engineering GE Control-June 541.00 144833 Lexington Station-June 1,314.00 144866 Hamline Ave PCW-June 3,700.75 12,182.00Total for Check Number 50217: AR-JENS MARSHA AND LAURA JENSEN 07/23/202150218 PC 19-007 Escrow Refund PC 19-007; 4101 Gale Cir 602.37 Page 2AP Checks by Date - Detail by Check Date (8/4/2021 3:23 PM) Check No Check DateVendor NameVendor No Check Amount Invoice No ReferenceDescription 602.37Total for Check Number 50218: 1440 HONGYI LAN 07/23/202150219 7192021 Spring Summer Tai Chi 480.00 480.00Total for Check Number 50219: 01467 MINNESOTA SWORD PLAY 07/23/202150220 1 Fencing Summer Camp 700.00 700.00Total for Check Number 50220: 0600 NCPERS GROUP LIFE INS 07/23/202150221 315800082021 August Insurance 48.00 48.00Total for Check Number 50221: NSCC NORTH SUBURBAN COMMUNICATIONS COMMISSION INC07/23/202150222 2021-513 Q2 2021 Contribution 6,150.22 6,150.22Total for Check Number 50222: 0155 OFFICE OF MN IT SERVICES 07/23/202150223 W21060580 Phone-June 736.14 736.14Total for Check Number 50223: 10408 PAULSON & CLARK ENGINEERING 07/23/202150224 21728 HVAC Replacement Project 3,234.00 3,234.00Total for Check Number 50224: 10250 PEAK STAFFING INC 07/23/202150225 47552 Office Support 7/5-7/9 150.00 47552 Office Support 7/5-7/9 37.50 47552 Office Support 7/5-7/9 150.00 47552 Office Support 7/5-7/9 112.50 47552 Office Support 7/5-7/9 825.00 47552 Office Support 7/5-7/9 112.50 47552 Office Support 7/5-7/9 112.50 1,500.00Total for Check Number 50225: 0811 RAMSEY COUNTY 07/23/202150226 EMCOM -009414 CAD-June 544.99 EMCOM-009361 Fleet Support-June 24.96 EMCOM-009397 Dispatch-June 3,978.60 FLEET-000649 Fuel-June 3,197.51 SHRFL-001993 Sheriff Services-July 115,686.34 123,432.40Total for Check Number 50226: 6748 RELIANCE STANDARD 07/23/202150227 GL154938.0821 August Insurance 1,200.77 1,200.77Total for Check Number 50227: 5576 SCHINDLER ELEVATOR CORP 07/23/202150228 7153327838 service to electronic component 541.95 541.95Total for Check Number 50228: Page 3AP Checks by Date - Detail by Check Date (8/4/2021 3:23 PM) Check No Check DateVendor NameVendor No Check Amount Invoice No ReferenceDescription SRFC SRF CONSULTING GROUP INC 07/23/202150229 14320.00-5 MVHS Trail Improv-June 12,573.54 12,573.54Total for Check Number 50229: 6555 TKDA INC 07/23/202150230 002021002455 Arden Oaks Feasibility-June 8,497.73 8,497.73Total for Check Number 50230: 394,697.54Total for 7/23/2021: 0192 GRAINGER INC 07/30/2021ACH 9963759536 Spotlights 339.68 339.68Total for this ACH Check for Vendor 0192: 0230 MTI DISTRIBUTING INC 07/30/2021ACH 1313177-00 Mower #85458 parts 136.27 136.27Total for this ACH Check for Vendor 0230: 0292 OXYGEN SERVICE COMPANY INC 07/30/2021ACH 3489999 June rental 27.28 27.28Total for this ACH Check for Vendor 0292: 0327 STAPLES INC 07/30/2021ACH 3481828663 Membership fee 299.00 299.00Total for this ACH Check for Vendor 0327: 0549 ABLE HOSE & RUBBER LLC INC 07/30/2021ACH 224990-001 Supplies 256.41 256.41Total for this ACH Check for Vendor 0549: 0922 NINENORTH 07/30/2021ACH 2021-129 June production 1,019.25 1,019.25Total for this ACH Check for Vendor 0922: 10363 MINUTE MAKER SECRETARIAL 07/30/2021ACH M1305 7/12 Council Meeting 164.00 164.00Total for this ACH Check for Vendor 10363: 1125 BOLTON & MENK INC 07/30/2021ACH 272039 Chick-Fil-A PC 21-011 #564 471.00 272039 Scannell PC 20-010 #506 604.50 272039 5/15/21-6/11/21 Planning Services 180.00 272039 AHSL PC 19-002 #403 157.00 272039 5/15/21-6/11/21 Planning Services 60.00 272039 Chick-Fil-A PC 21-003 #555 265.00 272039 Kunze PC 21-006 #565 343.50 272039 Arden Hills RE PC 21-010 #570 235.50 272039 Grove Church PC 21-005 #561 371.00 272039 5/15/21-6/11/21 Planning Services 10,897.50 272039 Boston Scientific PC 21-001 #553 53.00 272039 IMKD3 PC 21-004 #556 1,001.00 272039 Arden Hills RE PC 21-012 #577 1,440.50 Page 4AP Checks by Date - Detail by Check Date (8/4/2021 3:23 PM) Check No Check DateVendor NameVendor No Check Amount Invoice No ReferenceDescription 272039 U&B Architecture PC 21-009 #562 53.00 272039 Scannell PC 20-002 #498 78.50 272039 U&B Architecture PC 21-014 #569 793.00 272039 Samuelson PC 20-017 #543 184.50 272039 MVHS PC 18-014 #396 549.50 272039 Grove Church PC 21-013 #576 1,039.00 272039 5/15/21-6/11/21 Planning Services 960.00 19,737.00Total for this ACH Check for Vendor 1125: 1252 CAMPBELL KNUTSON - ATTORNEYS AT LAW07/30/2021ACH 3231G-0621 June Legal 186.00 3231G-0621 June Legal - PC21-001 #553 116.80 3231G-0621 June Legal 2,380.90 3231G-0621 June Legal 1,901.80 3231G-0621 June Legal - PC21-012 #577 294.50 3231G-0621 June Legal - PC21-011 #564 400.20 3231G-0621 June Legal 124.00 3231G-0621 June Legal - PC21-010 #570 139.50 3231G-0621 June Legal 46.50 3231G-0621 June Legal 491.00 3231G-0621 June Legal - PC21-014 #569 527.00 3231G-0621 June Legal - PC21-015 #582 535.30 3231G-0621 June Legal - PC21-006 #565 207.50 3231G-0621 June Legal 201.50 7,552.50Total for this ACH Check for Vendor 1252: 4445 PIONEER RIM AND WHEEL CO 07/30/2021ACH 01CF7254 Generator parts 347.28 347.28Total for this ACH Check for Vendor 4445: 5587 CES IMAGING INC 07/30/2021ACH INV129504 July rental 60.00 INV129505 Supplies 96.50 156.50Total for this ACH Check for Vendor 5587: 5665 METERING & TECHNOLOGY SOLUTION INC07/30/2021ACH 20006 Cellular endpoint 142.25 142.25Total for this ACH Check for Vendor 5665: 6060 BATTERIES PLUS 07/30/2021ACH P41896061 Escape battery 192.95 192.95Total for this ACH Check for Vendor 6060: fptc FLEXIBLE PIPE TOOL COMPANY INC 07/30/2021ACH 26435 Terminate pathfinder cable 418.95 418.95Total for this ACH Check for Vendor fptc: ampl AMERICAN PLANNING ASSOCIATION 07/30/202150231 369867-2174 APA membership 10/21-9/22 227.00 227.00Total for Check Number 50231: 0131 BEISSWENGERS DO IT BEST 07/30/202150232 474443 Trimmer line 53.48 476351 Supplies 19.48 Page 5AP Checks by Date - Detail by Check Date (8/4/2021 3:23 PM) Check No Check DateVendor NameVendor No Check Amount Invoice No ReferenceDescription 476935 Brake cable 26.69 99.65Total for Check Number 50232: cpf1 CENTRAL PENSION FUND 07/30/202150233 184503.0721 July pension 1,228.80 1,228.80Total for Check Number 50233: 4999 HIRSHFIELD'S PAINT MFG INC 07/30/202150234 0011299-IN Field striping 1,587.60 1,587.60Total for Check Number 50234: 10362 MARCO TECHNOLOGIES LLC 07/30/202150235 INV8955700 7/25-8/24 copier 13.62 INV8955700 7/25-8/24 copier 77.18 90.80Total for Check Number 50235: 5443 METRO PRODUCTS INC 07/30/202150236 160546 Supplies 115.13 115.13Total for Check Number 50236: 1058 MIDC ENTERPRISES INC 07/30/202150237 I0047521 Supplies 86.30 86.30Total for Check Number 50237: 10351 NORTHERN TECHNOLOGIES LLC 07/30/202150238 38849 Karth Lake Runoff materials testing 5/16-6/19 297.50 39136 Karth Lake Runoff materials testing 6/20-7/17 33.75 331.25Total for Check Number 50238: 10250 PEAK STAFFING INC 07/30/202150239 47560 Office Support 7/12-7/16 37.50 47560 Office Support 7/12-7/16 112.50 47560 Office Support 7/12-7/16 150.00 47560 Office Support 7/12-7/16 150.00 47560 Office Support 7/12-7/16 112.50 47560 Office Support 7/12-7/16 112.50 47560 Office Support 7/12-7/16 825.00 47565 Office Support 7/19-7/23 150.00 47565 Office Support 7/19-7/23 112.50 47565 Office Support 7/19-7/23 150.00 47565 Office Support 7/19-7/23 112.50 47565 Office Support 7/19-7/23 37.50 47565 Office Support 7/19-7/23 112.50 47565 Office Support 7/19-7/23 825.00 3,000.00Total for Check Number 50239: 0811 RAMSEY COUNTY 07/30/202150240 FLEET-000655 June parts and labor 1,980.00 FLEET-000655 June parts and labor 330.49 PRK-001942 Q2 Inspections 2,221.96 4,532.45Total for Check Number 50240: 10438 RON THE SEWER RAT 07/30/202150241 Page 6AP Checks by Date - Detail by Check Date (8/4/2021 3:23 PM) Check No Check DateVendor NameVendor No Check Amount Invoice No ReferenceDescription 25762357 2021 PMP sewer inspections 178.00 25767475 2021 PMP sewer inspections 178.00 25831990 2021 PMP sewer inspections 178.00 26397126 2021 PMP sewer inspections 178.00 712.00Total for Check Number 50241: 42,800.30Total for 7/30/2021: Report Total (59 checks): 437,497.84 Page 7AP Checks by Date - Detail by Check Date (8/4/2021 3:23 PM) Page 1 of 1 CONSENT ITEM – 7B MEMORANDUM DATE: August 9, 2021 TO: Honorable Mayor and City Councilmembers FROM: Dave Perrault, City Administrator SUBJECT: Amendment to Urban Requalification Joint Cooperation Agreement Budgeted Amount: Actual Amount: Funding Source: N/A N/A N/A Council Should Consider Motions to approve, table, or deny the following: • Amendment to Urban Requalification Joint Cooperation Agreement All items need a simple majority for action unless otherwise noted. Background The City of Arden Hills participates in the countywide program to receive and distribute Community Development Block Grant (CDBG) funds from the U.S. Department of Housing and Urban Development (HUD). The cooperation agreement with Ramsey County is usually renewed automatically unless a jurisdiction opts out or if an amendment must be approved. The attached agreement includes two new paragraphs for approval. The first paragraph is to reaffirm local commitment to the federal Fair Housing Act and the second paragraph is to prohibit the trade of federal funds for local funds. Budget Impact N/A Attachments Attachment A: Amendment to Urban Requalification Joint Cooperation Agreement 1 AMENDMENT TO JOINT COOPERATION AGREEMENT WHEREAS, the Ramsey County Housing and Redevelopment Authority ("Authority") and ____________________ ("Municipality"), each a political subdivision of the State of Minnesota, entered into a joint cooperative agreement dated August 19, 1985, as amended May 10, 2006 and June 24, 2015 ("Agreement"); and WHEREAS Title I of the Housing and Community Development Act of 1974, 42 U.S.C. § 5301 et seq., as amended, ("CDBG Act") provides for a program of community development block grants; and WHEREAS, computation of a county's population as an Urban County as that term is used in the CDBG Act included the Municipality with which it has entered into the Agreement to undertake or to assist in the undertaking of essential activities pursuant to community development block grants; and WHEREAS, HUD CPD Notices 19-04, 20-03, and 21-06 require that an Urban County requalifying in fiscal year (FY) 2021 for the FY 2022-2024 qualification period is required to make any necessary revisions to its cooperation agreements at the time that it requalifies; and WHEREAS, the Authority requalified for the FY 2022-2024 qualification period and therefore amends the Agreement. NOW, THEREFORE, the Parties agree to amend the Agreement as follows: 1. Paragraph 4 of the Agreement should be amended by the addition of the following: P. Both the Authority and Municipality must take all actions necessary to assure compliance with the certification required under section 104(b) of Title I of the Housing and Community Development Act of 1974, that the grant will be conducted and administered in conformity with Title VI of the Civil Rights Act of 1964, and the implementing regulations at 24 CFR part 1, and the Fair Housing Act, and the implementing regulations at 24 CFR part 100, and will affirmatively further fair housing. See 24 CFR § 91.225(a) and 5.105(a). Both Authority and Municipality must also comply with section 109 of Title I of the Housing and Community Development 2 Act of 1974, and the implementing regulations at 24 CFR part 6, which incorporates Section 504 of the Rehabilitation Act of 1973, and the implementing regulations at 24 CFR part 8, Title II of the Americans with Disabilities Act, and the implementing regulations at 28 CFR part 35, the Age Discrimination Act of 1975, and the implementing regulation at 24 CFR part 146, and Section 3 of the Housing and Urban Development Act of 1968. Authority and Municipality must also comply with other applicable laws. Funding is prohibited for activities in, or in support of, any Municipality that does not affirmatively further fair housing within its own jurisdiction or that impedes the county's actions to comply with the county's fair housing certification. This provision is required because noncompliance by a Municipality may constitute noncompliance by Authority that can, in turn, provide cause for funding sanctions or other remedial actions by the Department. Q. Municipality may not sell, trade, or otherwise transfer all or any portion of such funds to a metropolitan city, urban county, unit of general local government, or Indian tribe, or insular area that directly or indirectly receives CDBG funds in exchange for any other funds, credits, or non-Federal considerations, but must use such funds for activities eligible under Title I of the Housing and Community Development Act of 1974, as amended. 2. Except as modified herein, the terms of the Agreement shall remain in full force and effect. (Signature pages to follow) 3 RAMSEY COUNTY HOUSING AND REDEVELOPMENT AUTHORITY By: Ryan T. O’Connor Ramsey County Manager Dated: APPROVAL RECOMMENDED: Max Holdhusen Manager of Housing Development and Policy APPROVED AS TO FORM Amy Schmidt Assistant Ramsey County Attorney This Document Drafted By: Office of the Ramsey County Attorney 121 Seventh Place East, Suite 4500 Saint Paul, MN 55101 4 MUNICIPALITY By: Its: Dated: CONSENT ITEM – 7C MEMORANDUM DATE: August 9, 2021 TO: Honorable Mayor and City Councilmembers Dave Perrault, City Administrator FROM: Julie Hanson, City Clerk SUBJECT: New Tobacco License at Cub Discount Liquor, 3715 Lexington Avenue N Budgeted Amount: Actual Amount: Funding Source: $ $ Council Should Consider Motions to approve, table, or deny the following: • A new tobacco license at Cub Discount Liquor located at 3715 Lexington Avenue N. All items need a simple majority for action unless otherwise noted. Background/Discussion Cub Discount Liquor has applied for a new (initial) tobacco license. The liquor store has not previously held a tobacco license; however, Cub Foods (the grocery store) located at 3717 Lexington Avenue holds a current tobacco license (and renews such annually). Cub Discount Liquor holds a current liquor license as well as a business license (for a store/sale of items and a sign). A satisfactory background check has been conducted by the Ramsey County Sheriff’s Department. The Lake Johanna Fire Marshal noted that this site is inspected annually during the year-end license renewal period for the liquor license and confirmed there are no current fire-related concerns at this time. The Ramsey County Sheriff’s Office indicated that they would not conduct an inspection at this time but noted that the business must allow the Department of Revenue Staff to enter the business (without a search warrant) to inspect the premises, the records and tobacco products. It should be noted Cub Discount Liquor is aware of the City’s current ordinance regarding the restriction of flavored tobacco or tobacco-related products, was provided a copy of said ordinance, and subsequently elected to move forward with this process. Upon City Council approval, the tobacco license will be released to Cub Discount Liquor. This business’ tobacco license will become part of the annual renewal process and receive the associated site inspections at that time, should they choose to renew going forward. Budget Impact N/A Attachments N/A Page 1 of 1 CONSENT ITEM – 7D MEMORANDUM DATE: August 9, 2021 TO: Honorable Mayor and City Councilmembers Dave Perrault, City Administrator FROM: Julie Hanson, City Clerk SUBJECT: Premise Permit Application for Spring Lake Park Lions for Charitable Gambling at Welch’s Big Ten Tavern Budgeted Amount: Actual Amount: Funding Source: $ $ Council Should Consider Motions to approve, table, or deny the following: • Resolution 2021-043 approving a premise permit for Spring Lake Park Lions to conduct charitable gambling at Welsch’s Big Ten Tavern located at 4703 N Highway 10, Arden Hills for a period expiring June 30, 2022. All items need a simple majority for action unless otherwise noted. Background/Discussion The Spring Lake Park Lions (Applicant) have submitted an application to conduct charitable gambling Welch’s Big Ten Tavern. Note the Applicant previously held a permit to conduct gambling at this location and so is aware of the requirements which include providing financial reports to the City. The necessary premise permit fee has been paid, all paperwork has been provided (see attachments) and a satisfactory background check has been conducted by the Ramsey County Sheriff’s Department. City Code requires charitable gambling licenses to be approved by the City Council and renewed every two years. This current permit, if approved, will be renewed along with the City’s other charitable gambling permits in June 2022. Budget Impact N/A Attachments Attachment A: Resolution 2021-043 Attachment B: LG214 Minnesota’s Premises Permit Application Attachment C: LG215 Lease for Lawful Gambling Activity To view the final document, access adopted Resolutions via Arden Hills Public Laserfiche Weblink by visiting cityofardenhills.org and clicking on Archived Documents under Helpful Links on our main webpage. CITY OF ARDEN HILLS COUNTY OF RAMSEY STATE OF MINNESOTA RESOLUTION NO. 2021-043 APPROVING A PREMISE PERMIT APPLICATION FOR SPRING LAKE PARK LIONS FOR CHARITABLE GAMBLING AT WELSCH’S BIG TEN TAVERN NOW THEREFORE, BE IT RESOLVED by the City Council of the City of Arden Hills, Minnesota, that the City agrees to approve a Charitable Gambling License expiring June 30, 2022, to the Spring Lake Park Lions at Welsch’s Big Ten Tavern, 4703 N Highway 10, Arden Hills, MN. ADOPTED BY THE CITY COUNCIL OF THE CITY OF ARDEN HILLS THIS 9TH DAY OF AUGUST 2021. __________________________________________ David Grant, Mayor ATTEST: _________________________________________ Julie Hanson, City Clerk MINNESOTA LAWFUL GAM BLING LG214 Premises Permit Application 6lLS Page 1 of 2 Annua! Fee $15O (tot-nEFUNDAaT-r) REQUTRED ATTACHMENTS TO Lc2,^4 1. If the premises is leased, attach a copy of your lease. Use LG2l5 Lease for Lawful Gambling Activity. 2. $150 annual premises permit fee, for each permit (non-refundable) Make check payable to "State of Minnesota.,' Mail the application and required attachments to: Minnesota Gambling Control Board 1711 West County Road B, Suite 300 South Roseville, MN 55113 Questions? Call 651-539-1900 and ask for Licensing. ORGANIZATION IN FORMATION License Number: 00584Organization Name:Spring Lake Park Lions Chief Executive Officer (CEO)Deborah Roberge Daytime phone: 612-483-3962 Gambling Manag "r. Amanda Jackson Dayti me phone: 763-784-9t79 GAMBLING PREMISES INFORMATION Street address where premises is located: (Do not use a P.O. box number or mailing address.) 4703 Highw ay 10 Current name of site where gambling will be conducted. Welsch's Big Ten Tavern List any previous names for this location: City: Arden Hills OR Township County: Ramsey Zip Code: 551 12 Does your organization own the building where the gambling will be conducted? r' ./ Note: Bar bingo can only be conducted at a site where another form of lawful gambling is being conducted by the applying organi-zation or another permitted organization. Electronlc games can only be conducted at Jslte whire paper pultitabs are itayid. - r'Yes No Don't know Yes No Has your organization previously conducted gambling at this site? Yes Don't know A lease is not required if only a raffle will be conducted. Is any other organization conducting gambling at this site? No If no, attach LG215 Lease for Lawful Gambling Activity GAMBLING BANK ACCOUNT INFORMATION; MUST BE IN MINNESOTA Bank Nams; Northeast Bank Bank Street Address: 200 Coon Rapids Blvd City State: MN Zip Code: 55433 Bank Account Number. 10012805 Coon Rapids ALL TEMPORARY AND PERMANENT OFF-SITE STORAGE SPACES Address (Do not use a P.O. box number): MN IrlN City State: Zip Code: MN LG214 Premises Permit Application 6/LS Page 2 of 2 ACKNOWLEDGMENT BY LOCAL UNIT OF GOVERNMENT: APPROVAL BY RESOLUTION (If none, attach meeting minutes.) Signature of City Personnel: Local unit of government must sign. '€ l'rfnn.llr,lS Title:Date Signed: _ t _____f_-1 City Name CITY APPROVAL for a gambling premises located within city limits Date Approved by City Council: Resolution Number: (If none, attach meeting minutes.) Signature of County Personnel: Complete below only if required by the county. On behalf of the township, I acknowledge that the organization is applying to conduct gambling activity within the township limits. (A township has no statutory authority to approve or deny an application, per Minnesota Statutes 349.2L3, Subd. 2.) Date Signed: Date Signed: Title TOWNSHIP NAME: Print Township Name: County Name: Date Approved by County Board: Resolution Number: COUNTY APPROVAL for a gambling premises located in a township Signature of Township Officer: Title: ACKNOWLEDGMENT AND OATH 1. I hereby consent that local law enforcement officers, the Board or its agents, and the commissioners of revenue or public safety and their agents may enter and inspect the premises. 2. The Board and its agents, and the commissioners of revenue and public safety and their agents, are authorized to inspect the bank records of the gambling account whenever necessary to fulfill requirements of current gambling rules and law. 3. I have read this application and all information submitted to the Board is true, accurate, and complete. 4. All required information has been fully disclosed. 5. I am the chief executive officer of the organization. 6. I assume full responsibility for the fair and lawful operation of all activities to be conducted. 7. I will familiarize myself with the laws of Minnesota governing lawful gambling and rules of the Board and agree, if licensed, to abide by those laws and rules, including amendments to them. 8. Any changes in application information will be submitted to the Board no later than ten days after the change has taken effect. 9. I understand that failure to provide required information or providing false or misleading information may result in the denial or revocation of the license. 10. I understand the fee is non-refundable regardless of license approval/denial. D7 A/.A/ DateSignature of Chief Executive not sign) aAd esignee Data privacy notice: The information requestfd on this form (and any attachments) will be used by the Gambling Control Board (Board) to determine your organization's qualifications to be involved in lawful gambling activities in Minnesota. Your organization has the right to refuse to supply the information; however, if your organization refuses to supply this information, the Board may not be able to determine your organization's qualifications and, as a consequence, may refuse to issue a permit. If your organization supplies the information requested, the Board will be able to process your organization's application. Your organization's name and address will be public Information when received by the Board. All other information provided will be private data about your organization until the Board issues the permit. When the Board issues the permit, all information provided will become public. If the Board does not issue a permit, all information provided remains private, with the exception of your organization's name and address which will remain public. Private data about your organization are available to: Board members, Board staff whose work requires access to the information; Minnesota's Department of Public Safety, Attorney General, Commissioners of Administration, Minnesota Management & Budget, and Revenue; Legislative Auditor, national and international gambling regulatory agencies; anyone pursuant to court order; other individuals and agencies specifically authorized by state or federal law to have access to the information; individuals and agencies for which law or legal order authorizes a new use or sharing of information after this notice was given; and anyone with your written consent. This form will be made available in alternative format, i.e. large print, braille, upon request. An equal opportunity employer MINNESOTA LAWFUL GAM BLING LG215 Lease for Lawful Gambling Activity 6/LS Page 1 of 2 Llcense/Site Number: 00584 Daytime Phone: .',1 . 763-784-9L79nnLake Park Lions Organizatlon: Address: 8433 Center Drive State: Zipz MN 55432Lake Park al Clty S Street Address: 4703 Highway 10Welsch's Bi Ten Tavern Name of Leased Premlses: City: Arden Hills ztp: 551 12 State: MN Daytlme Phone: 651-633-7253 Name of Legal Owner: John J Welsch Business/Street Address : 4703 Highway 10 Clty: Arden Hills State: MN zip: ssi 12 Daytime Phone: 5s1-633-72s3 AddressName of Lessor (lf rrme ar legal own€r, wrlte "SAlrlE"): SAME Daytime Phone:Clty:State: Zip Check @E appllcable ltem:ilw or tmended l€asG. Effecttve date; .9:12.9?!-. Submit changes at least ten days betorc the effective date of the change. Ncwownei.Effectivedate:-.submltnewleasewlthlntendaysafternewlessorassumesownership' ( Iiectronic games may or'ly be condtrcted: 1. at a premises licensed for the on-sale of intoxicating liquor or the on-sale of 3.2o/o malt beverages; or 2. at a premises where blngo is conducted as the primary business and has a seating capacity of at least 100. r' r' r' V g E[l Putl-Tabs (paper)Electronlc Pull-Tabs Electronic Linked Bingo Tipboards Paddlewheel r Paddlewheel with table Pull-Tabs (paper) wlth disPensing devlce Bar Blngo f]ainoo '' sales of gambllng equlpment are conducted by an employee/volunteer of a llcensed organization atBOOTH OPERATIO}I: SOME OT the leased premises. ALL GAtlES, lncludlng electrcnlc o Total rent pald from all organl r The rent cap does not lnclude gtmGr: Monthly rent to be paid: o/o, not to exceed 1oolo of gross proflts for that month. zlflons for only booth operatlons at the leased premises may not exceed $1r75O. BAR OPERATION rent for electronlc games conducted by the Jessor. equlpment conducted by the lessor or lessor's employee.BAR OPERATION: All sales of g 9am€s and electronlc llnked blngo 9ames. ALL OIHER GAlilES: Hont}|ly rent to be Pald: 20 06, not to exceed 20r|6 of gross Profits from all other forms of lawful gambllng''--. rii"v-u""urEbs conducted ov i rriensra;-rganrzltlon at the premlses, rirnt may not exceed 1oq6 of gross profits for that month and ls Subled to boo$ oPeratlgn ll,r3o cap' of the gross proflts for that month from electronic pull-tabELECTRONIC GAMES: Monthly rent to be pald:t5 o/o, not to exceed 15o/o -oR- o R?tc to be pald: $ per square foot, not to exceed 110o/o of a comparable cost per approved uy tne director of the Gambling Control Board. The lessor must attach documentation, confirm the compiriul" r.te and all appl'icable costs to be paid by the organization to the lessor. '; ,= ,r3qnt.mey 4pt be pald fof blr blngo. ,.\ .-,-^- | i "'Bu'r blngodoLs not include blngo games linked to other permltted premises. folthe lowionetoofBIntrelsmIted ngngo n oVIctlesUtdheudnbmabnafroalmlawfun9IIIrosstheofexceeto10o/o profigmonthlydnotolobeotoRentpald bi odxclbarungoccaslons,dlng square foot for leased sPace, as verified by the organization, to lease may be termlnated by either party'ivlth a written 30 . day notice. other terms: ar commitmentWelsch's Bl mber of 2024 - this lease is a 310 Tavern will not term lnate this lease before S irll[i {*i'.-' :1,il:r\ tli-., LGZIS Lease for Lawful Gambling Activity 6/tS Page 2 of 2 Other Prohlbltlons: The lessor wlll not lmpose restrlcflons on the organlzation with respect to providers (distributor or linked blngo game provlder) of gambling-related equlpment and ser- vices or in the use of net profits for lawful purposes. The lessor, the lessor's lmmedlatd fbmily, Bhy person reslding in the same resldence as the lessor, and any agents or employees of the lessor wlll not requlre the organlzatlon to perform any actlon that would vlolate statute or rule. The lessor must not modlfy or termlnate thls lease ln whole or in part due to the lessor's vlolatlon of thls provlslon. If there ls a dlspute as to whether a vlolatlon occurred, the lease wlll remain in effect pend- lng a final determlnatlon by the Compllance Review Group (CRG) of the Board. The lessor agrees to arbitration when a violation of thls provlslon ls alleged. The arbitrator shall be the CRG. Access to Permltted Premlees: Consent is glven to the Board and lts agents, the commissioners of revenue and public safety and thelr agents, and law enforcement personnel to enter and lnspect the permitted premlseg at any reasonable time during the buslness hours of the lessor. The organization has access to the premises during any tlme reasonable and when necessary for the conduct of lawful gambllng. Leccor Recorde: The lessor must maintaln a record of all money recelved from the organizatlon, and make the record available to the Board and lts agents, and the commissloners of revenue and public safety and their agents upon demand. The record must be maintalned for 3-L/2 years. Rent All-Incluslve: Amounts pald as rent by the organizatlon to the'lessor?re all-lnclusive, No other servlces or expenses provlded or contracted by the lessor may be paid by the organi- zatlon, lncluding but not limited to:- trash removal electrlcity, heat ;-rCvV i'€ITIOVEi rage itorlal and cleaning services er utilitles or servlces awn services rity, securlty monltorlng of any communlcation neti^rork or servlce required to nduct electronlc pull-tabs games or electronic bingo n the case of bar operatlons, cash shortages. Any er expendltures made by an organization that ls related toa eased premlses must be approved by the dlrector of the Bqa . Rent payments may not be made to an lndlvldual. & Leace Term: The term of thls agreement wlll be concurrent wlth the premlses permlt lssued by the Gambllng Control Board (Board). Management: The owner of the premlses or the lessor wlll not manage the conduct of lawful garmbllng at the premises. The organlzatlon may not conduct any activity on behalf of the lessor on thq leased'premlses. Partlclpatlon sr Playcru Prohiblted: The lessor wlll not par- ticlpate dlrectly or indirectly as a player in any lawful gambling conducted on the premlses, The lessor's lmmediate famlly and any agents or gambllng employees of the lessor wlll not partlcl- pate as players ln the'conduct of lawful gambllng on the premls- es, except as authorlzed by Minnesota Statutes, Section 349.181. Illega! Gambllng: The lessor ls aware of the prohlbltion agalnst lllegal gambllng ln Mlnnesota Statutes 609.75, and thO penaltles for lllegal gambling violi'tlons ln Minnesota Rules 7865.0220, Subpart 3. In addition, the Board may authorize the organlzation to withhold rent for,g perlod of up to 90 days lf the Board determlnes that lllegal gambllng occulred on the premlses or that the lessor or lts employees paftlclpated ln the lllegal gambling or knew of the gambllng and dld hot take prompt actlon to stop the gambllng. ConUnued tenancy of the organlza- tion ls authorlzed wlthout payment of rent durlng the tlme period determlned by the Board for vlolatlons of thls provision, as authorlzed by Minnesota Statutes, Sectlon 349.18, Subd. 1(a). To the best of the lessor's knowledEe, the lessor afflrms that ony and all games or devlces located'0n the premises are not belng used, and aft, not capable of belng used, ln a manner that vlolates the prohlbltions against illegal gambling ln Mlnntisota Statutes. Sectlon 609.75. Notwlthstandlng Mlnnesota Rules 7865.0220, Subpart 3, an organizafrgn m\rsc concinue inakirrg rent ;.rdynrenls u;nde;" the teims of thli lease, lf the organizaUon or its agents are found to be solely responslble for any illegal gambllng, conducted at this site, that ls prohlblted by Minnesota Rules 7861.0260, Subpart 1, item H, or Mlnnesota Statutes, Sectlon 609.75, unless the organlzatlon's agents responslble for the lllegal gambllng actlvlty are also agents or employels of the lessor. The lesloi must not modifo or termlnate the lease ln whole or ln part because the organEafion reported, to a state or locdl law enforcement authorlty or to the Bbard, the conduct of lllegal gambllng actlvlty at this site in whlch the organization dld not <l!.! 3 ) 10 Tavern will not terminate this lease before Se mber of 2024 - this lease is a mber of 2024 a 30 wrltte notice may terminate the lease. As stated on Welsch'sae1 ree nte en ethtotanondmbetweaYag andse SUareedU1tolseaorattach bjea r commltment. After Se the approval of the dlrector of the Gambling Control Board. and the organlzatlon, ?rd that all obligations andI affirm that thls lease ls the agreements aro contalned ln Other termc of the lease: Si al (Lessee):Date:re of Organlzatlonre o M7-Date: dt S Prl Name and Title of Lessee: r? of Lessor;me andPrl (l.e lved by uested Mall or fax lease to: Mlnnesota Gambllng Control Board 1711 W. County Road B, Suite 300 South Rosevllle, MN 55113Fax: 651-639-4032 artrj'lr.:ili'r {.$liYi i -..:l 4L Page 1 of 2 CONSENT ITEM – 7E MEMORANDUM DATE: August 9, 2021 TO: Honorable Mayor and City Councilmembers Dave Perrault, City Administrator FROM: David Swearingen, Interim Public Works Director SUBJECT: 2018 PMP Street and Utility Improvements Project – Change Order No. 8 and Final Payment Budgeted Amount: Actual Amount: Funding Source: $3,300,000 $3,137,577.20 PIR, Special Assessments, Utility Funds Council Should Consider Motions to approve, table, or deny the following: • Approve Change Order No. 8 in the amount of $8,794.05. • Approve Final Payment for the 2018 PMP Street and Utility Improvements Project in the amount of $169,458.28 to Northwest Asphalt. All items need a simple majority for action unless otherwise noted. Background/Discussion On March 26, 2018, the City Council adopted Resolution 2018-034 Awarding the 2018 Street and Utility Improvement Project to Northwest Asphalt, Inc. in the amount of $2,491,595.86 which since has been revised to $2,623,981.66 due to contract changes. The project reached substantial completion on November 12, 2019. The final punch list items have been completed by the contractor, therefore, this project is ready for close out. Page 2 of 2 Change Order No. 8 (Attachment B), included repairs to a sanitary sewer service located within the project area that affected 1392 Indian Oaks Trail and adjusting a storm sewer structure to correct a drainage issue. It was determined the issues were related to the 2018 PMP and needed to be corrected. Staff and WSB are recommending approving Change Order No. 8, in the amount of $8,794.05. The recommended Payment No. 11 (Attachment C) is the Final Payment for the 2018 PMP Streets and Utility Improvement project, which includes Change Order No. 8, in the amount of $169,458.28. With approval of the Final Payment, this project will be closed out. Budget Impact WSB has provided a recommendation to approve Payment No. 11 in the amount of $169,458.28, bringing the total amount paid to date to $2,553,065.58. Payment Voucher No. 11 is Attachment B, which includes all the work completed for the project, all change orders and retainage to be paid in full for project close out. The following is a summary of the revised contract amount for the 2018 Street and Utility Improvement Project. Initial Contract Amount: $2,491,595.86 Change Order No. 1 $ 40,408.53 Change Order No. 2 $ 5,705.00 Change Order No. 3 $ 28,210.00 Change Order No. 4 $ 4,597.00 Change Order No. 5 $ 3,128.00 Change Order No. 6 $ 39,324.30 Change Order No. 7 $ 2,218.92 Change Order No. 8 $ 8,794.05_ Total: $2,623,981.66 Attachments Attachment A: WSB Cover Letter Attachment B: Change Order No. 8 Attachment C: Pay Voucher No. 11 K:\010111-000\Admin\Construction Admin\Pay Vouchers\Pay Voucher No. 11\R-010111-000 CST LTR VO 11 CTY-d swearingen-07292021.docx July 29, 2021 Mr. David Swearingen, P.E. Interim Public Works Director City of Arden Hills 1245 West Highway 96 Arden Hills, MN 55112 Re: Construction Final Pay Voucher No. 11 2018 Street and Utility Improvement Project City Project No. PW-17-0102 City of Arden Hills, MN WSB Project No. R-010111-000 Dear Mr. Swearingen, Please find enclosed Construction Final Pay Voucher No. 11 in the amount of $169,458.28 for the above-referenced project. The quantities completed to date have been reviewed and agreed upon by the contractor, and we hereby recommend that the City of Arden Hills approve Construction Final Pay Voucher No. 11 in the amount of $169,458.28 for Northwest Asphalt, Inc. The Contractor has submitted all required project closeout documentation, including IC-134’s, final lien waivers and the two-year maintenance bond and Consent of Surety for the project. Once processed, please keep one copy for your records and return two copies to our office, one for the contractor and one for our files. If you have any questions or comments regarding the enclosed, please contact me at 952.737.4675. Thank you. Sincerely, WSB Monica Heil, PE Project Manager Attachments tmw 701 XENIA AVENUE S | SUITE 300 | MINNEAPOLIS, MN | 55416 | 763.541.4800 | WSBENG.COM Page 1 of 2 CONSENT ITEM – 7F MEMORANDUM DATE: August 9, 2021 TO: Honorable Mayor and City Councilmembers Dave Perrault, City Administrator FROM: David Swearingen, Interim Public Works Director SUBJECT: 2021 Concrete Improvements Project – Payment No. 1 Budgeted Amount: Actual Amount: Funding Source: $65,000 $65,064.50 Surface Water (604-49550-44030) Part of In-House Paving $ 5,050.50 General Fund, Street Maintenance Council Should Consider Motions to approve, table, or deny the following: • Approval of Payment No. 1 for the 2021 Concrete Improvements project to Pember Companies in the amount of $66,609.25 All items need a simple majority for action unless otherwise noted. Background/Discussion On May 24, 2021 City Council approved a construction contract with Pember Companies for the 2021 Concrete Improvements project. This project included a list of miscellaneous concrete repairs to address failing curb, flatwork, and repairing storm sewer catch basins. Pember Companies has since completed all of the contract items and City Staff has confirmed the work through inspections. 5% retainage of $3,505.75 will still be held as areas disturbed from construction are monitored for restoration. City staff recommends approving Payment No. 1 in the amount of $66,609.25 to Pember Companies. Page 2 of 2 Budget Impact The 2021 Operating Budget for the Surface Water Management Fund includes funding for repairs to drainage assets, including curbs and catch basins in the amount of $65,000 under 604- 49550-44030. All work items included in this project are associated with surface drainage or subsurface water causing heaving and damage to flatwork. Staff also used this contract to repair catch basins and damaged curb within the 2021 Public Works In-House Paving project. There are sufficient funds budgeted in the General Fund to cover the In-House Paving project costs. 2021 Concrete Improvements $59,964.50 – Surface Water Mgmt Fund 2021 PW In -House Paving catch basins $ 5,100.00 – Surface Water Mgmt Fund 2021 PW In-House Paving curbing $ 5,050.50 – General Fund, Street Maintenance Actual Constructed Total $70,115.00 Attachments Attachment A: Pay Request No. 1 – Pember Companies Menomonie, WI 54751-5436N4449 469th StreetPEMBER COMPANIES, INC.PEMBER COMPANIES, INC.REQUEST FOR PAYMENT7/6/2021Invoice date: Period ending date:12402To:From:7/22/20211245 Hwy. 96 W.Arden Hills, MN 55112Invoice:City of Arden HillsProject: 21-0514-01 ARDEN HILLS, MN-2021 CONCRETEREQUEST FOR PAYMENT:$5,257.05$0.00$3,505.75$70,115.00$71,866.30$0.00$71,866.30Less Previous Requests:Remaining Contract to Bill:Original Contract Amount:Net Change Orders:Revised Contract Amount:Contract Completed to Date:Date: ________________________________________By: __________________________________________My commission expires:Notary PublicSubscribed and sworn to before me this ______ day of _____________,__________CONTRACTOR:I hereby certify that the work performed and the materials supplied to date, as shown on the above represent the actual value of the accomplishment under the terms of theContract (and all authorized changes thereof) between the undersigned and the City of Arden Hills relating to the above referenced project. I also certify that the contractor haspaid all amounts previously billed and paid by the owner.Current Request for Payment:$66,609.25State Of WisconsinCounty Of DunnRetainage:PAYMENT RECOMMENDED:PAYMENT APPROVED :Engineer SignaturePrinted Name and TitleDate:Owner SignatureDate:Printed Name and TitleJuly 22, 2021 Detail Page 2 of 3 PagesInvoice:AmountAmountCONTRACTEDUnit ofMeasureBidQuantityUnit PriceAmountCURRENTTOTAL TO DATEQuantity Quantity Units toFinishDescriptionItemIDREQUEST FOR PAYMENT DETAILProject: 21-0514-01 / ARDEN HILLS, MN-2021 CONCRETE12402Period Ending Date:7/6/202110MOBILIZATION15,000.0015,000.001.00LS15,000.001.001.0015,000.0020TRAFFIC CONTROL3,635.003,635.001.00LS3,635.001.001.003,635.0030REMOVE CONCRETE CURB & GUTTER1,600.001,600.00160.00LF10.00160.00160.001,600.0040CURB & GUTTER DEISGN B6185,680.005,680.00160.00LF35.50160.00160.005,680.0050MILL BITUMINOUS SURFACE 2"1,680.0084.00SY20.0084.0060BITUMINOUS TACK COAT42.004.20GAL10.004.2070SPWEB240C WEARING COURSE MIX3,429.309.66TON355.009.6680ADJUST FRAME & RING CASTING40,800.0044,200.00 -2.0026.00EA1,700.0024.0026.0044,200.009000MOBILIZATION0.001.00LS 1.009010SUPERINTENDENT0.001.00LS 1.009020WARRANTY COSTS0.001.00LS 1.0070,115.00Totals71,866.3070,115.00 Detail Page 3 of 3 PagesInvoice:AmountAmountCONTRACTEDUnit ofMeasureBidQuantityUnit PriceAmountCURRENTTOTAL TO DATEQuantity Quantity Units toFinishDescriptionItemIDREQUEST FOR PAYMENT DETAILProject: 21-0514-01 / ARDEN HILLS, MN-2021 CONCRETE12402Period Ending Date:7/6/2021 CO CO Amount CO Item and Description0.00Total Change Order amount Page 1 of 2 CONSENT ITEM – 7G MEMORANDUM DATE: August 9, 2021 TO: Honorable Mayor and City Councilmembers Dave Perrault, City Administrator FROM: David Swearingen, Interim Public Works Director SUBJECT: Lexington Avenue and Target Rd Signal System Feasibility Report Budgeted Amount: Actual Amount: Funding Source: $323,000 $198,916.75 Special Assessments Per current CIP estimate Street light portion Council Should Consider Motions to approve, table, or deny the following: • Resolution 2021-044 receiving the feasibility report for the potential traffic signal system as part of the Lexington Avenue Reconstruct Project and ordering the improvement hearing. All items need a simple majority for action unless otherwise noted. Background/Discussion On February 22, 2021, City Council approved professional services with Alliant Engineering and approved Resolution 2021-011 to prepare a feasibility report on the proposed traffic signal system improvements at the intersection of Lexington Avenue North and Target Rd as part of the Ramsey County led Lexington Avenue Reconstruct Project. The feasibility report was prepared for the Cities of Shoreview and Arden Hills to document proposed improvements, project costs, funding, and assessments for a new traffic signal system installed as part of the Ramsey County Lexington Avenue Reconstruction Project. The full feasibility report can be reviewed in Attachment A. The 2013 Master Planned Unit Development (PUD) agreement, Attachment C, for the Lexington Station commercial site includes access and cost participation requirements related to the proposed Target Road traffic signal. The master PUD agreement states that full development of the Lexington Station commercial property will include a new access driveway aligned with Target Road to replace the current access point along Lexington Avenue. The new access is Page 2 of 2 required to include the proposed traffic signal at Target Road based on a completed traffic study. The master PUD agreement further requires the developer of the Lexington Station site to pay for or accept an assessment against the project property for the cost of the access improvements, including the traffic signal. Staff recommends approving Resolution 2021-044 to receive the feasibility report and order a Public Improvement Hearing for the traffic signal improvements as part of the Lexington Avenue Reconstruct Project. Budget Impact The total fee for the feasibility report is $5,570.00. The City of Shoreview has agreed to split the cost, therefore, the City of Arden Hills fee total is $2,785.00 From the feasibility report, the total estimated improvements costs for the traffic signal is $191,385.00. To date the City has also incurred some other legal and engineering costs attributed to this project in the amount of $4,746.75. This brings the total estimated costs to $198,916.75. All costs for this improvement are assessed to the benefitting properties as outlined on pages 5 through 7 of the feasibility report. Attachments Attachment A – Feasibility Report – Alliant Attachment B – Resolution 2021-044 Attachment C – Master PUD Agreement >ĞǆŝŶŐƚŽŶ ǀĞŶƵĞ ZĞĐŽŶƐƚƌƵĐƚŝŽŶ WƌŽũĞĐƚ WƌĞƉĂƌĞĚ&Žƌ͗ ŝƚǇŽĨƌĚĞŶ,ŝůůƐ ŝƚǇŽĨ^ŚŽƌĞǀŝĞǁ ŝƚǇŽĨƌĚĞŶ,ŝůůƐWƌŽũĞĐƚEŽ͘ϭϴͲϬϭϬϰ ŝƚǇŽĨ^ŚŽƌĞǀŝĞǁWƌŽũĞĐƚEŽ͘ϮϭͲϬϭ WƌĞƉĂƌĞĚǇ͗ ϳϯϯDĂƌƋƵĞƚƚĞǀĞŶƵĞ^ŽƵƚŚ͕^ƵŝƚĞϳϬϬ DŝŶŶĞĂƉŽůŝƐ͕DEϱϱϰϬϮ &ĞĂƐŝďŝůŝƚǇZĞƉŽƌƚ :ƵůǇϮϳ͕ϮϬϮϭ Attachment A ddĂďůĞŽĨŽŶƚĞŶƚƐ ,,QWURGXFWLRQ ,,3URMHFW6FRSH ,,,([LVWLQJ&RQGLWLRQV ,93URSRVHG,PSURYHPHQWV 93XEOLF,QIRUPDWLRQ0HHWLQJV 9,7UDIILF$QDO\VLV 9,,(VWLPDWHG3URMHFW&RVWV 9,,,)LQDQFLQJDQG$VVHVVPHQWV ,;3URMHFW6FKHGXOH ;)HDVLELOLW\1HFHVVLW\DQG&RVW(IIHFWLYHQHVV ;,&RQFOXVLRQ (;+,%,76 ([KLELW± 3URMHFW/RFDWLRQ0DSVHHSDJH ([KLELW /H[LQJWRQ$YHQXH/D\RXW $33(1',&(6 $SSHQGL[$±$UGHQ+LOOV&LW\&RXQFLO5HVROXWLRQ1R$SSURYLQJ3URMHFW $SSHQGL[%±6KRUHYLHZ&LW\&RXQFLO5HVROXWLRQ1R$SSURYLQJ3URMHFW $SSHQGL[&±6XSSRUWLQJ7UDIILF$QDO\VLV)LJXUHV $SSHQGL['±/H[LQJWRQ$YHQXH5HFRQVWUXFWLRQ,WR&5(7UDIILF6WXG\±$SULO $SSHQGL[(±/H[LQJWRQ6WDWLRQ3KDVH&RQFHSW3ODQ±)HEUXDU\ $SSHQGL[)±(QJLQHHUV(VWLPDWHIRU5DPVH\&RXQW\/H[LQJWRQ$YHQXH3URMHFW $SSHQGL[*±5DPVH\&RXQW\3XEOLF:RUNV&RVW3DUWLFLSDWLRQ3ROLF\ $SSHQGL[+±%HQHILWLQJ3URSHUWLHV0DS $SSHQGL[,±3UHOLPLQDU\$VVHVVPHQW5ROOV3HQGLQJ $SSHQGL[-±&LW\RI$UGHQ+LOOV$VVHVVPHQW3ROLF\ ,,QWURGXFWLRQ 5DPVH\&RXQW\LQFRRSHUDWLRQZLWKWKH&LW\RI $UGHQ+LOOVDQGWKH&LW\RI6KRUHYLHZKDV SURJUDPPHGD\HDUUHFRQVWUXFWLRQRI /H[LQJWRQ$YHQXH&6$+EHWZHHQ, DQG&RXQW\5RDG(/H[LQJWRQ$YHQXHIRUPV WKHERUGHUEHWZHHQWKH&LW\RI$UGHQ+LOOVDQG WKH&LW\RI6KRUHYLHZ7KHSURMHFWORFDWLRQLV VKRZQLQ([KLELW)LQDOGHVLJQKDVEHHQ FRPSOHWHGIRUWKHSURMHFWDQGFRQVWUXFWLRQLV DQWLFLSDWHGWREHJLQLQWKHVSULQJRI.H\ LPSURYHPHQWVFRQVLVWRISDYHPHQW UHFRQVWUXFWLRQJHRPHWULFVSHGHVWULDQDQG ELF\FOHIDFLOLWLHVSXEOLFXWLOLWLHVDQGWUDIILF VLJQDOV\VWHPVLQFOXGLQJFRQVWUXFWLRQRIDQHZ VLJQDOL]HGLQWHUVHFWLRQDWWKHH[LVWLQJ7DUJHW 5RDGLQWHUVHFWLRQ 7KHSURSHUWLHVDGMDFHQWWR/H[LQJWRQ$YHQXHLQWKH SURMHFWDUHDFRQVLVWSULPDULO\RIUHWDLODQGVHUYLFHUHODWHGODQGXVHV/H[LQJWRQ$YHQXHSURYLGHVDFFHVVWR DVPDOOUHVLGHQWLDOQHLJKERUKRRGRQ,VODQG/DNH$YHQXHWRWKHHDVWRIWKHFRUULGRUYLD*UH\)R[5RDG 7KHSURSHUW\DORQJ/H[LQJWRQ$YHQXHZLWKLQWKHSURMHFWOLPLWVLVGHYHORSHGZLWKWKHH[FHSWLRQRI&RXQW\ SDUNODQGORFDWHGRQWKHHDVWVLGHRI/H[LQJWRQ$YHQXHEHWZHHQWKH&DQDGLDQ3DFLILF5DLOURDGWUDFNVDQG ,VODQG/DNH$YHQXH /H[LQJWRQ6WDWLRQLVDQH[LVWLQJPXOWLXVHGHYHORSPHQWORFDWHGLQWKHVRXWKZHVWFRUQHURIWKH/H[LQJWRQ $YHQXHDQG5HG)R[5RDGLQWHUVHFWLRQ7KHH[LVWLQJEXLOGLQJORFDWHGDW/H[LQJWRQ$YHQXH1RUWK LVSODQQHGIRUGHPROLWLRQZLWKDSURSRVHG3KDVHH[SDQVLRQRIWKH/H[LQJWRQ6WDWLRQGHYHORSPHQW7KH GHYHORSHUKDVFRRUGLQDWHGDFFHVVWRWKH/H[LQJWRQ6WDWLRQ3KDVHSURSHUW\ZLWK5DPVH\&RXQW\DQGWKH &LW\RI$UGHQ+LOOV$VSDUWRIWKHDJUHHPHQWEHWZHHQDOOSDUWLHVWKHH[LVWLQJDFFHVVSRLQWWR/H[LQJWRQ 6WDWLRQEHWZHHQ7DUJHW5RDGDQG5HG)R[5RDGZLOODOVREHUHPRYHG 7KHSURSRVHGQHZDFFHVVWR/H[LQJWRQ6WDWLRQZLOOIRUPDIRXUWKOHJDWWKHH[LVWLQJ7DUJHW5RDG LQWHUVHFWLRQ$QHZVLJQDOV\VWHPZLOOEHFRQVWUXFWHGE\5DPVH\&RXQW\ZLWKWKH/H[LQJWRQ$YHQXH 5HFRQVWUXFWLRQ3URMHFW7KHLQWHUVHFWLRQLVFXUUHQWO\XQVLJQDOL]HGZLWKVLGHVWUHHWVWRSFRQWURORQ7DUJHW 5RDG&RRUGLQDWLRQEHWZHHQWKH/H[LQJWRQ6WDWLRQGHYHORSHUDQGWKHRZQHUVRI/H[LQJWRQ$YHQXH DQG/H[LQJWRQ$YHQXHFRQFOXGHGWKDWWKHSURSHUW\RZQHUVPD\EHDPHQDEOHWRFRRUGLQDWLQJFURVV DFFHVVDJUHHPHQWVWRSURYLGHVKDUHGDFFHVVWRWKHVLJQDOL]HGLQWHUVHFWLRQDW7DUJHW5RDG7KHUHLVDQ H[LVWLQJFURVVDFFHVVDJUHHPHQWLQSODFHEHWZHHQWKHRZQHUVRIDQG/H[LQJWRQ$YHQXHWR VKDUHDFRPPRQGULYHZD\7KHSURSRVHG&RXQW\5RDGLPSURYHPHQWVZLOOFRQVWUXFWDFRQWLQXRXVPHGLDQ DORQJ/H[LQJWRQ$YHQXHHIIHFWLYHO\FRQYHUWLQJWKHH[LVWLQJDFFHVVWR/H[LQJWRQ$YHQXHDQG /H[LQJWRQ$YHQXHWRDULJKWLQULJKWRXWDFFHVV7KH&RXQW\LVQRWSDUW\WRFURVVDFFHVVDJUHHPHQWVDQG FRRUGLQDWLRQZLOOUHTXLUHZLOOLQJSDUWLFLSDWLRQRIDOODIIHFWHGSURSHUWLHV7KH&RXQW\¶V/H[LQJWRQ$YHQXH SURMHFWGRHVQRWLQFOXGHFRQVWUXFWLRQRIDSK\VLFDOGULYHZD\FRQQHFWLRQIURP/H[LQJWRQ6WDWLRQWRVHUYH WKHSURSHUWLHVWRWKHVRXWK,PSURYHPHQWVZRXOGKDYHWREHFRQVWUXFWHGE\WKHSULYDWHSDUWLHVWRSURYLGH VKDUHGDFFHVV ([KLELW±3URMHFW/RFDWLRQ0DS $WUDIILFVWXG\ZDVSUHSDUHGLQIRUWKH5DPVH\&RXQW\UHFRQVWUXFWLRQSURMHFW7KHWUDIILFVWXG\LV LQFOXGHGLQWKH$SSHQGL['/HIWWXUQPRYHPHQWVRXWRI/H[LQJWRQ6WDWLRQDQG7DUJHWVRXWKHQWUDQFHRQ 7DUJHW5RDGH[SHULHQFHVLJQLILFDQWGHOD\XQGHUPLGGD\DQGSPSHDNKRXUYROXPHVFXUUHQWO\7KH UHGHYHORSPHQWRIWKH/H[LQJWRQ6WDWLRQVLWHZLOOIXUWKHUH[DFHUEDWHWUDIILFRSHUDWLRQVRQ/H[LQJWRQ $YHQXH5DPVH\&RXQW\DJUHHGWRFRQVLGHUDWUDIILFVLJQDOV\VWHPDW7DUJHW5RDGLQWHUVHFWLRQWR LPSURYHDFFHVVDQGVDIHW\7KHUHDUHH[LVWLQJVLJQDOL]HGLQWHUVHFWLRQVLQFORVHSUR[LPLW\DW*UH\)R[ 5RDGDQG5HG)R[5RDG7KHFRQYHUVLRQRI7DUJHW5RDGWRDIXOOVLJQDOL]HGLQWHUVHFWLRQGRHVQRWPHHW WKH&RXQW\¶VDFFHVVVSDFLQJJXLGHOLQHV:LWKRXWSULYDWHDFFHVVQHHGVDQGGHYHORSPHQWGHPDQGIRUD WUDIILFVLJQDODW7DUJHW5RDGWKH&RXQW\ZRXOGQRWQRUPDOO\LQVWDOODWUDIILFVLJQDOV\VWHPDWWKDWORFDWLRQ )RUWKLVUHDVRQWKH&RXQW\GHHPVWKHFRVWRIWKHVLJQDOV\VWHPWREHDORFDOFRVW3HUWKH&RXQW\¶V DGRSWHGFRVWVKDULQJSROLF\IRUURDGZD\LPSURYHPHQWSURMHFWVLQFOXGHGLQ$SSHQGL[*ORFDODJHQFLHV DUHUHVSRQVLEOHIRUIXQGLQJWUDIILFVLJQDOVFRUUHVSRQGLQJWRORFDOURDGOHJVRIWKHLQWHUVHFWLRQ 7KHLPSURYHPHQWVLQFOXGHGLQWKLVSURMHFWKDYHEHHQLGHQWLILHGWKURXJKWKHUHVXOWRIDWUDIILFVWXG\DQG FRRUGLQDWLRQZLWK5DPVH\&RXQW\ZKRPDLQWDLQVDQGRSHUDWHVWKHURDGZD\7KHLPSURYHPHQWVDUH FRQVLVWHQWZLWKWKH&LW\RI$UGHQ+LOOVDQG&LW\RI6KRUHYLHZ&RPSUHKHQVLYH3ODQVIRUWKHDUHD7KURXJK HYDOXDWLRQRIWKHVHLQIUDVWUXFWXUHFRPSRQHQWVDQGLQSXWIURPSURSHUW\RZQHUVWKH(QJLQHHULQJ 'HSDUWPHQWVDUHUHFRPPHQGLQJWKHVHLPSURYHPHQWVWRWKH&LW\&RXQFLOV ,IWKH&RXQFLOVGHFLGHWRSURFHHGZLWKWKHVHLPSURYHPHQWVWKHQH[WVWHSLQWKHSXEOLFLPSURYHPHQW SURFHVVZRXOGEHWRFRQGXFWIRUPDOSXEOLFLPSURYHPHQWKHDULQJV$GGLWLRQDOLQIRUPDWLRQUHJDUGLQJ SRWHQWLDOSXEOLFKHDULQJGDWHVFDQEHIRXQGLQWKH6FKHGXOHVHFWLRQEHORZ ,,3URMHFW6FRSH 7KHVFRSHRIWKLVUHSRUWLVWRDQDO\]HWKHWUDIILFVLJQDOV\VWHPDQGDVVRFLDWHGJHRPHWULFLPSURYHPHQWVDW 7DUJHW5RDGWRGHWHUPLQHWKHHQJLQHHULQJDQGILVFDOIHDVLELOLW\RISURYLGLQJWKHQHFHVVDU\LPSURYHPHQWV 7KHVWXG\ZLOOGLVFXVVWKHH[LVWLQJFRQGLWLRQVSURSRVHGLPSURYHPHQWVHVWLPDWHGFRQVWUXFWLRQFRVWVDQG RYHUKHDGFRVWVLHDGPLQLVWUDWLRQHQJLQHHULQJILVFDODQGOHJDOH[SHQVHV&XUUHQWSXEOLFLPSURYHPHQW SROLFLHVDGRSWHGE\WKH$UGHQ+LOOVDQG6KRUHYLHZ&LW\&RXQFLOVZLOOEHXVHGDVDJXLGHOLQHWRGLVFXVV ILQDQFLQJPHWKRGVIRUWKHSURSRVHGLPSURYHPHQWV ,,,([LVWLQJ&RQGLWLRQV /H[LQJWRQ$YHQXHLVPDLQWDLQHGDQGRSHUDWHGE\5DPVH\&RXQW\([LVWLQJ/H[LQJWRQ$YHQXHKDVIRXU WKURXJKODQHVDQGDFRQWLQXRXVOHIWWXUQODQHDWWKH7DUJHW5RDGLQWHUVHFWLRQ7KHWKUHHOHJJHG LQWHUVHFWLRQLVFXUUHQWO\VWRSFRQWUROOHGRQWKH7DUJHW5RDGOHJWRWKHHDVW7DUJHW5RDGRQWKHHDVWVLGHRI /H[LQJWRQ$YHQXHLVDSODWWHGURDGZD\KRZHYHUWKHURDGWHUPLQDWHVDWWKH7DUJHWVWRUH([LVWLQJ7DUJHW 5RDGHVVHQWLDOO\RSHUDWHVDVDIXOODFFHVVSRLQWIRU7DUJHWDQGRWKHUGHYHORSHGSDUFHOVRQWKHHDVWVLGHRI /H[LQJWRQ$YHQXH7KHUHLVDSDYHGPXOWLXVHWUDLODORQJWKHHDVWVLGHRI/H[LQJWRQ$YHQXH7KHUHDUH FXUUHQWO\QRGHGLFDWHGSHGHVWULDQDQGELF\FOHIDFLOLWLHVDORQJWKHZHVWVLGHRI/H[LQJWRQ$YHQXHDW7DUJHW 5RDG7KH/H[LQJWRQ$YHQXHFRUULGRULVDOVRVHUYHGE\PXOWLSOHEXVURXWHV ,93URSRVHG,PSURYHPHQWV /H[LQJWRQ$YHQXHZLOOEHUHFRQVWUXFWHGWKURXJKRXWWKHSURMHFWOLPLWVZLWKDFRQWLQXRXVFHQWHUPHGLDQ 1RUWKERXQGDQGVRXWKERXQGOHIWDQGULJKWWXUQODQHVZLOOEHSURYLGHGDWLQWHUVHFWLRQV$QDGGLWLRQDOOHJ ZLOOEHDGGHGWRWKH7DUJHW5RDGLQWHUVHFWLRQRQWKHZHVWVLGHRI/H[LQJWRQ$YHQXHWRSURYLGHDFFHVVWR WKH/H[LQJWRQ6WDWLRQGHYHORSPHQWDQGSRWHQWLDOO\DGGLWLRQDOSURSHUWLHVWRWKHVRXWK7KHSURSHUWLHV VRXWKRI/H[LQJWRQ6WDWLRQ/H[LQJWRQ$YHQXHDQG/H[LQJWRQ$YHQXHPD\KDYHWKH RSSRUWXQLW\WRFRQQHFWWRWKHQHZLQWHUVHFWLRQOHJYLDFURVVDFFHVVDJUHHPHQWVLIWKHSDUWLHVFDQZRUNRXW DJUHHPHQWVZLWKIDFLOLWDWLRQDVVLVWDQFHIURPWKH&LW\RI$UGHQ+LOOVDQGZRUNWRJHWKHUWRFRQVWUXFWD VPDOOVHJPHQWRIFRQQHFWLQJGULYHZD\SDYHPHQW7KHH[LVWLQJ/H[LQJWRQ6WDWLRQGULYHZD\RQWR /H[LQJWRQ$YHQXHZLOOEHUHPRYHG7KHQHZVLJQDOL]HGLQWHUVHFWLRQZLOOLPSURYHDFFHVVWRSURSHUWLHVRQ ERWKVLGHVRI/H[LQJWRQ$YHQXHE\SURYLGLQJFRQWUROOHGDFFHVVZKLFKZLOOSURYLGHRSHUDWLRQDODQGVDIHW\ EHQHILWVIRUDOOPRGHVRIWUDYHOWKURXJKWKHLQWHUVHFWLRQ 5DPVH\&RXQW\KDVPDGHWKHGHWHUPLQDWLRQWKDWWKHQHHGIRUWKHWUDIILFVLJQDOV\VWHPDW7DUJHW5RDGLV VROHO\GULYHQE\DGMDFHQWGHYHORSPHQWDQGSULYDWHDFFHVVQHHGVDQGWKHUHIRUHFRVWUHVSRQVLELOLW\IRU FDSLWDOFRVWVWRSURFXUHDQGLQVWDOOWKHVLJQDOV\VWHPVKRXOGEHSDLGIRUE\WKHORFDODJHQFLHV3HUWKH &RXQW\¶VFRVWVKDULQJSROLF\HDFKFLW\ZLOOEHUHVSRQVLEOHIRUWKHLUOHJVRIWKHVLJQDOV\VWHPDQGLQWKLV FDVHHDFKFLW\ZRXOGDOVREHUHVSRQVLEOHIRURQHRIWKHOHJVRQ/H[LQJWRQ$YHQXH 93XEOLF,QIRUPDWLRQ0HHWLQJV 5DPVH\&RXQW\3XEOLF:RUNVFRQGXFWHGWZRSXEOLFRSHQKRXVHVGXULQJWKHGHVLJQSKDVHRIWKHSURMHFW 7KHLQLWLDOSXEOLFRSHQKRXVHZDVKHOGRQ'HFHPEHU7KHLQLWLDORSHQKRXVHLQFOXGHG SUHVHQWDWLRQRIPDWHULDOVUHJDUGLQJH[LVWLQJFRQGLWLRQVDQGVROLFLWHGLQSXWIURPWKHSXEOLFWRKHOSJXLGH WKHLPSURYHPHQWSURMHFW$VHFRQGSXEOLFRSHQKRXVHZDVKHOGRQ$SULOWRSUHVHQWGHVLJQ DOWHUQDWLYHVDQGVROLFLWIHHGEDFNRQWKHSUHIHUUHGDOWHUQDWLYH6HHWKH6FKHGXOHVHFWLRQEHORZIRU LQIRUPDWLRQRQDQWLFLSDWHG3XEOLF+HDULQJGDWHV 9,7UDIILF$QDO\VLV $WUDIILFDQDO\VLVZDVSHUIRUPHGWRGHWHUPLQHHVWLPDWHGYHKLFOHWULSJHQHUDWLRQIRUSURSHUWLHVWKDWZRXOG EHQHILWIURPWKHQHZWUDIILFVLJQDOV\VWHPDQGDVVRFLDWHGJHRPHWULFLPSURYHPHQWVDW7DUJHW5RDG'XH WRQRQW\SLFDOWUDIILFSDWWHUQVGXULQJWKH&RYLGSDQGHPLFYHKLFOHFRXQWVDWWKHSURMHFWVLWHWR GHWHUPLQHWULSVXWLOL]LQJLQGLYLGXDOGULYHZD\VFRXOGQRWEHFROOHFWHG$OOLDQW(QJLQHHULQJ,QFGHYHORSHG HVWLPDWHGWULSVIRUHDFKSRWHQWLDOEHQHILWWLQJSURSHUW\RQERWKVLGHVRI/H[LQJWRQ$YHQXH7ULSVZHUH HVWLPDWHGXVLQJWKH,QVWLWXWHRI7UDQVSRUWDWLRQ(QJLQHHUV7ULS*HQHUDWLRQ0DQXDOWK(GLWLRQEDVHGRQ DVVXPHGQXPEHURIWULSVIRUHDFKODQGXVHFDWHJRU\IRUWKHH[LVWLQJSURSHUWLHVSHUWKHLUFXUUHQWXVH)XWXUH ODQGXVHIRU/H[LQJWRQ6WDWLRQ3KDVHLVEDVHGRQWKHGHYHORSHU¶VSURSRVHGFRQFHSWSODQGDWHG)HEUXDU\ LQFOXGHGLQ$SSHQGL[(7KHFRQFHSWSODQIRU/H[LQJWRQ6WDWLRQ3KDVHSURSRVHVD VTXDUHIHHWJURFHU\VWRUH%XVLQHVVKRXUVZHUHDQDO\]HGDQGWULSVZHUHGHWHUPLQHGIRUW\SLFDOZHHNGD\ 6DWXUGD\DQG6XQGD\WRGHWHUPLQHWRWDOZHHNO\WULSVIRUHDFKSDUFHO7KHJHQHUDWHGZHHNO\WRWDOWULSV ZKHUHWKHQDVVLJQHGWRWKHDGMDFHQWURDGZD\QHWZRUNEDVHGRQWKHGLUHFWLRQDOGLVWULEXWLRQGHILQHGLQ 5DPVH\&RXQW\¶V/H[LQJWRQ$YHQXH5HFRQVWUXFWLRQ7UDIILF6WXG\DWWDFKHGLQ$SSHQGL[(DQG HQJLQHHULQJMXGJHPHQW 7ULSJHQHUDWLRQZDVSUHSDUHGIRUWZRVFHQDULRVZLWKGLIIHUHQWDFFHVVFRQGLWLRQVRQWKHQHZO\FRQVWUXFWHG ZHVWOHJRIWKHLQWHUVHFWLRQ 6FHQDULR±7KLVVFHQDULRDVVXPHVDJUHHPHQWVFDQEHZRUNHGRXWEHWZHHQWKH/H[LQJWRQ$YHQXH DQG/H[LQJWRQ$YHQXHSURSHUWLHVDQGWKH/H[LQJWRQ6WDWLRQ3KDVHRZQHUWRSURYLGHFURVVDFFHVV DOORZLQJWKH/H[LQJWRQ$YHQXHDQG/H[LQJWRQ$YHQXHSURSHUWLHVWRDFFHVVWKHVLJQDOL]HG LQWHUVHFWLRQ 6FHQDULR±7KLVVFHQDULRDVVXPHVWKDWWKHRQO\EHQHILWWLQJSURSHUW\RQWKHZHVWVLGHRIWKHLQWHUVHFWLRQ LV/H[LQJWRQ6WDWLRQ/H[LQJWRQ$YHQXHDQG/H[LQJWRQ$YHQXHZRXOGKDYHDULJKWLQULJKW RXWDFFHVVWR/H[LQJWRQ$YHQXH1RGULYHZD\FRQQHFWLRQZRXOGEHPDGHEHWZHHQ/H[LQJWRQ6WDWLRQDQG WKHSURSHUWLHVWRWKHVRXWK $VXPPDU\RIWKHWRWDOZHHNO\WKURXJKWULSVDQGSHUFHQWRIZHHNO\WULSVWRHDFKEHQHILWWLQJSDUFHOIRU 6FHQDULRDQG6FHQDULRLVLQFOXGHGLQ$SSHQGL[& 9,,(VWLPDWHG3URMHFW&RVWV 7KHWRWDOHVWLPDWHGFRQVWUXFWLRQFRVWVIRUWKH5DPVH\&RXQW\UHFRQVWUXFWLRQSURMHFWLV 7KHHVWLPDWHGFRVWVIRUWKHSURSRVHG7DUJHW5RDGWUDIILFVLJQDOV\VWHPLPSURYHPHQWVDUHDVVKRZQEHORZ LQ7DEOH 7DEOH±(VWLPDWHG&RQVWUXFWLRQ&RVWV 7UDIILF&RQWURO6LJQDO6\VWHP& 7UDIILF&RQWURO6LJQDO6\VWHP& (PHUJHQF\9HKLFOH3UHHPSWLRQ6\VWHP& 3URUDWHG,WHPV$VEXLOW0RELOL]DWLRQ)LHOGRIILFH7\SH'0RGLILHG 7UDIILF&RQWURO 7RWDO(VWLPDWHG&RQVWUXFWLRQ&RVWV &LW\RI$UGHQ+LOOV6KDUHRI(VWLPDWHG&RQVWUXFWLRQ&RVWV±7UDIILF&RQWURO6LJQDO6\VWHP& 7UDIILF&RQWURO6LJQDO6\VWHP& (PHUJHQF\9HKLFOH3UHHPSWLRQ6\VWHP& 3URUDWHG,WHPV &LW\RI$UGHQ+LOOV7RWDO(VWLPDWHG&RQVWUXFWLRQ&RVWV &LW\RI6KRUHYLHZ6KDUHRI(VWLPDWHG&RQVWUXFWLRQ&RVWV±7UDIILF&RQWURO6LJQDO6\VWHP& 7UDIILF&RQWURO6LJQDO6\VWHP& (PHUJHQF\9HKLFOH3UHHPSWLRQ6\VWHP& 3URUDWHG,WHPV &LW\RI6KRUHYLHZ7RWDO(VWLPDWHG&RQVWUXFWLRQ&RVWV 1RWH3URUDWHGLWHPVFRVWLVVKDUHGDFURVVDOOLWHPVEDVHGRQSHUFHQWDJHRIRYHUDOOFRQVWUXFWLRQFRVWV (QJLQHHULQJDQGFRQVWUXFWLRQDGPLQLVWUDWLRQDQGLQVSHFWLRQFRVWVZLOOEHERUQHE\5DPVH\&RXQW\DQG LQGLUHFWO\E\WKHSURMHFWDJHQF\SDUWQHUV7KHIXWXUHRSHUDWLQJDQGPDLQWHQDQFHFRVWVLQFOXGLQJSRZHU FRVWVIRUWKHVLJQDOV\VWHPZLOOEHDGGUHVVHGLQDVHSDUDWHDJUHHPHQWEHWZHHQWKHDJHQFLHV (QJLQHHULQJFRVWVDUHH[SHFWHGWREHDSSUR[LPDWHO\RIWKHWRWDOFRQVWUXFWLRQFRVWV%LGGLQJVHUYLFHV FRQVWUXFWLRQDGPLQLVWUDWLRQLQVSHFWLRQDQGPDWHULDOVWHVWLQJFRVWVDUHH[SHFWHGWREHDSSUR[LPDWHO\ RIWKHWRWDOFRQVWUXFWLRQFRVWV 7RWDOHVWLPDWHG&LW\FRVWVIRUWKHSURSRVHG7DUJHW5RDGWUDIILFVLJQDOV\VWHPLPSURYHPHQWVDUHVKRZQLQ 7DEOH 7DEOH±(VWLPDWHG&LW\,PSURYHPHQW&RVWV 7UDIILF6LJQDO6\VWHP& &LW\RI$UGHQ+LOOV7RWDO(VWLPDWHG&RQVWUXFWLRQ&RVWV (QJLQHHULQJ %LGGLQJ&RQVWUXFWLRQ$GPLQLVWUDWLRQ,QVSHFWLRQDQG7HVWLQJ &LW\RI$UGHQ+LOOV7RWDO(VWLPDWHG,PSURYHPHQW&RVWV &LW\RI6KRUHYLHZ7RWDO(VWLPDWHG&RQVWUXFWLRQ&RVWV (QJLQHHULQJ %LGGLQJ&RQVWUXFWLRQ$GPLQLVWUDWLRQ,QVSHFWLRQDQG7HVWLQJ &LW\RI6KRUHYLHZ7RWDO(VWLPDWHG,PSURYHPHQW&RVWV 7RWDO,PSURYHPHQW&RVWV 9,,,)LQDQFLQJDQG$VVHVVPHQWV 7KHLPSURYHPHQWVGLVFXVVHGLQWKLVUHSRUWIRUWKH7DUJHW5RDGWUDIILFVLJQDOV\VWHPUHTXLUHGDVSDUWRIWKH /H[LQJWRQ$YHQXH5HFRQVWUXFWLRQ3URMHFWDUHDQWLFLSDWHGWREHILQDQFHGWKURXJKVSHFLDODVVHVVPHQWVWR EHQHILWHGSURSHUWLHVDFFRUGLQJWRWKH&LWLHV$VVHVVPHQW3ROLFLHV $OORIWKHSURSHUW\RZQHUVZKRZRXOGUHFHLYHEHQHILWVIURPWKHSURSRVHGWUDIILFVLJQDOV\VWHPDQGZKR ZRXOGEHDVVHVVHGIRUDOORUDSRUWLRQRIWKHLPSURYHPHQWVDUHOLVWHGRQWKH3URSRVHG$VVHVVPHQW5ROOVLQ $SSHQGL[,RIWKLVUHSRUW7KHDVVHVVPHQWVSUHDGVKHHWVLQGLFDWHWKHRZQHUWKHDGGUHVVRIWKHSURSHUW\ DQGWKHDPRXQWRIWKHSURSRVHGDVVHVVPHQWEDVHGRQWKHDVVLJQPHQWRIYHKLFXODUWULSV 7KH&LWLHVDVVHVVPHQWSUDFWLFHVIRUSXEOLFLPSURYHPHQWVDOORZIRUWKHGLVWULEXWLRQRIWKHSURSRVHG DVVHVVPHQWVIRUFRPPHUFLDOSURSHUWLHVIRUXSWRD\HDUSHULRG 7KH&LW\RI$UGHQ+LOOV$VVHVVPHQW3ROLF\LVLQFOXGHGLQ$SSHQGL[- 7KHSURSHUWLHVZLWKGLUHFWDFFHVVWR/H[LQJWRQ$YHQXHYLDWKHQHZ7DUJHW5RDGLQWHUVHFWLRQDQGZKLFK DUHWKHUHIRUHEHQHILWWLQJIURPWKHSURSRVHGLPSURYHPHQWVDQGUHTXLULQJQRWLILFDWLRQDUHOLVWHGLQ7DEOH DQGDUHVKRZQRQWKHPDSLQ$SSHQGL[+ 7DEOH±%HQHILWWLQJ3URSHUWLHV %HQHILWWLQJ3URSHUWLHVLQ$UGHQ+LOOV 3DUFHO,' $GGUHVV /H[LQJWRQ$YHQXH1$UGHQ+LOOV01 /H[LQJWRQ$YHQXH1$UGHQ+LOOV01 /H[LQJWRQ$YHQXH1$UGHQ+LOOV01/H[LQJWRQ6WDWLRQ /H[LQJWRQ$YHQXH1$UGHQ+LOOV01/H[LQJWRQ6WDWLRQ /H[LQJWRQ$YHQXH1$UGHQ+LOOV01/H[LQJWRQ6WDWLRQ %HQHILWWLQJ3URSHUWLHVLQ6KRUHYLHZ 3DUFHO,' $GGUHVV /H[LQJWRQ$YHQXH16KRUHYLHZ01 /H[LQJWRQ$YHQXH16KRUHYLHZ01 7KH&LW\RI$UGHQ+LOOVDQGWKH&LW\RI6KRUHYLHZDUHHDFKUHVSRQVLEOHIRURIWKHWUDIILFVLJQDO V\VWHPFRVWV7KHHVWLPDWHGDVVHVVPHQWDPRXQWIRUHDFKEHQHILWWLQJSURSHUW\LVVKRZQLQ7DEOHIRU 6FHQDULRDQG7DEOHIRU6FHQDULR(VWLPDWHGDVVHVVPHQWFRVWVDUHEDVHGRQWKHSHUFHQWDJHRIWRWDO WULSVWREHQHILWWLQJSDUFHOVZLWKLQHDFKFLW\ 7DEOH±3URSRVHG$VVHVVPHQW6XPPDU\ 6FHQDULR 6FHQDULR$UGHQ+LOOV$VVHVVPHQWV WĞƌĐĞŶƚŽĨ WĞƌĐĞŶƚŽĨ tĞĞŬůǇ tĞĞŬůǇ dŚƌŽƵŐŚdƌŝƉƐdŽƚĂů 3DUFHO,' 7KURXJK7ULSV LQ$UGHQ+LOOV$VVHVVPHQW ϯ͘ϳϬй 1RWH3DUFHOVDQGDUHWKH/H[LQJWRQ6WDWLRQ GHYHORSPHQW7RWDODVVHVVPHQWVDUHFRPELQHGIRUDOO/H[LQJWRQ6WDWLRQSDUFHOV 6FHQDULR6KRUHYLHZ$VVHVVPHQWV WĞƌĐĞŶƚŽĨ WĞƌĐĞŶƚŽĨ tĞĞŬůǇ tĞĞŬůǇ dŚƌŽƵŐŚdƌŝƉƐdŽƚĂů 3DUFHO,' 7KURXJK7ULSV LQ6KRUHYLHZ$VVHVVPHQW ϳϳ͘ϴϳй 7DEOH±3URSRVHG$VVHVVPHQW6XPPDU\ 6FHQDULR 6FHQDULR$UGHQ+LOOV$VVHVVPHQWV WĞƌĐĞŶƚŽĨ WĞƌĐĞŶƚŽĨ tĞĞŬůǇ tĞĞŬůǇ dŚƌŽƵŐŚdƌŝƉƐdŽƚĂů 3DUFHO,' 7KURXJK7ULSV LQ$UGHQ+LOOV$VVHVVPHQW 6FHQDULR6KRUHYLHZ$VVHVVPHQWV WĞƌĐĞŶƚŽĨ WĞƌĐĞŶƚŽĨ tĞĞŬůǇ tĞĞŬůǇ dŚƌŽƵŐŚdƌŝƉƐdŽƚĂů 3DUFHO,' 7KURXJK7ULSV LQ6KRUHYLHZ$VVHVVPHQW ϳϳ͘ϴϲй 1RWH3DUFHOVDQGDUHWKH/H[LQJWRQ6WDWLRQ GHYHORSPHQW7RWDODVVHVVPHQWVDUHFRPELQHGIRUDOO/H[LQJWRQ6WDWLRQSDUFHOV ,;3URMHFW6FKHGXOH 5DPVH\&RXQW\DQWLFLSDWHVWKHIROORZLQJELGGLQJDQGFRQVWUXFWLRQVFKHGXOH %LGV2SHQHG1RYHPEHU &RXQW\%RDUGDZDUGV%LG'HFHPEHU 5DPVH\&RXQW\%HJLQV&RQVWUXFWLRQ$SULO &RQVWUXFWLRQ6XEVWDQWLDOO\&RPSOHWH1RYHPEHU 7KHSURSRVHGSURMHFWVFKHGXOHLVDVIROORZVIRUHDFK&LW\ 352326('352-(&76&+('8/(±$5'(1+,//6 &LW\&RXQFLOUHFHLYHV)HDVLELOLW\5HSRUW$XJXVW &LW\&RXQFLORUGHUV3XEOLF,PSURYHPHQW+HDULQJ $XJXVW &LW\&RXQFLODSSURYHV3ODQVDQG6SHFLILFDWLRQV6HSWHPEHU &LW\&RXQFLOVHWVGDWHIRU$VVHVVPHQW+HDULQJ6HSWHPEHU &LW\&RXQFLOKROGV$VVHVVPHQW+HDULQJ2FWREHU 352326('352-(&76&+('8/(6+25(9,(: &LW\&RXQFLOUHFHLYHV)HDVLELOLW\5HSRUW$XJXVW &LW\&RXQFLORUGHUV3XEOLF,PSURYHPHQW+HDULQJ $XJXVW &LW\&RXQFLODSSURYHV3ODQVDQG6SHFLILFDWLRQV6HSWHPEHU &LW\&RXQFLOVHWVGDWHIRU$VVHVVPHQW+HDULQJ6HSWHPEHU &LW\&RXQFLOKROGV$VVHVVPHQW+HDULQJ2FWREHU ;)HDVLELOLW\1HFHVVLW\DQG&RVW(IIHFWLYHQHVV 7KHSURSRVHGWUDIILFVLJQDOLPSURYHPHQWVDW7DUJHW5RDGLQFOXGHGLQWKH/H[LQJWRQ$YHQXH 5HFRQVWUXFWLRQ3URMHFWDUHIHDVLEOHIURPDQHQJLQHHULQJVWDQGSRLQWQHFHVVDU\DQGFRVWHIIHFWLYHLI FRQVWUXFWHGDVSDUWRIWKH&RXQW\SURMHFWDVSURSRVHG7KHVHLPSURYHPHQWVZRXOGJUHDWO\LPSURYHWKH VDIHW\DQGPRELOLW\IRUDOOXVHUVLQFOXGLQJLPSURYHGDFFHVVWRFRPPHUFLDOSURSHUWLHVRQERWKVLGHVRI /H[LQJWRQ$YHQXH 7KHLPSURYHPHQWVFDQPRVWHIIHFWLYHO\DQGHFRQRPLFDOO\EHFRQVWUXFWHGLIXQGHUWDNHQWKURXJKD FRRUGLQDWHGFRQWUDFWDVSDUWRIWKH&RXQW\SURMHFWWKDWZRXOGFDXVHWKHLPSURYHPHQWVWREHLQVWDOOHGLQ WKHSURSHUVHTXHQFH ;,&RQFOXVLRQ 2XUUHFRPPHQGDWLRQWRWKH&LW\&RXQFLOLVWKDWLILPSURYHPHQWVDUHWREHFRQVWUXFWHGWKDWWKHWUDIILF VLJQDOV\VWHPDQGDVVRFLDWHGJHRPHWULFLPSURYHPHQWVEHLQVWDOOHGDVSURSRVHGLQWKLVIHDVLELOLW\UHSRUW 7KHHVWLPDWHGFRVWRIWKHVHLPSURYHPHQWVLQFOXGLQJWKHSURSRVHGDVVHVVPHQWVLVUHDVRQDEOHDQG FRPSDUDEOHZLWKVLPLODULPSURYHPHQWVEHLQJFRQVWUXFWHGLQRWKHUFLWLHVLQWKHPHWURSROLWDQDUHD ǆŚŝďŝƚϮ >ĞǆŝŶŐƚŽŶǀĞŶƵĞ>ĂǇŽƵƚ COUNTY ROAD ECANADIAN PACIFIC RAILROADISLAND LAKE AVE1103GOODWILL1195ESTREET FLATS3585WALGREENS1160AMERICANRED CROSSCARIBOU COFFEEGEORGES SHOESSUBWAYTMOBILEALLSTATECHINA EXPRESSGREAT CLIPSUPSH&R BLOCKNAILS 3000TOBACCONUTMEG BREWHOUSECLEAN N PRESSDAVANNIS3717CUB FOODS36733720AMBASSADORBAPTISTCHURCH10901084107610723592SUPERAMERICA1080ODDSANDENDSAGAIN3600STEPHENS ARTCENTENNIAL JEWLERSEDWARD JONESPIZZA HUTPIPES CIGARSTOP SHELF ATHLETICSGREY FOX RD13' THRU13' THRU13' LEFT (170')11' THRU13' THRU6' BLVD6' BLVD10' TRAIL1:5 TAPER (55')10' LEFT 13' THRU/RIGHT 13' THRU 1:10 TAPER (110')1:10 TAPER (110')8' WALK6' BLVD6' BLVD10' TRAILSTORMWATER-- --POND LOCATIONLEXINGTON AVENUECOUNTY ROAD ETOGREY FOX RDLEGENDCONCRETE SURFACEBITUMINOUS SURFACEPARCEL BOUNDARYINPLACE RIGHT OF WAYTRAFFIC FLOW ARROWS GREY FOX RDRED FOX RDTARGET RD3737PACE INDUSTRIES3751ARBYS3757BIG OTIRES3761ENTERPRISE3775 - 3785JIMMY JOHNSBALANCE FOR LIFEBINDERY PLUSPAPA MURPHYSJIM LAABS PIANOSOLIVE ME CHIRO3833NOODLES AND COFROZEN YOGURTFANTASTIC SAMSROYAL NAILSPAPA JOHNSAT&TGNCPOTBELLYSTARBUCKS3836TCFBANK3780RAISINGCANES3800TARGET3760YMCA3720AMBASSADORBAPTISTCHURCHGREY FOX RD10' LEFT 13' THRU/RIGHT 13' THRU 13' THRU13' THRU13' LEFT (175')11' THRU11' THRU13' RIGHT (225')1:10 TAPER (110')1:10 TAPER (110')1:10 TAPER (110')1:10 TAPER (110')1:10 TAPER (110')10' TRAIL13' THRU13' THRU13' THRU13' THRU1:10 TAPER (110')1:10 TAPER (110')VARIABLE (5' - 20') MEDIANLEXINGTON AVENUEGREY FOX RDTORED FOX RDLEGENDCONCRETE SURFACEBITUMINOUS SURFACEPARCEL BOUNDARYINPLACE RIGHT OF WAYTRAFFIC FLOW ARROWS RED FOX RDI-694 SBI-694 NB3833NOODLES AND COFROZEN YOGURTFANTASTIC SAMSROYAL NAILSPAPA JOHNSAT&TGNCPOTBELLYSTARBUCKS3855PERKINS1125QUALITY INN3854EXXON CIRCLE K3836TCFBANK1051WENDYS11' LEFT (320')11' THRU11' THRU13' LEFT (260')13' THRU13' THRU13' THRU13' THRU13' RIGHT (225')1:5 TAPER (110')1:5 TAPER (55')6' BLVD10' TRAIL1:5 TAPER (55')13' THRU13' THRU1:10 TAPER (110')VARIABLE (5' - 20') MEDIAN5' MEDIANLEXINGTON AVENUERED FOX RDTOI-694LEGENDCONCRETE SURFACEBITUMINOUS SURFACEPARCEL BOUNDARYINPLACE RIGHT OF WAYTRAFFIC FLOW ARROWS ƉƉĞŶĚŝǆ ƌĚĞŶ,ŝůůƐŝƚǇŽƵŶĐŝůZĞƐŽůƵƚŝŽŶEŽ͘ϮϬϮϭͲϬϭϭ 1 To view the final document, access adopted Resolutions via Arden Hills Public Laserfiche Weblink by visiting cityofardenhills.org and clicking on Archived Documents under Helpful Links on our main webpage. CITY OF ARDEN HILLS COUNTY OF RAMSEY STATE OF MINNESOTA RESOLUTION NO. 2021-011 RESOLUTION ORDERING THE PREPARATION OF FEASIBILITY REPORT FOR THE LEXINGTON AVENUE IMPROVEMENT PROJECT WHEREAS, the Capital Improvement Program for the City of Arden Hills identifies potential street and utility improvements for Lexington Avenue; and WHEREAS, the proposed improvements to Lexington Avenue include the installation of a new traffic control signal system at the intersection of Lexington Avenue and Target Road; and WHEREAS, the proposed traffic signal at Target Road would provide access improvements to the Lexington Station development site located in the southwest quadrant of Lexington Avenue and Red Fox Road; and WHEREAS, the Master Planned Unit Development Agreement for Lexington Station specifies that the developer of the Lexington Station site will be required to pay for or accept an assessment against the property for the cost of access improvements to Lexington Avenue. NOW, THEREFORE, BE IT RESOLVED THAT THE CITY COUNCIL OF THE CITY OF ARDEN HILLS: That the proposed Target Road traffic signal and associated access improvements stated above shall be referred to as the Lexington Avenue Traffic Signal at Target Road for study and that the City Engineer is instructed to report to the Council with all convenient speed advising the Council in a preliminary way as to whether the proposed improvement is necessary, cost-effective, and feasible and as to whether it should best be made as proposed or in connection with some other improvement, and the estimated cost of the improvement as recommended. PASSED AND ADOPTED BY THE CITY COUNCIL OF THE CITY OF ARDEN HILLS THIS 22nd DAY OF FEBRUARY 2021. ________________________________ Mayor Attest: ______________________________ City Clerk Attachment A ƉƉĞŶĚŝǆ ^ŚŽƌĞǀŝĞǁŝƚǇŽƵŶĐŝůZĞƐŽůƵƚŝŽŶEŽ͘ϮϭͲϭϮ ƉƉĞŶĚŝǆ ^ƵƉƉŽƌƚŝŶŐdƌĂĨĨŝĐŶĂůǇƐŝƐ&ŝŐƵƌĞƐ ĐĐĞƐƐ^ĐĞŶĂƌŝŽϭ>ĂŶĚhƐĞ;/dŽĚĞͿ WĂƌĐĞů/ ƵƐŝŶĞƐƐͬĞǀĞůŽƉŵĞŶƚ hŶŝƚƐ ^ŝǌĞ^ŝŶŐůĞtĞĞŬĚĂǇdƌŝƉƐ^ĂƚƵƌĚĂǇdƌŝƉƐ^ƵŶĚĂǇdƌŝƉƐdŽƚĂůtĞĞŬůǇdƌŝƉƐ;ϭͿWĞƌĐĞŶƚdƌŝƉŝƐƚƌŝďƵƚŝŽŶdŚƌŽƵŐŚ^ŝŐŶĂůdŽƚĂůtĞĞŬůǇdƌŝƉƐdŚƌŽƵŐŚ^ŝŐŶĂůWĞƌĐĞŶƚŽĨdŽƚĂůtĞĞŬůǇdƌŝƉƐdŚƌŽƵŐŚ^ŝŐŶĂů&ƌĞĞͲ^ƚĂŶĚŝŶŐŝƐĐŽƵŶƚ^ƵƉĞƌƐƚŽƌĞ;ϴϭϯͿ ϮϲͲϯϬͲϮϯͲϯϮͲϬϬϭϯ dĂƌŐĞƚ ^ƋƵĂƌĞ&ĞĞƚ'&ϭϴϮ͕ϱϬϬ ϵ͕Ϯϱϰ ϭϭ͕ϲϳϬ ϭϬ͕Ϯϭϰ ϲϴ͕ϭϱϰ ϰϬ͘Ϭй Ϯϳ͕ϮϲϮϰϮ͘ϱϯй^ŚŽƉƉŝŶŐĞŶƚĞƌ;ϴϮϬͿ;ϮͿϮϳͲϯϬͲϮϯͲϰϭͲϬϬϮϮ͕ϮϳͲϯϬͲϮϯͲϰϭͲϬϬϮϯ ^ƋƵĂƌĞ&ĞĞƚ'& ϯϮ͕ϱϬϬ Ϯ͕ϴϬϬ ϰ͕ϰϬϬ ϯ͕ϲϬϬ'ƌŽĐĞƌǇ;ϴϱϰͿ ϮϳͲϯϬͲϮϯͲϰϭͲϬϬϮϰ ^ƋƵĂƌĞ&ĞĞƚ'& ϰϯ͕ϬϬϬ ϯ͕ϵϬϴ ϰ͕ϴϭϬ ϰ͕ϮϵϬdŝƌĞ^ƵƉĞƌƐƚŽƌĞ;ϴϰϵͿ ϮϳͲϯϬͲϮϯͲϰϭͲϬϬϮϬ ŝŐKdŝƌĞƐͬŶƚĞƌƉƌŝƐĞͬDŝĚǁĞƐƚƵƚŽĞƚĂŝůŝŶŐ ^ƋƵĂƌĞ&ĞĞƚ'&ϭϬ͕ϱϬϬ Ϯϭϰ ϮϬϬ Ϭ ϭ͕ϮϳϬ ϴϱ͘Ϭй ϭ͕ϬϴϬϭ͘ϲϴй&ĂƐƚͲ&ŽŽĚZĞƐƚĂƵƌĂŶƚǁͬƌŝǀĞͲdŚƌŽƵŐŚ;ϵϯϰͿ ϮϳͲϯϬͲϮϯͲϰϭͲϬϬϮϭ ƌďǇΖƐ ^ƋƵĂƌĞ&ĞĞƚ'&ϯ͕ϬϬϬ ϭ͕ϰϭϰ ϭ͕ϴϰϴ ϭ͕ϰϭϴ ϭϬ͕ϯϯϲ ϳϱ͘Ϭй ϳ͕ϳϱϮϭϮ͘Ϭϵй&ĂƐƚͲ&ŽŽĚZĞƐƚĂƵƌĂŶƚǁͬƌŝǀĞͲdŚƌŽƵŐŚ;ϵϯϰͿ ϮϲͲϯϬͲϮϯͲϰϭͲϬϬϮϰ ZĂŝƐŝŶŐĂŶĞΖƐ ^ƋƵĂƌĞ&ĞĞƚ'&ϯ͕ϬϬϬ ϭ͕ϰϭϰ ϭ͕ϴϰϴ ϭ͕ϰϭϴ ϭϬ͕ϯϯϲ ϳϱ͘Ϭй ϳ͕ϳϱϮϭϮ͘Ϭϵй'&с'ƌŽƐƐ&ůŽŽƌƌĞĂ;ϭͿdŽƚĂůtĞĞŬůǇdƌŝƉƐс;ϱǆ^ŝŶŐůĞtĞĞŬĚĂǇdƌŝƉƐͿн^ĂƚƵƌĚĂǇdƌŝƉƐн^ƵŶĚĂǇdƌŝƉƐ;ϮͿ^ŚŽƉƉŝŶŐĞŶƚĞƌ^ƵŶĚĂǇƚƌŝƉŐĞŶĞƌĂƚŝŽŶĞƐƚŝŵĂƚĞŝƐƚŚĞĂǀĞƌĂŐĞŽĨƚŚĞǁĞĞŬĚĂǇĂŶĚ^ĂƚƵƌĚĂǇĞƐƚŝŵĂƚĞƐĚƵĞƚŽůŝŵŝƚĞĚ^ƵŶĚĂǇĚĂƚĂĂǀĂŝůĂďŝůŝƚǇ͘ĐĐĞƐƐ^ĐĞŶĂƌŝŽϮ>ĂŶĚhƐĞ;/dŽĚĞͿ WĂƌĐĞů/ ƵƐŝŶĞƐƐͬĞǀĞůŽƉŵĞŶƚ hŶŝƚƐ ^ŝǌĞ^ŝŶŐůĞtĞĞŬĚĂǇdƌŝƉƐ^ĂƚƵƌĚĂǇdƌŝƉƐ^ƵŶĚĂǇdƌŝƉƐdŽƚĂůtĞĞŬůǇdƌŝƉƐ;ϭͿWĞƌĐĞŶƚdƌŝƉŝƐƚƌŝďƵƚŝŽŶdŚƌŽƵŐŚ^ŝŐŶĂůdŽƚĂůtĞĞŬůǇdƌŝƉƐdŚƌŽƵŐŚ^ŝŐŶĂůWĞƌĐĞŶƚŽĨdŽƚĂůtĞĞŬůǇdƌŝƉƐdŚƌŽƵŐŚ^ŝŐŶĂů&ƌĞĞͲ^ƚĂŶĚŝŶŐŝƐĐŽƵŶƚ^ƵƉĞƌƐƚŽƌĞ;ϴϭϯͿ ϮϲͲϯϬͲϮϯͲϯϮͲϬϬϭϯ dĂƌŐĞƚ ^ƋƵĂƌĞ&ĞĞƚ'&ϭϴϮ͕ϱϬϬ ϵ͕Ϯϱϰ ϭϭ͕ϲϳϬ ϭϬ͕Ϯϭϰ ϲϴ͕ϭϱϰ ϰϬ͘Ϭй Ϯϳ͕ϮϲϮϰϵ͘ϯϯй^ŚŽƉƉŝŶŐĞŶƚĞƌ;ϴϮϬͿ;ϮͿϮϳͲϯϬͲϮϯͲϰϭͲϬϬϮϮ͕ϮϳͲϯϬͲϮϯͲϰϭͲϬϬϮϯ ^ƋƵĂƌĞ&ĞĞƚ'& ϯϮ͕ϱϬϬ Ϯ͕ϴϬϬ ϰ͕ϰϬϬ ϯ͕ϲϬϬ'ƌŽĐĞƌǇ;ϴϱϰͿ ϮϳͲϯϬͲϮϯͲϰϭͲϬϬϮϰ ^ƋƵĂƌĞ&ĞĞƚ'& ϰϯ͕ϬϬϬ ϯ͕ϵϬϴ ϰ͕ϴϭϬ ϰ͕ϮϵϬ&ĂƐƚͲ&ŽŽĚZĞƐƚĂƵƌĂŶƚǁͬƌŝǀĞͲdŚƌŽƵŐŚ;ϵϯϰͿ ϮϲͲϯϬͲϮϯͲϰϭͲϬϬϮϰ ZĂŝƐŝŶŐĂŶĞΖƐ ^ƋƵĂƌĞ&ĞĞƚ'&ϯ͕ϬϬϬ ϭ͕ϰϭϰ ϭ͕ϴϰϴ ϭ͕ϰϭϴ ϭϬ͕ϯϯϲ ϳϱ͘Ϭй ϳ͕ϳϱϮϭϰ͘Ϭϯй'&с'ƌŽƐƐ&ůŽŽƌƌĞĂ;ϭͿdŽƚĂůtĞĞŬůǇdƌŝƉƐс;ϱǆ^ŝŶŐůĞtĞĞŬĚĂǇdƌŝƉƐͿн^ĂƚƵƌĚĂǇdƌŝƉƐн^ƵŶĚĂǇdƌŝƉƐ;ϮͿ^ŚŽƉƉŝŶŐĞŶƚĞƌ^ƵŶĚĂǇƚƌŝƉŐĞŶĞƌĂƚŝŽŶĞƐƚŝŵĂƚĞŝƐƚŚĞĂǀĞƌĂŐĞŽĨƚŚĞǁĞĞŬĚĂǇĂŶĚ^ĂƚƵƌĚĂǇĞƐƚŝŵĂƚĞƐĚƵĞƚŽůŝŵŝƚĞĚ^ƵŶĚĂǇĚĂƚĂĂǀĂŝůĂďŝůŝƚǇ͘ϯϲ͘ϲϱйϰϬ͘Ϭй ϮϬ͕ϮϱϲϱϬ͕ϲϰϬϱϬ͕ϲϰϬ ϰϬ͘Ϭй ϮϬ͕Ϯϱϲϯϭ͘ϲϬйdƌŝƉ'ĞŶĞƌĂƚŝŽŶͲWƌŽƉŽƐĞĚ>ĞǆŝŶŐƚŽŶǀĞŶƵĞΘdĂƌŐĞƚZŽĂĚdƌĂĨĨŝĐ^ŝŐŶĂů^ŽƵƌĐĞ͗/ŶƐƚŝƚƵƚĞŽĨdƌĂŶƐƉŽƌƚĂƚŝŽŶŶŐŝŶĞĞƌƐdƌŝƉ'ĞŶĞƌĂƚŝŽŶDĂŶƵĂů͕ϭϬƚŚĚŝƚŝŽŶ^ŽƵƌĐĞ͗/ŶƐƚŝƚƵƚĞŽĨdƌĂŶƐƉŽƌƚĂƚŝŽŶŶŐŝŶĞĞƌƐdƌŝƉ'ĞŶĞƌĂƚŝŽŶDĂŶƵĂů͕ϭϬƚŚĚŝƚŝŽŶ>ĞǆŝŶŐƚŽŶ^ƚĂƚŝŽŶ>ĞǆŝŶŐƚŽŶ^ƚĂƚŝŽŶ 1 Trip ƉƉĞŶĚŝǆ >ĞǆŝŶŐƚŽŶǀĞŶƵĞZĞĐŽŶƐƚƌƵĐƚŝŽŶ;/ͲϲϵϰƚŽZͿ dƌĂĨĨŝĐ^ƚƵĚǇʹƉƌŝůϭϴ͕ϮϬϭϵ Lexington Avenue Reconstruction g (I-694 to CR E) Traffic Study Arden Hills & Shoreview, MN Prepared For: Ramsey County Public Works 1425 Paul Kirkwold Dr Arden Hills, MN 55112 Prepared By: Alliant Engineering, Inc. 733 Marquette Ave, Ste 700 Minneapolis, MN 55402 April 18, 2019 Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 i April 18, 2019 Table of Contents List of Figures ................................................................................................................................ ii List of Tables ................................................................................................................................. ii 1.0 Introduction ........................................................................................................................1 1.1 PURPOSE AND NEED ......................................................................................................... 1 1.2 DESCRIPTION OF LOCATION ............................................................................................. 1 2.0 Existing Conditions ............................................................................................................3 2.1 EXISTING ROADWAY CHARACTERISTICS ......................................................................... 3 2.2 EXISTING INTERSECTION CHARACTERISTICS ................................................................... 4 2.3 EXISTING CRASH EXPERIENCE ......................................................................................... 8 2.4 TRAFFIC OPERATIONS ANALYSIS ................................................................................... 16 3.0 Year 2040 Conditions ......................................................................................................19 3.1 TRIP GENERATION ......................................................................................................... 19 3.2 TRIP DISTRIBUTION AND ASSIGNMENT .......................................................................... 21 3.3 TRAFFIC FORECASTS ...................................................................................................... 23 3.4 YEAR 2040 NO BUILD TRAFFIC OPERATIONS ANALYSIS ............................................... 25 3.5 IDENTIFICATION OF DEFICIENCIES ................................................................................. 26 4.0 Preliminary Alternatives Analysis..................................................................................28 4.1 SIGNAL WARRANT ANALYSIS ........................................................................................ 28 4.2 IDENTIFICATION OF PRELIMINARY INTERSECTION ALTERNATIVES ................................ 29 4.3 PRELIMINARY ALTERNATIVES TRAFFIC OPERATIONS ANALYSIS ................................... 32 4.4 PRELIMINARY ALTERNATIVES COMPARISON MATRIX ................................................... 34 4.5 SELECTION OF PREFERRED ALTERNATIVE ..................................................................... 36 4.6 PREFERRED ALTERNATIVE ANALYSIS ............................................................................ 36 5.0 Conclusions/Recommendations ......................................................................................39 Appendix A: Detailed Intersection Operations Analysis ........................................................ A1 Appendix B: Detailed Signal Warrant Analysis ...................................................................... B1 Appendix C: Preferred Alternative Concept Layout .............................................................. C1 Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 ii April 18, 2019 List of Figures Figure 1. Project Location............................................................................................................... 2 Figure 2. Existing Conditions ......................................................................................................... 6 Figure 3. Year 2020 No Build Conditions ...................................................................................... 7 Figure 4. Existing Crashes by Severity and Type ........................................................................... 8 Figure 5. Existing Crash Diagrams ............................................................................................... 10 Figure 6. Lexington Station Site Plan ........................................................................................... 20 Figure 7. Proposed Development Directional Distribution .......................................................... 22 Figure 8. Year 2040 No Build Conditions .................................................................................... 24 List of Tables Table 1. Crash Rate Summary (2011 – 2015)............................................................................... 15 Table 2. Level of Service Criteria ................................................................................................. 16 Table 3. Existing Operations Analysis Summary ......................................................................... 17 Table 4. Year 2020 No Build Operations Analysis Summary ...................................................... 18 Table 5. Lexington Station Phase 3 Trip Generation Estimates ................................................... 19 Table 6. Existing and Forecast Approach Volumes ...................................................................... 23 Table 7. Year 2040 No Build Operations Analysis Summary ...................................................... 25 Table 8. Signal Warrant Analysis Summary................................................................................. 28 Table 9. Operations Analysis Summary – Preliminary Alternatives (2040 PM Peak Hour) ....... 33 Table 10. Preliminary Alternatives Comparison Matrix............................................................... 35 Table 11. Operations Analysis Summary – Preferred Alternative (Forecast Year 2040) ............ 36 Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 1 April 18, 2019 1.0 Introduction Ramsey County, in cooperation with the City of Arden Hills and the City of Shoreview, has programmed a year 2020 reconstruction of Lexington Avenue (County State Aid Highway 51) between I-694 and County Road E (CR E). Key aspects of the project include pavement rehabilitation, providing geometric improvements that accommodate pedestrians/bicyclists/transit users, traffic signal upgrades/geometric improvements at the Red Fox Road and Grey Fox Road intersections, and a proposed traffic signal at the Target South intersection (see Figure 1: Project Location). Ramsey County has identified the need to conduct a traffic study along the Lexington Avenue corridor to determine the most appropriate forms of access, lane geometrics, and traffic signal improvements. 1.1 Purpose and Need The purpose of this traffic study is to determine the future vision for the Lexington Avenue study corridor in terms of access, lane geometrics, and traffic signal improvements. Understanding the nature of any corridor safety problems and the need to address potential future traffic operations deficiencies, Ramsey County desires improvement solutions that accomplish the following goals: x Improve or maintain the intersection level of service into the future x Reduce the frequency of severe crashes; and x Provide access management recommendations to improve overall traffic flow To support Ramsey County in identifying the appropriate improvements that meet the above stated goals, this traffic study accomplishes the following: x Documents the existing geometric, traffic operations, and safety characteristics x Documents design year 2020 and horizon year 2040 traffic forecasts based upon study area historical traffic volumes and expected population growth x Develops and evaluates high-level conceptual alternatives that will improve intersection safety characteristics to a varying degree x Conducts a traffic operations and safety analysis of each alternative x Identifies a preferred alternative 1.2 Description of Location The subject of this study is the Lexington Avenue corridor between I-694 and CR E, and in particular, the intersections with Red Fox Road, Target South, and Grey Fox Road. The study area is composed primarily of retail and service related land uses with access to a small residential neighborhood (approximately 50 houses) via Grey Fox Road. Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 3 April 18, 2019 2.0 Existing Conditions The following section documents the existing corridor conditions. 2.1 Existing Roadway Characteristics The existing roadway characteristics are summarized as follows: x Lexington Avenue: Lexington Avenue serves as a minor arterial roadway with a posted speed limit of 40 miles per hour (mph). The roadway consists mostly of an undivided five-lane cross-section with a continuous two-way left-turn lane (TWLTL). An at-grade railroad crossing is situated approximately 300 feet north of the Lexington Avenue / CR E intersection near the southern project limits. x Red Fox Road: Red Fox Road serves as a local roadway with a posted speed limit of 30 mph. The roadway consists of an undivided two-lane cross-section west of Lexington Avenue and an undivided three-lane cross-section with a continuous TWLTL to the east. x Grey Fox Road: Grey Fox Road serves as a local roadway with a posted speed limit of 30 mph. The roadway consists of an undivided two-lane cross-section and provides the only access to the Island Lake neighborhood (approximately 50 homes) east of Lexington Avenue. To the west, Grey Fox Road connects to northbound Snelling Avenue via a right-in/right-out (RIRO) intersection. 2.1.1 Pedestrian/Bicycle Accommodations Existing pedestrian/bicycle accommodations are summarized as follows: x Lexington Avenue: A mixed-use path exists along the east side of Lexington Avenue for the entire length of the corridor. Two sidewalk segments exist along the west side of Lexington Avenue; the first between Red Fox Road and Lexington Station, and the second starting at Grey Fox Road and extending south of CR E. x Red Fox Road: Sidewalk is present on both sides of Red Fox Road east of Lexington Avenue and for a short distance on the south side of Red Fox Road to the west. x Grey Fox Road: No pedestrian or bicycle facilities are present. Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 4 April 18, 2019 2.1.2 Public Transportation Metro Transit currently maintains service for Bus Routes 225, 227, and 261 along parts of the Lexington Avenue corridor. Bus Routes 225 and 227 connect Arden Hills and Shoreview to Rosedale Mall, with Route 225 operating along the entire Lexington Avenue study corridor and Route 227 operating as far north as Red Fox Road. Bus Route 261 connects Arden Hills and Shoreview to the Minneapolis Central Business District (CBD), utilizing the entire Lexington Avenue study corridor. Bus stops are located at several study corridor intersections: x Lexington Avenue & Red Fox Road x Lexington Avenue & Target South (northbound only) x Lexington Avenue & Grey Fox Road x Lexington Avenue & County Road E It should be noted that under the current roadway configuration all stops are made in through lanes except for the northbound stop at Red Fox Road, which is made within a dedicated right-turn lane. 2.2 Existing Intersection Characteristics The existing intersection characteristics are summarized as follows: x Lexington Avenue/Red Fox Road Intersection: The Red Fox Road intersection is currently controlled by an actuated eight-phase traffic signal which is coordinated with signals along Lexington Avenue. Protective/permissive left-turn phasing exists for both the mainline northbound/southbound and side-street eastbound/westbound directions. x Lexington Avenue/Lexington Station Driveway: The Lexington Station driveway is currently side-street stop controlled for eastbound vehicles. A traffic signal at the Lexington Avenue / Target South intersection would provide an opportunity to realign driveway access to businesses along the west side of Lexington Avenue. The Target South intersection is located approximately 300 feet south of the Lexington Station driveway. x Lexington Avenue/Target South Intersection: The Target South intersection is currently side-street stop controlled for westbound vehicles. A proposed traffic signal at this location may improve intersection level of service and reduce the frequency of severe crashes while providing pedestrians and bicyclists a safer means to cross Lexington Avenue. Furthermore, a traffic signal at this location would provide an opportunity to realign driveway access to businesses along the west side of Lexington Avenue. The Enterprise / Big O Tires / Arby’s driveway access is located approximately 200 feet south, and the Lexington Station driveway access is located approximately 300 feet north of the Target South driveway. Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 5 April 18, 2019 x Lexington Avenue/Enterprise-Big O Tires-Arby’s Driveway: The Enterprise / Big O Tires / Arby’s driveway is currently side-street stop controlled for eastbound vehicles. A traffic signal at the Lexington Avenue / Target South intersection would provide an opportunity to realign driveway access to businesses along the west side of Lexington Avenue. The Target South intersection is located approximately 200 feet north of the Enterprise / Big O Tires / Arby’s driveway. x Lexington Avenue/Grey Fox Road Intersection: The Grey Fox Road intersection is currently controlled by an actuated five-phase traffic signal which is coordinated with signals along Lexington Avenue. Protective/permissive left-turn phasing exists for the mainline northbound/southbound directions, while permissive only left-turn phasing is in place for the side-street eastbound/westbound directions. x Lexington Avenue/Shannon Square Driveway: The Shannon Square driveway is currently side-street stop controlled for eastbound vehicles. The driveway is located approximately 550 feet south of the Lexington Avenue / Grey Fox Road intersection. With full access also being provided at Grey Fox Road, a RIRO or three-quarter access configuration could be considered. x Lexington Avenue/County Road E Intersection: The CR E intersection is currently controlled by an actuated seven-phase traffic signal which is coordinated with signals along Lexington Avenue during certain periods of the day. Protective/permissive left-turn phasing exists for the mainline northbound/southbound directions, while split phasing is in place for the side-street eastbound/westbound directions. Roadway network characteristics, including existing a.m., midday, and p.m. peak hour traffic volumes, are shown in Figure 2. No build characteristics, including design year 2020 a.m., midday, and p.m. peak hour traffic volumes, are shown in Figure 3. Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 8 April 18, 2019 2.3 Existing Crash Experience Historical crash data at the study intersections from the most recent five years available, years 2011-2015, was obtained from the Minnesota Crash Mapping Analysis Tool (MnCMAT). Based on the available crash data, there were 39 reported crashes at the Lexington Avenue / Red Fox Road intersection, eight (8) reported crashes at the Lexington Avenue / Target South intersection, six (6) reported crashes at the Lexington Avenue / Enterprise-Big O Tires-Arby’s driveway, 14 reported crashes at the Lexington Avenue / Grey Fox Road intersection, and two (2) reported crashes at the Lexington Avenue / Shannon Square driveway during the analysis period (69 total crashes). The reported crashes are summarized by severity and type in Figure 4 while detailed intersection crash diagrams are illustrated in Figure 5. Figure 4. Existing Crashes by Severity and Type Lexington Avenue & Red Fox Road Lexington Avenue & Target South Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 9 April 18, 2019 Figure 4. Existing Crashes by Severity and Type (Continued) Lexington Avenue & Enterprise / Big O Tires / Arby’s Lexington Avenue & Grey Fox Road Lexington Avenue & Shannon Square Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 14 April 18, 2019 2.3.1 Crash Type Further investigation into the types of reported crashes (see Figure 4) revealed that the Lexington Avenue study corridor had a significant number of right-angle and left-turn crashes, accounting for 52 percent (36 of 69) of the crashes between 2011 and 2015. At the intersection of Lexington Avenue / Red Fox Road, right-angle and left-turn crashes also accounted for 51 percent (20 of 39) of the crashes between 2011 and 2015. A more detailed review of the historical crash data revealed that the existing signalized left-turn operation may be negatively affecting the safety of study intersections: x 34 of the 36 right-angle/left-turn crashes throughout the study corridor occurred during midday or p.m. hours, which may suggest that high volumes during these time periods are resulting in poor gap selections by motorists. x 19 of the 20 right-angle/left-turn crashes at Lexington Avenue / Red Fox Road occurred during midday or p.m. hours, which may also suggest that signal operations during this time period are creating hazardous conditions. o 15 of these 19 right-angle/left-turn crashes involved a southbound vehicle, which may suggest that heavier volumes and permissive “green ball” left-turn operation are resulting in driver confusion/poor gap selections. x 10 of the 17 injury crashes throughout the study corridor were rear end crashes, with all 10 crashes occurring between 1 p.m. and 7 p.m. Conclusions based on crash type suggest there is a noteworthy crash pattern at the Red Fox Road intersection, including an observed increase in crashes throughout the study corridor during the afternoon/evening time period. 2.3.2 Crash Rate History has proven that crashes are a function of exposure. Roadways with higher traffic volumes experience more crashes than similar roadways with lower volumes. Rather than simply documenting the number of crashes that occur at an intersection, the crash rate must be considered. Crash rates normalize different locations with varying traffic volumes, providing a useful tool in comparing the locations with respect to safety. Actual crash rates at specific locations can also be compared to average or typical values for an intersection type. Intersection crash rates are defined by the number of crashes occurring per million entering vehicles (MEV). Table 1 summarizes the observed intersection crash rates compared to the statewide averages for similar intersections. Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 15 April 18, 2019 Table 1. Crash Rate Summary (2011 – 2015) Crash occurrence is somewhat random by nature. Identifying every intersection with a crash rate above the average value in an analysis could produce a large amount of data that may not be statistically relevant with respect to safety deficiencies. The critical crash rate identifies locations that have a crash rate higher than similar facilities by a statistically significant amount. The critical crash rate is calculated by adjusting the systemwide average based on the amount of exposure and a statistical constant indicating level of confidence1. At locations where the observed crash rate exceeds the critical crash rate, it is 99 percent certain that an intersection design deficiency exists, or there are hazardous characteristics present at the location. It should be noted that while the observed crash rate at the Lexington Avenue / Red Fox Road intersection (0.83 crashes/MEV) is higher than the statewide average for a signalized high-volume/low-speed intersection (0.70 crashes/MEV), the observed crash rate does not exceed the corresponding critical crash rate (1.03 crashes/MEV). Above average crash rates were also observed at the Lexington Avenue intersections with the Target South access and the Enterprise-Big O Tires-Arby’s driveway. However, the observed crash rates at these intersections also did not exceed the corresponding critical crash rates. 1 MnDOT Traffic Safety Fundamentals Handbook, August 2015. Intersection Traffic Control Total Crashes1 Total Entering Volume2 Crash Rate per MEV State Average Crash Rate3 Crash Critical Rate4, 5 Crash Severity Rate6 State Average Severity Rate3 Crash Severity Critical Rate4, 5 Lexington Avenue & Red Fox Road High Volume, Low Speed Signal 39 46,811,250 0.83 0.70 1.03 1.09 0.97 1.17 Lexington Avenue & Target South Urban Through-Stop 8 38,918,125 0.21 0.18 0.37 0.26 0.26 0.38 Lexington Avenue & Enterprise/Big O Tires/Arby's Urban Through-Stop 6 29,914,792 0.20 0.18 0.40 0.23 0.26 0.40 Lexington Avenue & Grey Fox Road High Volume, Low Speed Signal 14 34,112,292 0.41 0.70 1.08 0.15 0.97 1.20 Lexington Avenue & Shannon Square Urban Through-Stop 2 31,283,542 0.06 0.18 0.39 0.06 0.26 0.39 4 The critical rate is a statistically adjusted crash rate to account for random nature of crashes 5 A 99.5% confidence level was assumed for critical crash rate and an 80% confidence level was assumed for critical severity and K/A rate. 1 Crash Data obtained from MnCMAT and detailed police crash reports. 2 AADT obtained from MnDOT Traffic Data Map 3 MnDOT's 2015 Green Sheets were used to determine the State average crash rate. 6 Severity rate factors: 5 for Fatal Crashes, 4 for A type, 3 for B type, 2 for C type, and 1 for Property Damage Crashes Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 16 April 18, 2019 2.3.3 Crash Severity The observed intersection crash rates do not exceed the corresponding critical crash rates. Therefore, the number of reported crashes would not be considered statistically significant. However, it is worth investigating the severity of reported crashes. At the Lexington Avenue / Red Fox Road intersection, 10 of the reported crashes resulted in an injury, while 29 were property damage only crashes. At the Lexington Avenue / Target South intersection two of the eight reported crashes resulted in an injury. At the Lexington Avenue / Enterprise-Big O Tires-Arby’s driveway one of the six reported crashes resulted in an injury. At the Lexington Avenue / Grey Fox Road intersection, four of the 14 reported crashes resulted in an injury. At the Lexington Avenue / Shannon Square driveway, neither reported crash resulted in an injury. Crash severity quantifies how severe the crashes are at a location. The purpose for analyzing this statistic is to identify locations that experience a low crash rate but have a high percentage of injury or fatal crashes. Conversely, locations which have high crash rates and a large proportion of property damage crashes may not warrant as much priority when deficiencies are being addressed. Although crash rates are not statistically significant, the Lexington Avenue / Red Fox Road intersection experienced a severity rate (1.09) slightly below the critical severity rate (1.17) and 12 percent higher than the statewide average severity rate (0.97). However, it should be noted that no fatal crashes occurred and only one (1) type A injury crash occurred over the analysis period. 2.4 Traffic Operations Analysis An existing traffic operations analysis was completed using Synchro/SimTraffic software to establish a baseline condition to which future traffic operations and alternatives could be compared. Operations analysis results identify a Level of Service (LOS), which indicates the quality of traffic flow through an intersection. Intersections are given a ranking from LOS A through LOS F. The LOS results are based on average delay per vehicle, which correspond to the delay threshold values shown in Table 2. Table 2. Level of Service Criteria Description Signalized Intersection Unsignalized Intersection A Free Flow: Low volumes and no delays.0 - 10 0 - 10 B Stable Flow: Speeds restricted by travel conditions, minor delays.> 10 - 20 > 10 - 15 C Stable Flow: Speeds and maneuverability closely controlled due to higher volumes.> 20 - 35 > 15 - 25 D Stable Flow: Speeds considerably affected by change in operating conditions. High density traffic restricts maneuverability, volume near capacity.> 35 - 55 > 25 - 35 E Unstable Flow: Low speeds, considerable delay, volume at or slightly over capacity.> 55 - 80 > 35 - 50 F Forced Flow: Very low speeds, volume exceed capacity, long delays with stop and go traffic.> 80 > 50 Source: Highway Capacity Manual, 2010 Edition, Transportation Research Board, Exhibits 18-4 & 19-1. Delay per Vehicle (seconds) Level of Service Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 17 April 18, 2019 LOS A indicates the best traffic operation, with vehicles experiencing minimal delays. LOS F indicates an intersection where demand exceeds capacity, or a breakdown of traffic flow. The LOS D/E boundary for overall operations is often used as the indicator of congestion in an urban area. For side-street stop-controlled intersections, a key measure of operational effectiveness is the side-street LOS. Long delays and poor LOS can occur on side-street approaches even if the overall intersection is functioning well, making side-street LOS a valuable design criterion. After LOS, the second component of the operations analysis is a study of vehicular queuing, or the lineup of vehicles waiting to pass through an intersection. An intersection can operate with an acceptable LOS, but if queues from the intersection block entrances to turn lanes or adjacent driveways, unsafe operating conditions could result. The 95th percentile queue, or the length of queue with only a five (5) percent probability of being exceeded during an analysis period, is considered the standard for design purposes. It should be noted that, after consultation with Ramsey County staff, an annual background growth rate of 0.5 percent was applied to existing traffic volumes to provide a conservative estimate of future year 2020 conditions. Results of the existing and year 2020 no build traffic operations analyses, presented in Table 3 and Table 4 respectively, indicate that all study intersections operate at overall LOS D or better during the a.m., midday, and p.m. peak hours. Detailed operations and queuing analysis results are presented in Appendix A. Table 3. Existing Operations Analysis Summary Key conclusions of the existing traffic operations analysis include the following: x Red Fox Road: Under midday and p.m. peak hour traffic volumes, southbound left-turn queuing can occasionally extend beyond available turn lane storage and into the I-694 EB Ramp Terminal intersection to the north. Access to the northbound right-turn lane at the adjacent I-694 EB Ramp Terminal intersection can occasionally be blocked by northbound through queues. Both preceding issues are a consequence of limited spacing between the Red Fox Road and I-694 EB Ramp Terminal intersections. The westbound right-turn movement at Red Fox Road also sees queues exceed provided turn lane storage. Lexington Avenue & Red Fox Road B / C 11.5 / 29.6 C / C 22.7 / 28.9 C / D 29.9 / 39.8 Lexington Avenue & Lexington Station A / A 1.4 / 7.8 C / F 20.6 / 208.7 A / F 8.9 / 109.9 Lexington Avenue & Target South A / B 0.6 / 12.5 B / F 10.2 / 93.9 A / F 4.6 / 65.2 Lexington Avenue & Enterprise/Big O Tires/Arby's A / B 0.7 / 11.5 A / E 2.5 / 48.5 A / C 1.4 / 15.9 Lexington Avenue & Grey Fox Road A / C 6.4 / 31.4 A / C 9.4 / 26.9 B / C 14.1 / 30.9 Lexington Avenue & Shannon Square A / A 2.5 / 8.0 A / C 4.4 / 16.2 A / C 5.8 / 20.7 Lexington Avenue & CR E C / C 21.4 / 32.7 C / C 21.3 / 31.0 D / D 40.9 / 53.2 Intersection AM Peak Hour PM Peak Hour LOS Delay (s)LOS Delay (s) MID Peak Hour LOS Delay (s) Overall Intersection LOS / Worst Approach LOS Overall Intersection Delay / Worst Approach Delay Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 18 April 18, 2019 x Lexington Station and Target South: Left-turn movements out of Lexington Station and Target South experience significant delay under midday and p.m. peak hour volumes. x Side-Street Left-Turns and the Two-Way Left-Turn Lane: Field observations indicate that the Lexington Avenue continuous TWLTL is frequently utilized as an acceleration lane for left-turn maneuvers from unsignalized side-streets due to limited gaps in mainline traffic. Table 4. Year 2020 No Build Operations Analysis Summary Key conclusions of the 2020 no build traffic operations analysis include the following: x Side-Street Left-Turns: Left-turn maneuvers from unsignalized side-streets are expected to become increasingly more difficult under the forecast year 2020 traffic volumes. Lexington Station, Target South, Enterprise/Big O Tires/Arby’s, and Shannon Square driveways are all projected to experience side-street left-turn delays corresponding to at least LOS E during the midday and/or p.m. peak hours. Lexington Avenue & Red Fox Road B / C 11.6 / 30.2 C / C 23.8 / 28.1 C / D 33.7 / 48.2 Lexington Avenue & Lexington Station A / A 1.4 / 7.3 D / F 30.3 / 294.6 C / F 22.7 / 311.0 Lexington Avenue & Target South A / B 0.6 / 13.0 A / F 6.3 / 56.7 A / F 5.7 / 81.8 Lexington Avenue & Enterprise/Big O Tires/Arby's A / B 0.6 / 10.7 A / F 2.4 / 50.1 A / C 1.5 / 23.2 Lexington Avenue & Grey Fox Road A / C 6.7 / 30.2 A / C 10.0 / 28.6 B / C 13.3 / 29.2 Lexington Avenue & Shannon Square A / B 2.6 / 10.4 A / C 4.4 / 18.0 A / E 7.8 / 43.6 Lexington Avenue & CR E C / C 21.8 / 32.4 C / C 21.2 / 31.1 D / D 43.0 / 52.4 PM Peak Hour Overall Intersection LOS / Worst Approach LOS Overall Intersection Delay / Worst Approach Delay Intersection AM Peak Hour LOS Delay (s)LOS Delay (s) MID Peak Hour LOS Delay (s) Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 19 April 18, 2019 3.0 Year 2040 Conditions Increases in vehicle traffic resulting from regional infrastructure, regional connectivity, business and residential development, and demographic changes will influence the long-term operation of the Lexington Avenue corridor and corresponding intersections. This traffic study evaluated intersection geometric and traffic control needs based upon the forecast year 2040 design horizon. The following section documents the forecast year 2040 conditions analysis completed for the Lexington Avenue corridor. 3.1 Trip Generation To account for traffic impacts associated with the ongoing Lexington Station development (see Figure 6), trip generation estimates were developed for the weekday a.m., midday, and p.m. peak hours as well as on a daily basis. The trip generation estimates were developed utilizing trip generation rates for similar land uses as documented in the ITE Trip Generation Manual, 10th Edition. The ITE Trip Generation Manual provides peak hour and daily trip generation rates based on studies of similar land uses. 3.1.1 Lexington Station – Phase 2 Lexington Station – Phase 2 was observed to be complete with approximately 50 percent of retail space occupied at the time of data collection (September 2018). No additional trips were included for the remaining 50 percent of the development as background growth rates included as part of traffic forecasting will provide appropriate estimates of side-street growth through the year 2020. 3.1.2 – Lexington Station – Phase 3 The ITE Trip Generation Manual was utilized to estimate the trip generation potential for Lexington Station – Phase 3, which is expected to be complete in 2021. Estimated site generated traffic for the Lexington Station Phase 3 development is detailed in Table 5. It should be noted that midday peak hour trips were assumed to be equal to p.m. peak hour trips to provide a conservative estimate of generated trips. Table 5. Lexington Station Phase 3 Trip Generation Estimates Trips In Trips Out Total Trips Trips In Trips Out Total Trips Trips In Trips Out Total Trips Gross Floor Area (SF) 7,605 8 1 9 1 8 9 1 8 9 74 Gross Floor Area (SF) 25,446 15 9 24 47 50 97 47 50 97 962 23 10 33 48 58 106 48 58 106 1,036 Source: ITE Trip Generation Manual, 10th Edition 1: Trips generated for the a.m. and p.m. peak hours of the adjacent roadway network. 2: Trips generated for the mid peak hours assumed to be equal to p.m. peak hours. 3: General Retail (Shopping Center) raw trip generation data inherently includes a multi-use reduction. Net New Trips General Office (710) General Retail3 (820) Daily Trips Proposed Development - Phase 3 Land Use (ITE Code)Units Size AM Peak Hour Trips1 PM Peak Hour Trips1 MID Peak Hour Trips2 Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 21 April 18, 2019 Results of the trip generation estimates indicate the current Phase 3 development plan is expected to generate approximately 33 a.m. peak hour trips, 106 midday/p.m. peak hour trips, and 1,036 daily trips. To conservatively estimate additional trips generated by Phase 3, trips will not be subtracted for existing land uses to be removed by Phase 3 construction. It should be noted that to provide conservative trip generation estimates for the Phase 3 development, no multi-use or pass-by trip reductions were applied. 3.1.3 – YMCA/Island Lake Golf Course Within the City of Shoreview 2040 Comprehensive Plan, potential redevelopment of the Island Lake Golf Course and the vacant lot adjacent to the YMCA facility at 3760 Lexington Ave is discussed at length, with low to medium-density housing likely being considered. Recent discussions with Ramsey County staff indicate that if the golf course were to cease operations, the associated land would likely remain a park in some capacity rather than being redeveloped. Therefore, as part of the trip generation process, no trips associated with this potential redevelopment were included. 3.2 Trip Distribution and Assignment The distribution of Lexington Station – Phase 3 development traffic was estimated based on the Lexington Station Traffic Study (dated May 20, 2013, completed by SRF Consulting Group) distribution developed for all three phases of development. This distribution was reviewed based on existing traffic volumes/patterns, engineering judgement, and was found to be appropriate for this study. The estimated proposed development directional distribution is shown in Figure 7. Trips were then assigned to study intersections based on this distribution for the forecast year 2040 conditions. Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 23 April 18, 2019 3.3 Traffic Forecasts After consultation with Ramsey County staff, an annual background growth rate of 0.5 percent was applied to existing traffic volumes to provide a conservative estimate of future year 2040 conditions. The resultant forecast year 2040 traffic volumes, a combination of background growth and Lexington Station – Phase 3 trips, are shown in Figure 8. The existing and forecast approach volumes on each leg of several Lexington Avenue study intersections are shown in Table 6. Table 6. Existing and Forecast Approach Volumes 2018 2020 2040 Eastbound 2810 2840 3140 Westbound 6650 6720 7420 Northbound 11000 11100 12300 Southbound 16500 16700 18400 Eastbound --- Westbound 1860 1880 2080 Northbound 12300 12400 13700 Southbound 12400 12500 13800 Eastbound 3370 3400 3760 Westbound 1510 1530 1690 Northbound 10200 10300 11400 Southbound 12700 12800 14200 Lexington Avenue & Grey Fox Road 1: Volumes shown are based on collected 2018 turning movement counts. 2: The Lexington Avenue & Target South intersection is currently a T-intersection without an eastbound approach. Realignment of either the Enterprise/Big O Tires/Arby's or Lexington Station driveways would increase approach volumes. Roadway Approach Lexington Avenue & Red Fox Road Lexington Avenue & Target South2 Daily Approach Volumes 1 Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 25 April 18, 2019 3.4 Year 2040 No Build Traffic Operations Analysis A traffic operations analysis was conducted to evaluate the operational performance of the various intersections along the Lexington Avenue corridor under forecast year 2040 traffic volumes. The purpose of this no build analysis is to create a baseline to compare the performance of each potential build alternative; ultimately aiding in the selection of a preferred alternative to be evaluated in greater detail. In addition, the traffic operations analysis provides context to the need for intersection improvements based on intersection capacity. The key measures of effectiveness evaluated include overall intersection delay/LOS and worst approach delay/LOS. Table 7 provides a summary of the year 2040 no build traffic operations analysis for the Lexington Avenue corridor. Table 7. Year 2040 No Build Operations Analysis Summary Results of the traffic operations analysis indicate that the Lexington Avenue corridor intersections are expected to operate at overall LOS C or better under year 2040 a.m. peak hour traffic volumes. However, under year 2040 midday and p.m. peak hour traffic volumes, most study intersections are expected to perform significantly worse, enduring long delays and queues under no build conditions. It should be noted that these conditions are partly due to the analysis using existing signal timing. Updating the signal timing and coordination along Lexington Avenue may reduce the magnitude of these problems. Key conclusions of the 2040 no build traffic operations analysis include the following: x Red Fox Road: Issues noted previously under existing and year 2020 conditions are expected to be further exacerbated. During the forecast year 2040 p.m. peak hour, the Lexington Avenue / Red Fox Road intersection is expected to operate at overall LOS E. x Lexington Station: During the forecast year 2040 midday and p.m. peak hours, the Lexington Avenue / Lexington Station intersection is expected to operate at overall LOS F. Lexington Avenue & Red Fox Road B / C 13.6 / 29.7 C / D 30.1 / 36.8 E / E 58.1 / 79.2 Lexington Avenue & Lexington Station A / B 1.7 / 10.4 F / F 102.2 / > 300 F / F 108.9 / > 300 Lexington Avenue & Target South A / C 0.7 / 20.1 C / F 24.7 / 235.0 C / F 20.4 / > 300 Lexington Avenue & Enterprise/Big O Tires/Arby's A / B 0.7 / 12.3 A / E 2.5 / 41.5 A / F 7.5 / 109.9 Lexington Avenue & Grey Fox Road A / C 6.6 / 31.7 B / C 10.6 / 26.6 C / F 25.5 / 94.8 Lexington Avenue & Shannon Square A / B 2.7 / 11.1 A / D 6.4 / 34.9 A / E 8.6 / 41.5 Lexington Avenue & CR E C / C 23.4 / 33.5 C / C 22.9 / 32.2 D / E 54.5 / 70.2 Overall Intersection LOS / Worst Approach LOS Overall Intersection Delay / Worst Approach Delay Intersection AM Peak Hour PM Peak Hour LOS Delay (s)LOS Delay (s) MID Peak Hour LOS Delay (s) Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 26 April 18, 2019 x Side-Street Left-Turns: Left-turn maneuvers from unsignalized side-streets are expected to become significantly more difficult under the forecast year 2040 traffic volumes. Lexington Station, Target South, Enterprise/Big O Tires/Arby’s, and Shannon Square driveways are all projected to experience side-street left-turn delays corresponding to at least LOS E during the midday and/or p.m. peak hours. x County Road E: Under forecast year 2040 p.m. peak hour traffic volumes, inefficient east/west split phasing causes unnecessary delay and queuing, particularly on the eastbound approach. 3.5 Identification of Deficiencies Based on the safety analysis, geometric considerations evaluated, preliminary traffic operations analysis, and discussions with Ramsey County, the following deficiencies have been identified: 3.5.1 Safety Deficiencies Gap Selection At the Lexington Avenue / Red Fox Road intersection, 19 of 20 reported right-angle/left-turn crashes occurred during midday or p.m. hours, with 15 of these 19 crashes involving southbound left-turning vehicles. This trend is evident throughout the Lexington Avenue corridor, with 34 of the 36 right-angle/left-turn crashes occurring during midday or p.m. hours. It can be concluded that heavier volumes and permissive “green ball” left-turn operation may be resulting in driver confusion/poor gap selection throughout the corridor. Rear-End Injuries Examining injury crashes throughout the Lexington Avenue corridor, 10 of the 17 injury crashes were rear-end crashes, with all 10 occurring during midday or p.m. hours. A continuous TWLTL throughout much of the corridor allows mainline left-turning motorists to exit through traffic prior to turning. However, only one intersection has a dedicated right-turn lane (northbound approach at Red Fox Road). High volumes, frequent driveway access, and a lack of right-turn lanes may be contributing to the increased number of rear-end crashes observed throughout the corridor. 3.5.2 Access Management Lexington Station / Target South / Enterprise-Big O Tires-Arby’s Currently, three side-street stop controlled driveways are located within 500 feet of each other between the signalized intersections of Lexington Avenue / Red Fox Road and Lexington Avenue / Grey Fox Road. Lexington Station and Target currently both have connections to Red Fox Road to the north; however, the existing Lexington Avenue driveway for Enterprise-Big O Tires-Arby’s is the only access to these businesses. A signal at the Target South intersection would provide an opportunity to consolidate driveway access to businesses on the west side of Lexington Avenue. Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 27 April 18, 2019 Shannon Square Driveway Shannon Square businesses currently have a connection to Lexington Avenue via the Cub Foods parking lot and Grey Fox Road to the north, in addition to the direct driveway access along Lexington Avenue located approximately 550 feet to the south of Grey Fox Road. Due to frequent significant delay in executing the eastbound left-turn maneuver from Shannon Square, many outbound motorists choose to route through the Cub Foods parking lot to access the traffic signal at Grey Fox Road. This is exhibited by the disparity in traffic volumes between the eastbound left-turn maneuver and the southbound right-turn maneuver, as the eastbound left-turn maneuver exhibits significantly lower volumes over all time periods. 3.5.3 Operational Deficiencies Lexington Avenue & Red Fox Road Results of the traffic operations analysis indicate that the Lexington Avenue / Red Fox Road intersection is expected to operate at overall LOS F under year 2040 no build p.m. peak hour traffic volumes. Limited southbound left-turn capacity and inadequate spacing to the I-694 EB Ramp Terminal intersection create queuing issues, with southbound queues frequently extending into the I-694 EB Ramp Terminal intersection during peak hours. A similar problem affects the northbound approach to the I-694 EB Ramp Terminal intersection, as through queues frequently block access to the adjacent right-turn lane, causing the combined queues to extend to Red Fox Road. Lexington Avenue & Grey Fox Road Results of the traffic operations analysis indicate that the Lexington Avenue & Grey Fox Road intersection is expected to operate at overall LOS E under year 2040 no build p.m. peak hour traffic volumes. However, northbound and southbound movements operate at LOS C or better. Higher side-street volumes/permissive-only left-turn movements result in long delays and queues for the shared eastbound left-turn/through lane. Lexington Avenue & Driveway Access Results of the traffic operations analysis indicate that throughout the Lexington Avenue corridor driveways are expected to perform poorly under year 2040 no build p.m. peak hour traffic volumes. Most eastbound and westbound approaches are expected to operate at LOS F, with only the Lexington Avenue / Enterprise-Big O Tires-Arby’s right-turn movement operating at LOS B as a low volume movement. Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 28 April 18, 2019 4.0 Preliminary Alternatives Analysis To address documented crash concerns and to preserve traffic mobility, a preliminary alternatives analysis was completed. The goals of the preliminary alternatives analysis are to identify engineering considerations, expected traffic operations and safety impacts, as well as select a preferred alternative. Key elements of the preliminary alternatives analysis include: x Completion of a signal warrant analysis based on existing traffic volumes x Identification of preliminary alternatives x Completion of a traffic operations analysis to assess the performance of each alternative x Documentation of potential safety benefits x Selection of a preferred alternative 4.1 Signal Warrant Analysis A signal warrant analysis was completed for the Lexington Avenue intersections at Red Fox Road, Grey Fox Road, and Target South under existing traffic volumes. The warrant analysis was conducted in accordance with the Minnesota Manual on Uniform Traffic Control Devices (MnMUTCD). The following signal warrants were considered: x W1 – Eight-Hour Vehicular Volume x W2 – Four-Hour Vehicular Volume x W3 – Peak Hour x W4 – Pedestrian Volume x W5 – School Crossing x W6 – Coordinated Signal System x W7 – Crash Experience x W8 – Roadway Network x W9 – Intersection Near a Grade Crossing Warrant 1, Warrant 2, Warrant 3, and Warrant 7 were reviewed under existing traffic volumes. The remaining traffic signal warrants were not applicable at the study intersections, or minimum warrant standards were not met. Table 8 presents a summary of the MnMUTCD signal warrant analysis results. Detailed signal warrant analysis results are included in Appendix B. Table 8. Signal Warrant Analysis Summary 1A 1B 1C Met? Hours Met? 3B Met? Crashes Met? Lexington Ave & Red Fox Rd 3148 Yes 13 Yes 9 Yes 7 Yes Lexington Ave & Grey Fox Rd 8149 Yes 10 Yes 9 Yes 3 No Lexington Ave & Target South 030 No 3 No 1 Yes 3 No Warrant 7 - Crash ExperienceIntersection Warrant 1 - Eight-Hour Vehicular Volumes Warrant 3 - Peak Hour Warrant 2 - Four-Hour Vehicular Volumes Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 29 April 18, 2019 Results of the signal warrant analysis indicate that both existing signalized intersections meet eight-hour, four-hour, and peak hour warrants under existing conditions in addition to the Red Fox Road intersection meeting the crash experience warrant. Additionally, the Target South intersection meets the peak hour warrant under existing conditions. Therefore, continuing to operate (Red Fox Road, Grey Fox Road) or beginning to operate (Target South) the study intersections under traffic signal control is warranted. It should be noted that the Lexington Avenue / Target South intersection warrant analysis does not include Lexington Station or Enterprise / Big O Tires / Arby’s driveway volumes, which if included would only further emphasize the need for improved traffic control at the Target South intersection. 4.2 Identification of Preliminary Intersection Alternatives Up to five alternatives were identified for analysis at each of the primary study intersections in addition baseline improvements (Alternative 0) throughout the Lexington Avenue corridor. The baseline improvements should be considered the minimal level of appropriate corridor improvement and will provide a means of comparison for additional geometric and traffic signal improvements proposed under other alternatives. The preliminary alternatives at each primary study intersection are as follows: Lexington Avenue & Red Fox Road x Alternative 0 (Baseline Improvements) o NB/SB protective only left-turn phasing during p.m. peak hour o EB/WB protective/permissive flashing yellow arrow (FYA) left-turn phasing o Signal timing revisions: WB right-turn overlap with the SB left-turn phase o Add a dedicated EB right-turn lane x Alternative 1 o Add a dedicated SB right-turn lane x Alternative 2 o Add dual SB left-turn lanes o Extend Red Fox Road EB right-turn trap to second Target driveway to minimize the potential for merging conflicts x Alternatives 3/4/5 o No additional improvements Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 30 April 18, 2019 Lexington Avenue & Target South x Alternative 0 (Baseline Improvements) o Install a new traffic signal at the Target South driveway o Relocate Lexington Station access to align with new Target South signal o NB/SB protective/permissive FYA left-turn phasing o EB/WB permissive left-turn phasing o Reconfigure EB/WB to dedicated left-turn lanes and shared through/right-turn lanes x Alternative 1 o Add a dedicated NB right-turn lane x Alternatives 2/3 o No additional improvements x Alternative 4 o Modify Enterprise / Big O Tires / Arby’s driveway to RIRO access x Alternative 5 o Relocate Enterprise / Big O Tires / Arby’s access to align with new Target South signal o Add a dedicated SB right-turn lane Lexington Avenue & Grey Fox Road x Alternative 0 (Baseline Improvements) o NB/SB protective/permissive FYA left-turn phasing o EB/WB protective/permissive FYA left-turn phasing o Reconfigure EB/WB to dedicated left-turn lanes and shared through/right-turn lanes x Alternative 1 o Add a dedicated SB right-turn lane x Alternatives 2/3 o No additional improvements x Alternative 4 o Modify Shannon Square driveway to RIRO access x Alternative 5 o Remove Shannon Square access Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 31 April 18, 2019 Additional Improvements x Alternative 0 – Corridor Improvements (Baseline Improvements) o Replace traffic signal infrastructure as needed throughout the Lexington Avenue corridor from the I-694 WB Ramp Terminal (north end) intersection through CR E (south end) o Update signal timing throughout the Lexington Avenue corridor from CR F (north end) through CR E (south end) Provide FYA left-turn operations Provide a leading pedestrian interval (LPI) upon actuation to improve pedestrian visibility/comfort at all signalized intersections o Replace existing continuous TWLTL with a raised median throughout the Lexington Avenue corridor from Red Fox Road (north end) to CR E (south end) Provide pocket left-turn lanes at all signalized intersections x Alternatives 1/2 o No additional improvements x Alternative 3 – County Road E Intersection Improvements o Modify the WB approach median to offset the left-turn lane further south to allow the EB/WB left-turns to operate simultaneously (eliminate split EB/WB phasing) Would require a new 55-foot mast arm in addition to a 5-foot mast arm extender for the WB traffic signal indications (NW quadrant signal pole) o EB/WB protective/permissive FYA left-turn phasing x Alternative 4 – I-694 EB Ramp Intersection Improvements o Extend NB right-turn lane to minimize the potential for through queues blocking o Modify Exxon gas station access to right-out only x Alternative 5 o No additional improvements Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 32 April 18, 2019 County Road E Improvements Beyond the CR E intersection improvements detailed above, several others were also considered: x County Road E Intersection o Reconfigure SB approach to consist of separate left-turn / through / right-turn lanes This improvement would prevent right-turning vehicles from being blocked by queued through vehicles in a shared through/right-turn lane that would otherwise prevent a right-turn on red maneuver. However, the flexibility offered by the shared through/right-turn lane minimizes potential for lengthy southbound queues during peak hours. o Extend SB left-turn lane beyond railroad crossing This improvement would provide left-turning vehicles more storage and avoid through vehicle queues from blocking the left-turn lane. However, the minimal operational improvement is offset by the safety risk of having another vehicle lane crossing the railroad tracks (located approximately 250 feet north of CR E). Recommend lagging the SB left-turn movement to allow left-turning vehicles blocked by through vehicle queues to enter the left-turn lane prior to receiving a protected green arrow. 4.3 Preliminary Alternatives Traffic Operations Analysis A traffic operations analysis was conducted to evaluate the operational performance of the various alternatives under forecast year 2040 traffic volumes. Since the p.m. peak hour exhibited the poorest traffic operations under existing conditions, the p.m. peak hour was chosen for the operations analysis of the various preliminary intersection alternatives. The purpose of this preliminary analysis is to compare the performance of each alternative to aid in the selection of a preferred alternative to be evaluated in greater detail. In addition, the traffic operations analysis provides context to the need for intersection improvements based on intersection capacity. The key measures of effectiveness evaluated include overall intersection delay/LOS and approach delay/LOS. Table 9 provides a summary of the traffic operations analysis under forecast year 2040 p.m. peak hour traffic volumes. Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 33 April 18, 2019 Table 9. Operations Analysis Summary – Preliminary Alternatives (2040 PM Peak Hour) Alternatives 0, 1, & 2: Alternatives 3, 4, & 5: Results of the traffic operations analysis indicate that the Lexington Avenue corridor intersections are expected to operate at overall LOS D or better under forecast year 2040 traffic volumes and the various preliminary alternatives. Modeling indicates that the side-street approaches at the Lexington Avenue / Enterprise-Big O Tires-Arby’s and Lexington Avenue / Shannon Square intersections are expected to endure long delays and queues under alternatives 0, 1, 2, and 3. This is primarily due to the difficulty of finding acceptable gaps to make side-street left-turn maneuvers under peak hour volumes. It should be noted that unsignalized side-street right-turn maneuvers would typically be expected to be made with minimal delay, except when blocked by queued left-turning vehicles. Therefore, RIRO access may be acceptable at unsignalized intersections. Lexington Avenue & I-694 WB Ramps C / E 30.3 / 60.9 C / D 26.2 / 45.4 C / D 28.7 / 53.1 Lexington Avenue & I-694 EB Ramps C / E 24.9 / 67.2 C / D 21.1 / 50.6 C / D 21.2 / 41.3 Lexington Avenue & Red Fox Road C / D 34.7 / 47.9 C / D 34.6 / 52.7 C / D 28.5 / 42.4 Lexington Avenue & Lexington Station Lexington Avenue & Target South Lexington Avenue & Enterprise/Big O Tires/Arby's A / C 1.8 / 20.1 A / C 1.5 / 20.8 A / C 1.5 / 20.5 Lexington Avenue & Grey Fox Road B / D 17.0 / 41.1 B / D 15.5 / 42.7 B / D 16.5 / 41.3 Lexington Avenue & Shannon Square A / D 6.9 / 28.3 A / D 6.8 / 32.1 A / E 8.0 / 47.5 Lexington Avenue & CR E D / E 48.8 / 74.5 D / E 48.8 / 74.5 D / E 48.8 / 74.5 1: Lexington Avenue & Lexington Station consolidated with Lexington & Target South for Alternatives 0,1,2,3,4,&5 A /D 7.5 /29.58.6 /29.2 A /D 7.3 /29.6 Overall Intersection LOS / Worst Approach LOS Overall Intersection Delay / Worst Approach Delay ALT 0 ALT 1 ALT 2 LOS Delay (s)LOS Delay (s)LOS Delay (s) A /D Intersection Lexington Avenue & I-694 WB Ramps C / D 28.2 / 46.0 C / E 30.2 / 58.8 C / D 25.0 / 45.4 Lexington Avenue & I-694 EB Ramps C / D 20.9 / 41.9 C / D 21.6 / 44.1 C / D 21.3 / 45.1 Lexington Avenue & Red Fox Road C / D 28.8 / 47.9 C / D 26.9 / 41.4 C / D 27.8 / 41.8 Lexington Avenue & Lexington Station Lexington Avenue & Target South Lexington Avenue & Enterprise/Big O Tires/Arby's A / D 2.1 / 33.9 A / A 1.5 / 9.6 Lexington Avenue & Grey Fox Road B / D 16.6 / 41.2 C / D 21.0 / 41.8 Lexington Avenue & Shannon Square A / F 8.5 / 52.4 A / C 4.5 / 15.6 Lexington Avenue & CR E D / E 42.8 / 56.0 D / E 42.8 / 57.9 D / E 42.2 / 63.4 3: Lexington Avenue & Shannon Square consolidated with Lexington & Grey Fox Road for Alternative 5 2: Lexington Avenue & Enterprise/Big O Tires/Arby's consolidated with Lexington & Target South for Alternative 5 /D Intersection ALT 3 ALT 4 ALT 5 LOS Delay (s)LOS Delay (s)LOS Delay (s) B /D 15.6 /40.6 Overall Intersection LOS / Worst Approach LOS Overall Intersection Delay / Worst Approach Delay 7.8 /30.6 A /D 6.7 /30.0 A /D 8.3 /32.5 A Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 34 April 18, 2019 Key conclusions of the traffic operations analysis include the following: x Alternative 0: Updated signal timing and coordination reduced overall delay and queuing at all intersections, while the Target South signal, with the reconfigured Lexington Station driveway tying into the signal from the west, performed at overall LOS A. x Alternative 1: Additional right-turn lanes at Red Fox Road, Target South, and Grey Fox Road slightly improved delay with the added benefit of safer operations (potential rear-end crash mitigation). x Alternative 2: Dual SB left-turn lanes at Red Fox Road improved overall delay by roughly six seconds per vehicle, as more green time could be provided for other movements. In addition, southbound left-turn 95th percentile queuing is expected to be significantly improved compared to Alternative 0, especially during the p.m. peak hour (No Build – 480 feet, Alternative 0 – 425 feet, Alternative 2 – 247 feet) allowing vehicles to stack within the provided turn lane bays. x Alternative 3: Modification of the WB approach at CR E improved overall delay during the p.m. peak hour, eliminated split phasing, and allowed for off-peak FYA operations. x Alternative 4: Reconfiguring both the Enterprise/Big O Tires/Arby’s and Shannon Square driveways to RIRO operation eliminated left-turn conflicts and improved side-street delay without hurting the overall performance of the adjacent signalized intersections. x Alternative 5: Removing access to the Enterprise/Big O Tires/Arby’s and Shannon Square driveways provided minimal improvements to side-street delay over Alternative 4. However, access removal allowed for better signal coordination and progression throughout the corridor. 4.4 Preliminary Alternatives Comparison Matrix A preliminary alternatives comparison matrix summarizing the key decision factors with respect to project goals is provided in Table 10. The key decision factors include: x Pros and Cons – Qualitative assessment of key advantages and disadvantages of the preliminary intersection alternatives x Operations Evaluation – Documentation of anticipated future traffic operations x Design Considerations – Qualitative assessment of design issues, considerations, property and right of way impacts 7DEOH3UHOLPLQDU\$OWHUQDWLYHV&RPSDULVRQ0DWUL[$OWHUQDWLYH%DVHOLQH,PSURYHPHQWVĞƐĐƌŝƉƚŝŽŶ WƌŽƐĂŶĚŽŶƐ KƉĞƌĂƚŝŽŶƐǀĂůƵĂƚŝŽŶ ĞƐŝŐŶŽŶƐŝĚĞƌĂƚŝŽŶdƌĂĨĨŝĐƐŝŐŶĂůŝŵƉƌŽǀĞŵĞŶƚƐĂůŽŶŐƚŚĞĞŶƚŝƌĞ>ĞǆŝŶŐƚŽŶǀĞŶƵĞĐŽƌƌŝĚŽƌŝŶĐůƵĚŝŶŐƉƌŽƚĞĐƚŝǀĞͬƉĞƌŵŝƐƐŝǀĞ&zůĞĨƚͲƚƵƌŶŽƉĞƌĂƚŝŽŶ͕ĂĚĚŝƚŝŽŶŽĨĂƚƌĂĨĨŝĐƐŝŐŶĂůĂƚdĂƌŐĞƚ^ŽƵƚŚ͕ƌĞĂůŝŐŶŵĞŶƚŽĨƚŚĞ>ĞǆŝŶŐƚŽŶ^ƚĂƚŝŽŶĚƌŝǀĞǁĂǇƚŽĂůŝŐŶǁŝƚŚƚŚĞŶĞǁdĂƌŐĞƚ^ŽƵƚŚƐŝŐŶĂů͕ĂŶĚĂĚĚŝƚŝŽŶŽĨĂŶƌŝŐŚƚͲƚƵƌŶůĂŶĞĂƚZĞĚ&ŽǆZŽĂĚ͘WƌŽƐ͗ϭ͘ůůŽǁƐĨŽƌƉĞƌŵŝƐƐŝǀĞ&zůĞĨƚͲƚƵƌŶŽƉĞƌĂƚŝŽŶƐĂƚĂůůƐŝŐŶĂůŝǌĞĚŝŶƚĞƌƐĞĐƚŝŽŶƐ͕ǁŚŝĐŚĐĂŶďĞĂŶŽƉĞƌĂƚŝŽŶĂůďĞŶĞĨŝƚƉĂƌƚŝĐƵůĂƌůǇĚƵƌŝŶŐƚŚĞŽĨĨͲƉĞĂŬŚŽƵƌƐϮ͘ƌŝǀĞƌĨĂŵŝůŝĂƌŝƚǇŽŶƐ͗ϭ͘ŽĞƐŶŽƚĂĚĚƌĞƐƐ^ZĞĚ&ŽǆZŽĂĚƋƵĞƵŝŶŐŝƐƐƵĞϮ͘ŽĞƐŶŽƚĞůŝŵŝŶĂƚĞŝŶĞĨĨŝĐŝĞŶƚZͬtƐƉůŝƚƉŚĂƐĞƐŝŐŶĂůƚŝŵŝŶŐϯ͘ŽĞƐŶŽƚŝŵƉƌŽǀĞƐŝĚĞͲƐƚƌĞĞƚĚĞůĂǇĂƚƐƚŽƉͲĐŽŶƚƌŽůůĞĚŝŶƚĞƌƐĞĐƚŝŽŶƐĚƵƌŝŶŐŵŝĚĚĂǇĂŶĚƉ͘ŵ͘ƉĞĂŬŚŽƵƌƐϰ͘>ŝŵŝƚĞĚƚƌĂĨĨŝĐƐĂĨĞƚǇŝŵƉƌŽǀĞŵĞŶƚĂůŽŶŐƚŚĞĐŽƌƌŝĚŽƌKǀĞƌĂůů/ŶƚĞƌƐĞĐƚŝŽŶ>K^ͬĞůĂǇ;ϮϬϰϬWDͿ͗>ĞǆŝŶŐƚŽŶͬZĞĚ&Žǆ͗>K^ͬϯϰ͘ϳ>ĞǆŝŶŐƚŽŶͬdĂƌŐĞƚ^ŽƵƚŚ͗>K^ͬϴ͘ϲ>ĞǆŝŶŐƚŽŶͬ'ƌĞǇ&Žǆ͗>K^ͬϭϳ͘Ϭ>ĞǆŝŶŐƚŽŶͬZ͗>K^ͬϰϴ͘ϴKƉĞƌĂƚŝŽŶƐǀĂůƵĂƚŝŽŶ,ŝŐŚůŝŐŚƚ͗^ŝŐŶŝĨŝĐĂŶƚůǇŝŵƉƌŽǀĞƐĚĞůĂǇͬƋƵĞƵĞŝŶŐƚŚƌŽƵŐŚŽƵƚƚŚĞĐŽƌƌŝĚŽƌĨŽƌďŽƚŚƉĞĂŬŚŽƵƌĂŶĚŽĨĨͲƉĞĂŬƉĞƌŝŽĚƐͲWƌŽǀŝĚĞ&zůĞĨƚͲƚƵƌŶƐŝŐŶĂůŝŶĚŝĐĂƚŝŽŶƐŽŶĂůůĨŽƵƌĂƉƉƌŽĂĐŚĞƐ;ŝĨŽƉƉŽƐŝŶŐůĞĨƚͲƚƵƌŶƉĂƚŚƐĚŽŶŽƚĐŽŶĨůŝĐƚͿĂƚZĞĚ&ŽǆZŽĂĚ͕dĂƌŐĞƚ^ŽƵƚŚ͕ĂŶĚ'ƌĞǇ&ŽǆZŽĂĚ͘KƉĞƌĂƚĞƉƌŽƚĞĐƚĞĚŽŶůǇůĞĨƚͲƚƵƌŶƐĚƵƌŝŶŐƉ͘ŵ͘ƉĞĂŬƉĞƌŝŽĚƐĂƚZĞĚ&ŽǆZŽĂĚŽƌĂƐĚĞĞŵĞĚĂƉƉƌŽƉƌŝĂƚĞƚŚƌŽƵŐŚĂ&zĂƐƐĞƐƐŵĞŶƚ͘$OWHUQDWLYH7XUQ/DQH$GGLWLRQVĞƐĐƌŝƉƚŝŽŶ WƌŽƐĂŶĚŽŶƐ KƉĞƌĂƚŝŽŶƐǀĂůƵĂƚŝŽŶ ĞƐŝŐŶŽŶƐŝĚĞƌĂƚŝŽŶ/ŶĐůƵĚĞƐĂůůůƚĞƌŶĂƚŝǀĞϬŝŵƉƌŽǀĞŵĞŶƚƐŝŶĂĚĚŝƚŝŽŶƚŽĂ^ƌŝŐŚƚͲƚƵƌŶůĂŶĞĂƚZĞĚ&ŽǆZŽĂĚ͕ĂEƌŝŐŚƚͲƚƵƌŶůĂŶĞĂƚdĂƌŐĞƚ^ŽƵƚŚ͕ĂŶĚĂ^ƌŝŐŚƚͲƚƵƌŶůĂŶĞĂƚ'ƌĞǇ&ŽǆZŽĂĚ͘WƌŽƐ͗ϭ͘/ŵƉƌŽǀĞƐƚƌĂĨĨŝĐƐĂĨĞƚǇĂŶĚŽƉĞƌĂƚŝŽŶƐďǇƉƌŽǀŝĚŝŶŐƌŝŐŚƚͲƚƵƌŶŵŽǀĞŵĞŶƚƐǁŝƚŚĂĚĞĚŝĐĂƚĞĚůĂŶĞŽŶƐ͗ϭ͘ŽĞƐŶŽƚŝŵƉƌŽǀĞůĞĨƚͲƚƵƌŶƐĂĨĞƚǇĂƚƐƚŽƉͲĐŽŶƚƌŽůůĞĚŝŶƚĞƌƐĞĐƚŝŽŶƐKǀĞƌĂůů/ŶƚĞƌƐĞĐƚŝŽŶ>K^ͬĞůĂǇ;ϮϬϰϬWDͿ͗>ĞǆŝŶŐƚŽŶͬZĞĚ&Žǆ͗>K^ͬϯϰ͘ϲ>ĞǆŝŶŐƚŽŶͬdĂƌŐĞƚ^ŽƵƚŚ͗>K^ͬϳ͘ϱ>ĞǆŝŶŐƚŽŶͬ'ƌĞǇ&Žǆ͗>K^ͬϭϱ͘ϱKƉĞƌĂƚŝŽŶƐǀĂůƵĂƚŝŽŶ,ŝŐŚůŝŐŚƚ͗^ůŝŐŚƚůǇŝŵƉƌŽǀĞƐďŽƚŚƚŚƌŽƵŐŚĂŶĚƌŝŐŚƚͲƚƵƌŶĚĞůĂǇͬƋƵĞƵĞŝŶŐĂƚZĞĚ&ŽǆZŽĂĚ͕dĂƌŐĞƚ^ŽƵƚŚ͕ĂŶĚ'ƌĞǇ&ŽǆZŽĂĚŝŶƚĞƌƐĞĐƚŝŽŶƐͲZĞƋƵŝƌĞƐĂĚĚŝƚŝŽŶĂůǁŝĚƚŚĂƚZĞĚ&ŽǆZŽĂĚ͕dĂƌŐĞƚ^ŽƵƚŚ͕ĂŶĚ'ƌĞǇ&ŽǆZŽĂĚŝŶƚĞƌƐĞĐƚŝŽŶƐƚŽĂĐĐŽŵŵŽĚĂƚĞĂĚĚĞĚƌŝŐŚƚͲƚƵƌŶůĂŶĞƐ͘$OWHUQDWLYH5HG)R[5RDG,QWHUVHFWLRQ'XDO6%/HIW7XUQ/DQHVĞƐĐƌŝƉƚŝŽŶ WƌŽƐĂŶĚŽŶƐ KƉĞƌĂƚŝŽŶƐǀĂůƵĂƚŝŽŶ ĞƐŝŐŶŽŶƐŝĚĞƌĂƚŝŽŶ/ŶĐůƵĚĞƐĂůůůƚĞƌŶĂƚŝǀĞƐϬͬϭŝŵƉƌŽǀĞŵĞŶƚƐŝŶĂĚĚŝƚŝŽŶƚŽĚƵĂů^ůĞĨƚͲƚƵƌŶůĂŶĞƐĂƚZĞĚ&ŽǆZŽĂĚ͘WƌŽƐ͗ϭ͘ĚĚƌĞƐƐĞƐƚŚĞ^ZĞĚ&ŽǆZŽĂĚƋƵĞƵŝŶŐŝƐƐƵĞďǇƉƌŽǀŝĚŝŶŐĂĚĚŝƚŝŽŶĂůůĞĨƚͲƚƵƌŶĐĂƉĂĐŝƚǇ͕ŵŝŶŝŵŝǌŝŶŐƚŚĞƉŽƚĞŶƚŝĂůĨŽƌ^ŵŽǀĞŵĞŶƚƋƵĞƵĞƐƚŽĞǆƚĞŶĚŝŶƚŽƚŚĞ>ĞǆŝŶŐƚŽŶǀĞŶƵĞͬ/ͲϲϵϰZĂŵƉƐŝŶƚĞƌƐĞĐƚŝŽŶŽŶƐ͗ϭ͘ŽƐƚŝŶĐƌĞĂƐĞǀŝĂƐŝŐŶŝĨŝĐĂŶƚƌĞĐŽŶƐƚƌƵĐƚŝŽŶŽĨƚŚĞ^ĂƉƉƌŽĂĐŚ͕ĂŶĚƉŽƚĞŶƚŝĂůƌĞĂůŝŐŶŵĞŶƚŽĨƚŚĞEĂƉƉƌŽĂĐŚĂƐǁĞůůϮ͘ĚĚŝƚŝŽŶĂůĐŽƐƚƚŽŝƚǇŽĨ^ŚŽƌĞǀŝĞǁƚŽĞǆƚĞŶĚƌŝŐŚƚͲƚƵƌŶƚƌĂƉƚŽƐĞĐŽŶĚdĂƌŐĞƚĚƌŝǀĞǁĂǇŽŶZĞĚ&ŽǆZŽĂĚƚŽŵŝŶŝŵŝǌĞƉŽƚĞŶƚŝĂůŵĞƌŐŝŶŐĐŽŶĨůŝĐƚƐ͘KǀĞƌĂůů/ŶƚĞƌƐĞĐƚŝŽŶ>K^ͬĞůĂǇ;ϮϬϰϬWDͿ͗>ĞǆŝŶŐƚŽŶͬZĞĚ&Žǆ͗>K^ͬϮϴ͘ϱKƉĞƌĂƚŝŽŶƐǀĂůƵĂƚŝŽŶ,ŝŐŚůŝŐŚƚ͗/ŵƉƌŽǀĞƐ^ůĞĨƚͲƚƵƌŶƋƵĞƵĞŝŶŐ͕ǁŚŝůĞƐůŝŐŚƚůǇŝŵƉƌŽǀŝŶŐŽƚŚĞƌŵŽǀĞŵĞŶƚƐĚƵĞƚŽŝŶĐƌĞĂƐĞƐŝŶĂůůŽƚƚĞĚŐƌĞĞŶƚŝŵĞͲZĞƋƵŝƌĞƐĂĚĚŝƚŝŽŶĂůǁŝĚƚŚĂƚZĞĚ&ŽǆZŽĂĚŝŶƚĞƌƐĞĐƚŝŽŶƚŽĂĐĐŽŵŵŽĚĂƚĞĚĚƵĂů^ůĞĨƚͲƚƵƌŶůĂŶĞƐ͘ͲDĂǇƌĞƋƵŝƌĞĂĚĚŝƚŝŽŶĂůĐŽŶƐƚƌƵĐƚŝŽŶŽŶZĞĚ&ŽǆZŽĂĚ$OWHUQDWLYH&RXQW\5RDG(,QWHUVHFWLRQ,PSURYHPHQWVĞƐĐƌŝƉƚŝŽŶ WƌŽƐĂŶĚŽŶƐ KƉĞƌĂƚŝŽŶƐǀĂůƵĂƚŝŽŶ ĞƐŝŐŶŽŶƐŝĚĞƌĂƚŝŽŶ/ŶĐůƵĚĞƐĂůůůƚĞƌŶĂƚŝǀĞƐϬͬϭͬϮŝŵƉƌŽǀĞŵĞŶƚƐŝŶĂĚĚŝƚŝŽŶƚŽƚŚĞŵŽĚŝĨŝĐĂƚŝŽŶŽĨƚŚĞtĂƉƉƌŽĂĐŚĂƚŽƵŶƚǇZŽĂĚ͕ĂůůŽǁŝŶŐĐŽŶĐƵƌƌĞŶƚͬtůĞĨƚͲƚƵƌŶŵŽǀĞŵĞŶƚƐĂŶĚĞůŝŵŝŶĂƚŝŽŶŽĨƐƉůŝƚƉŚĂƐŝŶŐ͘WƌŽƐ͗ϭ͘ůŝŵŝŶĂƚĞƐŝŶĞĨĨŝĐŝĞŶƚͬtƐƉůŝƚƉŚĂƐŝŶŐďǇĂůůŽǁŝŶŐĐŽŶĐƵƌƌĞŶƚůĞĨƚͲƚƵƌŶŵĂŶĞƵǀĞƌƐŽŶƐ͗ϭ͘DŽĚĞƌĂƚĞĐŽƐƚǀŝĂŵĞĚŝĂŶƌĞĐŽŶƐƚƌƵĐƚŝŽŶŽŶƚŚĞtĂƉƉƌŽĂĐŚϮ͘ZĞƋƵŝƌĞƐŶĞǁϱϱΖŵĂƐƚĂƌŵŝŶĂĚĚŝƚŝŽŶƚŽĂϱΖĞǆƚĞŶĚĞƌĨŽƌƚŚĞtƚƌĂĨĨŝĐƐŝŐŶĂůŝŶĚŝĐĂƚŝŽŶƐ;EtƋƵĂĚƌĂŶƚƐŝŐŶĂůƉŽůĞͿKǀĞƌĂůů/ŶƚĞƌƐĞĐƚŝŽŶ>K^ͬĞůĂǇ;ϮϬϰϬWDͿ͗>ĞǆŝŶŐƚŽŶͬZ͗>K^ͬϰϮ͘ϴKƉĞƌĂƚŝŽŶƐǀĂůƵĂƚŝŽŶ,ŝŐŚůŝŐŚƚ͗/ŵƉƌŽǀĞƐĚĞůĂǇĨŽƌĂůůĂƉƉƌŽĂĐŚĞƐĚƵƌŝŶŐƉ͘ŵ͘ƉĞĂŬŚŽƵƌ͕ǁŝƚŚƉŽƚĞŶƚŝĂůĨŽƌĨƵƌƚŚĞƌŵŝŶŝŵŝǌĞĚĚĞůĂǇĚƵƌŝŶŐŽĨĨͲƉĞĂŬƉĞƌŝŽĚƐͲZĞƋƵŝƌĞƐŵŽĚĞƌĂƚĞŵĞĚŝĂŶƌĞĐŽŶƐƚƌƵĐƚŝŽŶŽŶƚŚĞtĂƉƉƌŽĂĐŚͲZĞƋƵŝƌĞƐƐƚƌŝƉŝŶŐĂŶĚƐŝŐŶŝŶŐŵŽĚŝĨŝĐĂƚŝŽŶƐͲZĞƋƵŝƌĞƐŵŽĚŝĨŝĐĂƚŝŽŶƐƚŽEtƋƵĂĚƌĂŶƚƐŝŐŶĂůƉŽůĞͲ^ĞƉĂƌĂƚĞůĞĨƚͲƚƵƌŶͬƚŚƌŽƵŐŚͬƌŝŐŚƚͲƚƵƌŶůĂŶĞƐǁĞƌĞĐŽŶƐŝĚĞƌĞĚ͕ďƵƚƚŚĞĨůĞǆŝďŝůŝƚǇŽĨĨĞƌĞĚďǇƚŚĞĞǆŝƐƚŝŶŐƐŚĂƌĞĚƚŚƌŽƵŐŚͬƌŝŐŚƚͲƚƵƌŶůĂŶĞŵŝŶŝŵŝǌĞƐƉŽƚĞŶƚŝĂůĨŽƌůĞŶŐƚŚǇƐŽƵƚŚďŽƵŶĚƋƵĞƵĞƐĚƵƌŝŶŐƉĞĂŬŚŽƵƌƐ͘$OWHUQDWLYH'ULYHZD\$FFHVV5HVWULFWLRQVĞƐĐƌŝƉƚŝŽŶ WƌŽƐĂŶĚŽŶƐ KƉĞƌĂƚŝŽŶƐǀĂůƵĂƚŝŽŶ ĞƐŝŐŶŽŶƐŝĚĞƌĂƚŝŽŶ/ŶĐůƵĚĞƐĂůůůƚĞƌŶĂƚŝǀĞƐϬͬϭͬϮͬϯŝŵƉƌŽǀĞŵĞŶƚƐŝŶĂĚĚŝƚŝŽŶƚŽƌĞĐŽŶĨŝŐƵƌŝŶŐďŽƚŚƚŚĞŶƚĞƌƉƌŝƐĞͬŝŐKdŝƌĞƐͬƌďǇ͛ƐĂŶĚ^ŚĂŶŶŽŶ^ƋƵĂƌĞĚƌŝǀĞǁĂǇƐƚŽ^Z/ZKŽƉĞƌĂƚŝŽŶ͕ĂŶĚƚŚĞĞǆƚĞŶƐŝŽŶŽĨƚŚĞEƌŝŐŚƚͲƚƵƌŶůĂŶĞĂƚƚŚĞ/ͲϲϵϰZĂŵƉŝŶƚĞƌƐĞĐƚŝŽŶ͘WƌŽƐ͗ϭ͘/ŵƉƌŽǀĞƐƚƌĂĨĨŝĐƐĂĨĞƚǇďǇĞůŝŵŝŶĂƚŝŶŐƵŶƐŝŐŶĂůŝǌĞĚůĞĨƚͲƚƵƌŶŵŽǀĞŵĞŶƚƐĨƌŽŵƐŝĚĞͲƐƚƌĞĞƚƐϮ͘DŝŶŝŵŝǌĞƐƉŽƚĞŶƚŝĂůĨŽƌEƚŚƌŽƵŐŚŵŽǀĞŵĞŶƚƋƵĞƵĞƐƚŽďůŽĐŬĂĐĐĞƐƐƚŽƚŚĞEƌŝŐŚƚͲƚƵƌŶůĂŶĞŽŶƐ͗ϭ͘^ůŝŐŚƚŝŶĐƌĞĂƐĞŝŶĚĞůĂǇĨŽƌƐŝĚĞͲƐƚƌĞĞƚŵŽǀĞŵĞŶƚƐĂƚƐŝŐŶĂůŝǌĞĚŝŶƚĞƌƐĞĐƚŝŽŶƐϮ͘WŽƚĞŶƚŝĂůƚŽŝŶƚƌŽĚƵĐĞ^ƚŽEhͲƚƵƌŶŵĂŶĞƵǀĞƌƐĂƚƚŚĞZŝŶƚĞƌƐĞĐƚŝŽŶKǀĞƌĂůů/ŶƚĞƌƐĞĐƚŝŽŶ>K^ͬĞůĂǇ;ϮϬϰϬWDͿ͗>ĞǆŝŶŐƚŽŶͬdĂƌŐĞƚ^ŽƵƚŚ͗>K^ͬϳ͘ϴ>ĞǆŝŶŐƚŽŶͬ'ƌĞǇ&Žǆ͗>K^ͬϮϭ͘ϬKƉĞƌĂƚŝŽŶƐǀĂůƵĂƚŝŽŶ,ŝŐŚůŝŐŚƚ͗^ůŝŐŚƚŝŶĐƌĞĂƐĞŝŶĚĞůĂǇĨŽƌƐŝĚĞͲƐƚƌĞĞƚŵŽǀĞŵĞŶƚƐĂƚƐŝŐŶĂůŝǌĞĚŝŶƚĞƌƐĞĐƚŝŽŶƐ͕ƚŚŽƵŐŚŝŵƉƌŽǀĞĚƐĂĨĞƚǇĂƚƵŶƐŝŐŶĂůŝǌĞĚŝŶƚĞƌƐĞĐƚŝŽŶƐͲZĂŝƐĞĚŵĞĚŝĂŶƚŚƌŽƵŐŚŽƵƚƚŚĞ>ĞǆŝŶŐƚŽŶǀĞŶƵĞĐŽƌƌŝĚŽƌǁŽƵůĚƉƌĞǀĞŶƚŵŽƚŽƌŝƐƚƐĨƌŽŵŵĂŬŝŶŐůĞĨƚͲƚƵƌŶƐĨƌŽŵƚŚĞƐŝĚĞͲƐƚƌĞĞƚƐĂƚƵŶƐŝŐŶĂůŝǌĞĚŝŶƚĞƌƐĞĐƚŝŽŶƐ$OWHUQDWLYH'ULYHZD\$FFHVV&ORVXUHVĞƐĐƌŝƉƚŝŽŶ WƌŽƐĂŶĚŽŶƐ KƉĞƌĂƚŝŽŶƐǀĂůƵĂƚŝŽŶ ĞƐŝŐŶŽŶƐŝĚĞƌĂƚŝŽŶ/ŶĐůƵĚĞƐĂůůůƚĞƌŶĂƚŝǀĞƐϬͬϭͬϮͬϯͬϰŝŵƉƌŽǀĞŵĞŶƚƐŝŶĂĚĚŝƚŝŽŶƚŽƌĞŵŽǀŝŶŐĂĐĐĞƐƐƚŽďŽƚŚƚŚĞŶƚĞƌƉƌŝƐĞͬŝŐKdŝƌĞƐͬƌďǇ͛ƐĂŶĚ^ŚĂŶŶŽŶ^ƋƵĂƌĞĚƌŝǀĞǁĂǇƐ͕ĂƐǁĞůůĂƐƚŚĞĂĚĚŝƚŝŽŶŽĨĂ^ƌŝŐŚƚͲƚƵƌŶůĂŶĞĂƚdĂƌŐĞƚ^ŽƵƚŚ͘WƌŽƐ͗ϭ͘&ƵƌƚŚĞƌŝŵƉƌŽǀĞƐƚƌĂĨĨŝĐƐĂĨĞƚǇďǇĞůŝŵŝŶĂƚŝŶŐĚƌŝǀĞǁĂǇƐ;ƉŽƚĞŶƚŝĂůĐŽŶĨůŝĐƚƉŽŝŶƚƐͿĂůŽŶŐ>ĞǆŝŶŐƚŽŶǀĞŶƵĞϮ͘ůůŽǁƐĨŽƌŝŵƉƌŽǀĞĚ>ĞǆŝŶŐƚŽŶǀĞŶƵĞĐŽƌƌŝĚŽƌƚŚƌŽƵŐŚƉƵƚďǇŽƉƚŝŵŝǌŝŶŐƐŝŐŶĂůƚŝŵŝŶŐĨŽƌEͬ^ŵŽǀĞŵĞŶƚƐŽŶƐ͗ϭ͘^ůŝŐŚƚŝŶĐƌĞĂƐĞŝŶĚĞůĂǇĨŽƌƐŝĚĞͲƐƚƌĞĞƚŵŽǀĞŵĞŶƚƐĂƚƐŝŐŶĂůŝǌĞĚŝŶƚĞƌƐĞĐƚŝŽŶƐKǀĞƌĂůů/ŶƚĞƌƐĞĐƚŝŽŶ>K^ͬĞůĂǇ;ϮϬϰϬWDͿ͗>ĞǆŝŶŐƚŽŶͬdĂƌŐĞƚ^ŽƵƚŚ͗>K^ͬϲ͘ϳ>ĞǆŝŶŐƚŽŶͬ'ƌĞǇ&Žǆ͗>K^ͬϭϱ͘ϲKƉĞƌĂƚŝŽŶƐǀĂůƵĂƚŝŽŶ,ŝŐŚůŝŐŚƚ͗^ůŝŐŚƚŝŶĐƌĞĂƐĞŝŶĚĞůĂǇĨŽƌƐŝĚĞͲƐƚƌĞĞƚŵŽǀĞŵĞŶƚƐĂƚƐŝŐŶĂůŝǌĞĚŝŶƚĞƌƐĞĐƚŝŽŶƐ͕ƚŚŽƵŐŚŝŵƉƌŽǀĞĚƐĂĨĞƚǇĂƚƵŶƐŝŐŶĂůŝǌĞĚŝŶƚĞƌƐĞĐƚŝŽŶƐͲZĞƋƵŝƌĞƐĂĚĚŝƚŝŽŶĂůǁŝĚƚŚĂƚdĂƌŐĞƚ^ŽƵƚŚŝŶƚĞƌƐĞĐƚŝŽŶƚŽĂĐĐŽŵŵŽĚĂƚĞ^ƌŝŐŚƚͲƚƵƌŶůĂŶĞ Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 36 April 18, 2019 4.5 Selection of Preferred Alternative Based on the preliminary alternatives analysis, geometric considerations evaluated, preliminary comparison matrix, and discussion with Ramsey County, the City of Arden Hills, and the City of Shoreview, Alternative 4 was selected for detailed evaluation with the inclusion of a southbound right-turn lane at Grey Fox Road (listed under Alternative 5). 4.6 Preferred Alternative Analysis The goal of the preferred alternative analysis is to evaluate in greater detail the selected improvements and to present the key decision-making factors that aid in developing the study recommendations. Key elements of the preferred alternative analysis include: x Operational analysis of the forecast year 2040 a.m., midday, and p.m. peak hours x Document key decision-making factors 4.6.1 Preferred Alternative Traffic Operations Analysis In addition to the year 2040 p.m. peak hour already analyzed under the preliminary alternatives traffic operations analysis, the year 2040 a.m. and midday peak hours were analyzed using Synchro/SimTraffic software. Results of the preferred alternative traffic operations analysis shown in Table 11 indicate that each study intersection is expected to operate at LOS C or better during the year 2040 peak hours, except the Lexington Avenue / CR E intersection which operates at LOS D during the p.m. peak hour. Detailed operations and queuing analysis results are presented in Appendix A. Table 11. Operations Analysis Summary – Preferred Alternative (Forecast Year 2040) Lexington Avenue & Red Fox Road B / C 11.7 / 28.8 C / D 25.2 / 36.3 C / D 26.9 / 44.5 Lexington Avenue & Lexington Station Lexington Avenue & Target South Lexington Avenue & Enterprise/Big O Tires/Arby's A / B 0.6 / 10.1 A / A 1.3 / 9.6 A / B 1.3 / 11.4 Lexington Avenue & Grey Fox Road A / C 6.8 / 29.3 B / D 16.7 / 38.8 C / D 20.0 / 43.4 Lexington Avenue & Shannon Square A / A 2.0 / 6.2 A / B 3.6 / 10.6 A / C 4.9 / 17.1 Lexington Avenue & CR E C / C 22.9 / 35.0 C / D 27.5 / 44.1 D / E 42.7 / 62.2 Overall Intersection LOS / Worst Approach LOS Overall Intersection Delay / Worst Approach Delay A /D 8.2 /30.111.5 /34.0A/D 3.4 /28.8 B /D Intersection AM Peak Hour MID Peak Hour PM Peak Hour LOS Delay (s)LOS Delay (s)LOS Delay (s) Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 37 April 18, 2019 Key delay and queuing observations include the following: Lexington Avenue & Red Fox Road Results of the preferred alternative traffic operations analysis indicate that the Lexington Avenue / Red Fox Road intersection is expected to operate at overall LOS C or better under the forecast year 2040 peak hour traffic volumes. In addition, southbound queuing is expected to be significantly improved with the addition of dual southbound left-turn lanes. Furthermore, westbound queuing is expected to be improved with the addition of a westbound right-turn overlap with the southbound left-turn signal phase. Lexington Avenue & Target South Results of the preferred alternative traffic operations analysis indicate that the Lexington Avenue / Target South intersection is expected to operate at overall LOS B or better under the forecast year 2040 peak hour traffic volumes. However, eastbound queuing should be considered if/when Lexington Station and Enterprise/Big O Tires/Arby’s driveways are consolidated at the Target South intersection. Lexington Avenue & Grey Fox Road Results of the preferred alternative traffic operations analysis indicate that the Lexington Avenue / Grey Fox Road intersection is expected to operate at overall LOS C or better under the forecast year 2040 peak hour traffic volumes. It should be noted that side-street operations are somewhat dependent on the driveway configuration at Shannon Square, with RIRO or full closure resulting in slight increases in side-street delay at Grey Fox Road. Lexington Avenue & County Road E Results of the preferred alternative traffic operations analysis indicate that the Lexington Avenue / CR E intersection is expected to operate at overall LOS D or better under the forecast year 2040 peak hour traffic volumes. With the reconfiguration of the westbound approach to allow concurrent EB/WB left-turn movements and removal of split signal phasing, overall delay and queuing are expected to be improved. Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 38 April 18, 2019 4.6.2 Key Decision Factors Operations were improved across all peak hours. Key decision factors for each intersection are: Lexington Avenue & Red Fox Road At the Lexington Avenue / Red Fox Road intersection where the southbound approach was the primary concern (southbound left-turns in particular), expanding the intersection to accommodate dual southbound left-turn lanes was a key factor in managing queues. Additional operational benefits are achieved through the separation of left-turn/through/right-turn movements into dedicated lanes, while providing permissive FYA left-turn operations for all approaches during off-peak hours. An additional improvement recommended in conjunction with the dual SB left-turn lanes involves extending the eastbound Red Fox Road right-turn lane trap approximately 265 feet east to the second Target driveway, thus minimizing potential merging conflicts. However, it should be noted that this recommended improvement is not expected to be implemented as part of the Lexington Avenue reconstruction. Therefore, operational and safety performance along eastbound Red Fox Road should continue to be monitored, and the recommended lane extension made in the future if performance is determined to be inadequate. Lexington Avenue & Target South At the Lexington Avenue / Target South intersection where side-street operations were the primary concern, the installation of a new traffic signal facilitated operational and safety improvements. Furthermore, consolidating the Lexington Station and Enterprise/Big O Tires/Arby’s driveways to oppose Target South would further improve safety along the Lexington Avenue corridor. Lexington Avenue & Grey Fox Road At the Lexington Avenue / Grey Fox Road intersection, improving side-street operations while also improving coordination along the Lexington Avenue corridor was the key factor in restriping and resigning the eastbound/westbound lane geometry. These operational improvements allowed consideration of access restrictions at the Shannon Square driveway to the south. Lexington Avenue & County Road E At the Lexington Avenue / CR E intersection, eliminating eastbound/westbound split signal phasing while providing protective/permissive FYA left-turn operations for the entire intersection was a key factor in improving operations. Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 39 April 18, 2019 5.0 Conclusions/Recommendations The selection of a preferred alternative for the Lexington Avenue corridor was made based upon discussions with Ramsey County, the City of Arden Hills, and the City of Shoreview as well as results of the analysis herein and consideration of key decision factors. For reference, a concept layout detailing the preferred alternative and final recommended geometrics at each intersection is included in Appendix C. The key conclusions for the recommended preferred alternative are documented as follows: Overall Improvements x Replace traffic signal infrastructure as needed throughout the Lexington Avenue corridor from the I-694 WB Ramp Terminal (north end) intersection through CR E (south end) x Update signal timing throughout the Lexington Avenue corridor from CR F (north end) through CR E (south end) o Provide FYA left-turn operations o Provide a leading pedestrian interval (LPI) upon actuation at all signalized intersections to improve pedestrian visibility/comfort x Replace existing continuous TWLTL with a raised median throughout the Lexington Avenue corridor from Red Fox Road (north end) to CR E (south end) o Provide pocket left-turn lanes at all signalized intersections Pedestrian/Bicycle Improvements x The existing mixed-use path along the east side of Lexington Avenue will be maintained for the entire length of the corridor x Sidewalk will be installed along the west side of Lexington Avenue, connecting the existing two sidewalk segments, to provide pedestrian access starting at Red Fox Road and extending south beyond CR E x LPI at all signalized intersections, as previously noted Transit Improvements x The existing bus stops along Lexington Avenue will be maintained or relocations will be coordinated with Metro Transit x Under the proposed roadway layout, bus stops that were previously located in through lanes could now be located in dedicated right-turn lanes at the following intersections: o Lexington Avenue & Red Fox Road o Lexington Avenue & Target South (northbound only) If added, a southbound stop could be located in a dedicated right-turn lane o Lexington Avenue & Grey Fox Road Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 40 April 18, 2019 Lexington Avenue & Red Fox Road Proposed improvements: x Add a dedicated EB right-turn lane x Add a dedicated SB right-turn lane x Add dual SB left-turn lanes x Modify signal timing to provide WB right-turn overlap with SB left-turn movement x Extend NB right-turn lane at I-694 EB Ramp Intersection to the Exxon gas station driveway Key benefits include: x Provides significant operational benefit during peak and non-peak periods o Expected to operate at overall LOS C or better under forecast year 2040 conditions o Southbound 95th percentile queuing is expected to be significantly improved compared to Alternative 0, especially during the p.m. peak hour (No Build – 480 feet, Alternative 0 – 425 feet, Preferred Alternative – 272 feet) x Provides flexibility for protective/permissive, protected only, or permissive only operation as determined through a FYA assessment analysis x Protective only phasing for the dual SB left-turn lanes during peak periods is likely to reduce crashes previously associated with poor gap selection under protective/permissive “green ball” operation Key design considerations include: x Reconstruction of the southbound approach is required x Provide four-section left-turn heads with FYA indications on all approaches o Operate the NB/SB left-turn movements protected only all day except for overnight periods or as deemed appropriate through a FYA assessment analysis Future considerations include: x Monitor operational and safety performance along EB Red Fox Road o If performance is determined to be inadequate, consider extending the EB right-turn lane trap approximately 265 feet east to the second Target driveway to minimize potential merging conflicts. Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 41 April 18, 2019 Lexington Avenue & Target South Proposed improvements: x Relocate Lexington Station access to align with new Target South signal x Add a dedicated NB right-turn lane x Add a dedicated SB right-turn lane x Modify Enterprise / Big O Tires / Arby’s driveway to RIRO access Key benefits include: x Provides significant operational benefit during peak and non-peak periods o Expected to operate at overall LOS B or better under forecast year 2040 conditions o Improves side-street delay and queuing x Provides flexibility for protective/permissive, protected only, or permissive only operation as determined through a FYA assessment analysis Key design considerations include: x Construction of an eastbound approach is required to connect to Lexington Station, in addition to the installation of a new traffic signal system x Provide four-section left-turn heads with FYA indications on all approaches o Operate the NB/SB left-turn movements protective/permissive all day except for overnight periods o Operate the EB/WB left-turn movements as permissive only all day Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 42 April 18, 2019 Lexington Avenue & Grey Fox Road Proposed improvements: x Add a dedicated SB right-turn lane x Modify Shannon Square driveway to RIRO access x Modification of EB/WB lane geometry to provide a dedicated left-turn lane and shared through / right-turn lane Key benefits include: x Provides operational benefit during peak and non-peak periods o Expected to operate at overall LOS C or better under forecast year 2040 conditions o Improves side-street delay and queuing x Provides flexibility for protective/permissive, protected only, or permissive only operation as determined through a FYA assessment analysis Key design considerations include: x Provide four-section left-turn heads with FYA indications on all approaches o Operate the NB/SB left-turn movements protective/permissive all day except for overnight periods o Operate the EB/WB left-turn movements protective/permissive between 7 a.m. – 7 p.m. x Potentially eliminate access to Shannon Square to further improve safety along the corridor by removing intermediate access and conflict points between signals Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 43 April 18, 2019 Lexington Avenue & County Road E Proposed improvements: x Modify the WB approach median to offset the left-turn lane further south Key benefits include: x Provides operational benefit during peak and non-peak periods o Expected to operate at overall LOS D or better under forecast year 2040 conditions x Eliminates EB/WB split phase signal timing x Provides flexibility for protective/permissive, protected only, or permissive only operation as determined through a FYA assessment analysis Key design considerations include: x Reconstruction of the westbound approach is required in addition to restriping and resigning east of the intersection x Requires a new 55-foot mast arm in addition to a 5-foot mast arm extender for the WB traffic signal indications (NW quadrant signal pole) x Provide four-section left-turn heads with FYA indications on all approaches o Operate the EB/WB left-turn movements as protected only all day except for overnight periods or as deemed appropriate through a FYA assessment analysis o Operate the NB/SB left-turn movements as protective/permissive all day except for overnight periods Optional Improvements Additional improvements that are not warranted based on operational and safety analyses but may be included as part of the overall reconstruction of the Lexington Avenue corridor include: x Add a dedicated NB right-turn lane at Grey Fox Road x A three-quarter access at the Shannon Square driveway is acceptable if RIRO access is not feasible (EB left-turns prohibited) 7UDIILF6WXG\ /H[LQJWRQ$YHQXH5HFRQVWUXFWLRQ $OOLDQW1R$ $SSHQGL[$ 'HWDLOHG,QWHUVHFWLRQ2SHUDWLRQV$QDO\VLV >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ/ͲϲϵϰtZĂŵƉƐ ͬ Ϯϯ͘ϯ ͬ ϯϴ͘ϴ ͬ ϭϵ͘ϭ ͬ Ϯϵ͘Ϯ ͬ Ϯϯ͘ϲ ͬ ϯϰ͘ϵ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ/ͲϲϵϰZĂŵƉƐ ͬ Ϯϯ͘Ϯ ͬ ϯϴ͘Ϯ ͬ ϭϰ͘ϳ ͬ ϮϮ͘ϲ ͬ ϭϵ͘ϳ ͬ Ϯϵ͘Ϭ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘZĞĚ&ŽǆZŽĂĚ ͬ ϭϭ͘ϱ ͬ Ϯϵ͘ϲ ͬ ϮϮ͘ϳ ͬ Ϯϴ͘ϵ ͬ Ϯϵ͘ϵ ͬϯϵ͘ϴ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ>ĞǆŝŶŐƚŽŶ^ƚĂƚŝŽŶ ͬ ϭ͘ϰ ͬ ϳ͘ϴ ͬ & ϮϬ͘ϲ ͬ ϮϬϴ͘ϳ ͬ &ϴ͘ϵ ͬ ϭϬϵ͘ϵ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘdĂƌŐĞƚ^ŽƵƚŚ ͬ Ϭ͘ϲ ͬ ϭϮ͘ϱ ͬ & ϭϬ͘Ϯ ͬ ϵϯ͘ϵ ͬ & ϰ͘ϲ ͬ ϲϱ͘Ϯ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘŶƚĞƌƉƌŝƐĞͬŝŐKdŝƌĞƐͬƌďǇΖƐ ͬ Ϭ͘ϳ ͬ ϭϭ͘ϱ ͬ Ϯ͘ϱ ͬ ϰϴ͘ϱ ͬ ϭ͘ϰ ͬ ϭϱ͘ϵ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ'ƌĞǇ&ŽǆZŽĂĚ ͬ ϲ͘ϰ ͬ ϯϭ͘ϰ ͬ ϵ͘ϰ ͬ Ϯϲ͘ϵ ͬ ϭϰ͘ϭ ͬ ϯϬ͘ϵ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ^ŚĂŶŶŽŶ^ƋƵĂƌĞ ͬ Ϯ͘ϱ ͬ ϴ͘Ϭ ͬ ϰ͘ϰ ͬ ϭϲ͘Ϯ ͬ ϱ͘ϴ ͬ ϮϬ͘ϳ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘZ ͬ Ϯϭ͘ϰ ͬ ϯϮ͘ϳ ͬ Ϯϭ͘ϯ ͬ ϯϭ͘Ϭ ͬ ϰϬ͘ϵ ͬ ϱϯ͘Ϯ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ/ͲϲϵϰtZĂŵƉƐ ͬ ϮϮ͘ϭ ͬ ϯϰ͘ϵ ͬ ϮϬ͘ϭ ͬ ϯϮ͘Ϭ ͬ Ϯϰ͘ϳ ͬ ϯϲ͘ϳ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ/ͲϲϵϰZĂŵƉƐ ͬ ϮϬ͘ϯ ͬ ϯϬ͘ϲ ͬ ϭϱ͘ϭ ͬ Ϯϯ͘ϲ ͬ ϮϬ͘Ϭ ͬ Ϯϳ͘ϯ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘZĞĚ&ŽǆZŽĂĚ ͬ ϭϭ͘ϲ ͬ ϯϬ͘Ϯ ͬ Ϯϯ͘ϴ ͬ Ϯϴ͘ϭ ͬ ϯϯ͘ϳ ͬϰϴ͘Ϯ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ>ĞǆŝŶŐƚŽŶ^ƚĂƚŝŽŶ ͬ ϭ͘ϰ ͬ ϳ͘ϯ ͬ & ϯϬ͘ϯ ͬ Ϯϵϰ͘ϲ ͬ &ϮϮ͘ϳ ͬ ϯϭϭ͘Ϭ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘdĂƌŐĞƚ^ŽƵƚŚ ͬ Ϭ͘ϲ ͬ ϭϯ͘Ϭ ͬ & ϲ͘ϯ ͬ ϱϲ͘ϳ ͬ & ϱ͘ϳ ͬ ϴϭ͘ϴ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘŶƚĞƌƉƌŝƐĞͬŝŐKdŝƌĞƐͬƌďǇΖƐ ͬ Ϭ͘ϲ ͬ ϭϬ͘ϳ ͬ & Ϯ͘ϰ ͬ ϱϬ͘ϭ ͬ ϭ͘ϱ ͬ Ϯϯ͘Ϯ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ'ƌĞǇ&ŽǆZŽĂĚ ͬ ϲ͘ϳ ͬ ϯϬ͘Ϯ ͬ ϭϬ͘Ϭ ͬ Ϯϴ͘ϲ ͬ ϭϯ͘ϯ ͬϮϵ͘Ϯ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ^ŚĂŶŶŽŶ^ƋƵĂƌĞ ͬ Ϯ͘ϲ ͬ ϭϬ͘ϰ ͬ ϰ͘ϰ ͬ ϭϴ͘Ϭ ͬ ϳ͘ϴ ͬ ϰϯ͘ϲ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘZ ͬ Ϯϭ͘ϴ ͬ ϯϮ͘ϰ ͬ Ϯϭ͘Ϯ ͬ ϯϭ͘ϭ ͬ ϰϯ͘Ϭ ͬ ϱϮ͘ϰ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ/ͲϲϵϰtZĂŵƉƐ ͬ & ϯϴ͘Ϭ ͬ ϴϭ͘Ϯ ͬ ϮϮ͘Ϯ ͬ ϯϰ͘Ϭ ͬ & ϱϰ͘ϰ ͬ ϵϴ͘ϳ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ/ͲϲϵϰZĂŵƉƐ ͬ Ϯϲ͘ϳ ͬ ϰϱ͘Ϭ ͬ ϭϴ͘Ϯ ͬ ϯϮ͘ϳ ͬ & ϱϭ͘ϱ ͬ ϮϬϱ͘ϵ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘZĞĚ&ŽǆZŽĂĚ ͬ ϭϯ͘ϲ ͬ Ϯϵ͘ϳ ͬ ϯϬ͘ϭ ͬ ϯϲ͘ϴ ͬ ϱϴ͘ϭ ͬϳϵ͘Ϯ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ>ĞǆŝŶŐƚŽŶ^ƚĂƚŝŽŶ ͬ ϭ͘ϳ ͬ ϭϬ͘ϰ & ͬ & ϭϬϮ͘Ϯ ͬ хϯϬϬ &ͬ & ϭϬϴ͘ϵ ͬ хϯϬϬ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘdĂƌŐĞƚ^ŽƵƚŚ ͬ Ϭ͘ϳ ͬ ϮϬ͘ϭ ͬ & Ϯϰ͘ϳ ͬ Ϯϯϱ͘Ϭ ͬ & ϮϬ͘ϰ ͬхϯϬϬ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘŶƚĞƌƉƌŝƐĞͬŝŐKdŝƌĞƐͬƌďǇΖƐ ͬ Ϭ͘ϳ ͬ ϭϮ͘ϯ ͬ Ϯ͘ϱ ͬ ϰϭ͘ϱ ͬ & ϳ͘ϱ ͬ ϭϬϵ͘ϵ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ'ƌĞǇ&ŽǆZŽĂĚ ͬ ϲ͘ϲ ͬ ϯϭ͘ϳ ͬ ϭϬ͘ϲ ͬ Ϯϲ͘ϲ ͬ & Ϯϱ͘ϱ ͬϵϰ͘ϴ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ^ŚĂŶŶŽŶ^ƋƵĂƌĞ ͬ Ϯ͘ϳ ͬ ϭϭ͘ϭ ͬ ϲ͘ϰ ͬ ϯϰ͘ϵ ͬ ϴ͘ϲ ͬ ϰϭ͘ϱ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘZ ͬ Ϯϯ͘ϰ ͬ ϯϯ͘ϱ ͬ ϮϮ͘ϵ ͬ ϯϮ͘Ϯ ͬ ϱϰ͘ϱ ͬ ϳϬ͘Ϯ KǀĞƌĂůů/ŶƚĞƌƐĞĐƚŝŽŶ>K^ͬtŽƌƐƚƉƉƌŽĂĐŚ>K^ KǀĞƌĂůů/ŶƚĞƌƐĞĐƚŝŽŶĞůĂǇͬtŽƌƐƚƉƉƌŽĂĐŚĞůĂǇ KǀĞƌĂůů/ŶƚĞƌƐĞĐƚŝŽŶ>K^ͬtŽƌƐƚƉƉƌŽĂĐŚ>K^ KǀĞƌĂůů/ŶƚĞƌƐĞĐƚŝŽŶĞůĂǇͬtŽƌƐƚƉƉƌŽĂĐŚĞůĂǇ zĞĂƌϮϬϮϬEŽƵŝůĚͲDĞĂƐƵƌĞƐŽĨĨĨĞĐƚŝǀĞŶĞƐƐ^ƵŵŵĂƌǇ /ŶƚĞƌƐĞĐƚŝŽŶ DWĞĂŬ,ŽƵƌ >K^ ĞůĂǇ;ƐͿ >K^ ĞůĂǇ;ƐͿ D/WĞĂŬ,ŽƵƌ >K^ ĞůĂǇ;ƐͿ >y/E'dKEsEhDK ǆŝƐƚŝŶŐzĞĂƌϮϬϭϴͲDĞĂƐƵƌĞƐŽĨĨĨĞĐƚŝǀĞŶĞƐƐ^ƵŵŵĂƌǇ /ŶƚĞƌƐĞĐƚŝŽŶ DWĞĂŬ,ŽƵƌ WDWĞĂŬ,ŽƵƌ WDWĞĂŬ,ŽƵƌ >K^ ĞůĂǇ;ƐͿ >K^ ĞůĂǇ;ƐͿ D/WĞĂŬ,ŽƵƌ >K^ ĞůĂǇ;ƐͿ KǀĞƌĂůů/ŶƚĞƌƐĞĐƚŝŽŶ>K^ͬtŽƌƐƚƉƉƌŽĂĐŚ>K^ KǀĞƌĂůů/ŶƚĞƌƐĞĐƚŝŽŶĞůĂǇͬtŽƌƐƚƉƉƌŽĂĐŚĞůĂǇ zĞĂƌϮϬϰϬEŽƵŝůĚͲDĞĂƐƵƌĞƐŽĨĨĨĞĐƚŝǀĞŶĞƐƐ^ƵŵŵĂƌǇ /ŶƚĞƌƐĞĐƚŝŽŶ DWĞĂŬ,ŽƵƌ WDWĞĂŬ,ŽƵƌ >K^ ĞůĂǇ;ƐͿ >K^ ĞůĂǇ;ƐͿ D/WĞĂŬ,ŽƵƌ >K^ ĞůĂǇ;ƐͿ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ/ͲϲϵϰtZĂŵƉƐ ͬ ϯϬ͘ϯ ͬ ϲϬ͘ϵ ͬ Ϯϲ͘Ϯ ͬ ϰϱ͘ϰ ͬ Ϯϴ͘ϳ ͬ ϱϯ͘ϭ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ/ͲϲϵϰZĂŵƉƐ ͬ Ϯϰ͘ϵ ͬ ϲϳ͘Ϯ ͬ Ϯϭ͘ϭ ͬ ϱϬ͘ϲ ͬ Ϯϭ͘Ϯ ͬ ϰϭ͘ϯ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘZĞĚ&ŽǆZŽĂĚ ͬ ϯϰ͘ϳ ͬ ϰϳ͘ϵ ͬ ϯϰ͘ϲ ͬ ϱϮ͘ϳ ͬ Ϯϴ͘ϱ ͬϰϮ͘ϰ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ>ĞǆŝŶŐƚŽŶ^ƚĂƚŝŽŶ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘdĂƌŐĞƚ^ŽƵƚŚ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘŶƚĞƌƉƌŝƐĞͬŝŐKdŝƌĞƐͬƌďǇΖƐ ͬ ϭ͘ϴ ͬ ϮϬ͘ϭ ͬ ϭ͘ϱ ͬ ϮϬ͘ϴ ͬ ϭ͘ϱ ͬ ϮϬ͘ϱ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ'ƌĞǇ&ŽǆZŽĂĚ ͬ ϭϳ͘Ϭ ͬ ϰϭ͘ϭ ͬ ϭϱ͘ϱ ͬ ϰϮ͘ϳ ͬ ϭϲ͘ϱ ͬ ϰϭ͘ϯ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ^ŚĂŶŶŽŶ^ƋƵĂƌĞ ͬ ϲ͘ϵ ͬ Ϯϴ͘ϯ ͬ ϲ͘ϴ ͬ ϯϮ͘ϭ ͬ ϴ͘Ϭ ͬ ϰϳ͘ϱ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘZ ͬ ϰϴ͘ϴ ͬ ϳϰ͘ϱ ͬ ϰϴ͘ϴ ͬ ϳϰ͘ϱ ͬ ϰϴ͘ϴ ͬ ϳϰ͘ϱ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ/ͲϲϵϰtZĂŵƉƐ ͬ Ϯϴ͘Ϯ ͬ ϰϲ͘Ϭ ͬ ϯϬ͘Ϯ ͬ ϱϴ͘ϴ ͬ Ϯϱ͘Ϭ ͬ ϰϱ͘ϰ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ/ͲϲϵϰZĂŵƉƐ ͬ ϮϬ͘ϵ ͬ ϰϭ͘ϵ ͬ Ϯϭ͘ϲ ͬ ϰϰ͘ϭ ͬ Ϯϭ͘ϯ ͬ ϰϱ͘ϭ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘZĞĚ&ŽǆZŽĂĚ ͬ Ϯϴ͘ϴ ͬ ϰϳ͘ϵ ͬ Ϯϲ͘ϵ ͬ ϰϭ͘ϰ ͬ Ϯϳ͘ϴ ͬϰϭ͘ϴ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ>ĞǆŝŶŐƚŽŶ^ƚĂƚŝŽŶ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘdĂƌŐĞƚ^ŽƵƚŚ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘŶƚĞƌƉƌŝƐĞͬŝŐKdŝƌĞƐͬƌďǇΖƐ ͬ Ϯ͘ϭ ͬ ϯϯ͘ϵ ͬ ϭ͘ϱ ͬ ϵ͘ϲ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ'ƌĞǇ&ŽǆZŽĂĚ ͬ ϭϲ͘ϲ ͬ ϰϭ͘Ϯ ͬ Ϯϭ͘Ϭ ͬ ϰϭ͘ϴ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ^ŚĂŶŶŽŶ^ƋƵĂƌĞ ͬ & ϴ͘ϱ ͬ ϱϮ͘ϰ ͬ ϰ͘ϱ ͬ ϭϱ͘ϲ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘZ ͬ ϰϮ͘ϴ ͬ ϱϲ͘Ϭ ͬ ϰϮ͘ϴ ͬ ϱϳ͘ϵ ͬ ϰϮ͘Ϯ ͬ ϲϯ͘ϰ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ/ͲϲϵϰtZĂŵƉƐ ͬ ϯϰ͘ϱ ͬ ϲϰ͘ϳ ͬ Ϯϭ͘Ϭ ͬ ϰϳ͘Ϯ ͬ Ϯϳ͘ϰ ͬ ϰϵ͘ϱ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ/ͲϲϵϰZĂŵƉƐ ͬ Ϯϲ͘ϳ ͬ Ϯϴ͘ϳ ͬ ϭϵ͘ϰ ͬ ϯϵ͘ϰ ͬ ϮϬ͘ϯ ͬ ϯϴ͘ϯ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘZĞĚ&ŽǆZŽĂĚ ͬ ϭϭ͘ϳ ͬ Ϯϴ͘ϴ ͬ Ϯϱ͘Ϯ ͬ ϯϲ͘ϯ ͬ Ϯϲ͘ϵ ͬϰϰ͘ϱ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ>ĞǆŝŶŐƚŽŶ^ƚĂƚŝŽŶ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘdĂƌŐĞƚ^ŽƵƚŚ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘŶƚĞƌƉƌŝƐĞͬŝŐKdŝƌĞƐͬƌďǇΖƐ ͬ Ϭ͘ϲ ͬ ϭϬ͘ϭ ͬ ϭ͘ϯ ͬ ϵ͘ϲ ͬ ϭ͘ϯ ͬ ϭϭ͘ϰ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ'ƌĞǇ&ŽǆZŽĂĚ ͬ ϲ͘ϴ ͬ Ϯϵ͘ϯ ͬ ϭϲ͘ϳ ͬ ϯϴ͘ϴ ͬ ϮϬ͘Ϭ ͬϰϯ͘ϰ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ^ŚĂŶŶŽŶ^ƋƵĂƌĞ ͬ Ϯ͘Ϭ ͬ ϲ͘Ϯ ͬ ϯ͘ϲ ͬ ϭϬ͘ϲ ͬ ϰ͘ϵ ͬ ϭϳ͘ϭ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘZ ͬ ϮϮ͘ϵ ͬ ϯϱ͘Ϭ ͬ Ϯϳ͘ϱ ͬ ϰϰ͘ϭ ͬ ϰϮ͘ϳ ͬ ϲϮ͘Ϯ KǀĞƌĂůů/ŶƚĞƌƐĞĐƚŝŽŶ>K^ͬtŽƌƐƚƉƉƌŽĂĐŚ>K^ KǀĞƌĂůů/ŶƚĞƌƐĞĐƚŝŽŶĞůĂǇͬtŽƌƐƚƉƉƌŽĂĐŚĞůĂǇ ͬ ϴ͘Ϯ ͬ ϯϬ͘ϭϭϭ͘ϱ ͬ ϯϰ͘Ϭ ͬ ϯ͘ϰ ͬ Ϯϴ͘ϴ ͬ zĞĂƌϮϬϰϬƵŝůĚWƌĞĨĞƌƌĞĚůƚĞƌŶĂƚŝǀĞͲDĞĂƐƵƌĞƐŽĨĨĨĞĐƚŝǀĞŶĞƐƐ^ƵŵŵĂƌǇ /ŶƚĞƌƐĞĐƚŝŽŶ DWĞĂŬ,ŽƵƌ D/WĞĂŬ,ŽƵƌ WDWĞĂŬ,ŽƵƌ >K^ ĞůĂǇ;ƐͿ >K^ ĞůĂǇ;ƐͿ >K^ ĞůĂǇ;ƐͿ ϭϱ͘ϲ ͬ ϰϬ͘ϲ KǀĞƌĂůů/ŶƚĞƌƐĞĐƚŝŽŶ>K^ͬtŽƌƐƚƉƉƌŽĂĐŚ>K^ KǀĞƌĂůů/ŶƚĞƌƐĞĐƚŝŽŶĞůĂǇͬtŽƌƐƚƉƉƌŽĂĐŚĞůĂǇ ϳ͘ϴ ͬ ϯϬ͘ϲ ͬ ϲ͘ϳ ͬ ϯϬ͘Ϭ ͬ ϴ͘ϯ ͬ ϯϮ͘ϱ zĞĂƌϮϬϰϬƵŝůĚůƚĞƌŶĂƚŝǀĞƐͲDĞĂƐƵƌĞƐŽĨĨĨĞĐƚŝǀĞŶĞƐƐ^ƵŵŵĂƌǇ /ŶƚĞƌƐĞĐƚŝŽŶ KǀĞƌĂůů/ŶƚĞƌƐĞĐƚŝŽŶ>K^ͬtŽƌƐƚƉƉƌŽĂĐŚ>K^ KǀĞƌĂůů/ŶƚĞƌƐĞĐƚŝŽŶĞůĂǇͬtŽƌƐƚƉƉƌŽĂĐŚĞůĂǇ >dϬ >dϭ >dϮ >K^ ĞůĂǇ;ƐͿ >K^ ĞůĂǇ;ƐͿ >K^ ĞůĂǇ;ƐͿ ͬ ϴ͘ϲ ͬ Ϯϵ͘Ϯ ͬ ϳ͘ϯ ͬ Ϯϵ͘ϲ ͬ ϳ͘ϱ ͬ Ϯϵ͘ϱ ϯ͗>ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ^ŚĂŶŶŽŶ^ƋƵĂƌĞĐŽŶƐŽůŝĚĂƚĞĚǁŝƚŚ>ĞǆŝŶŐƚŽŶΘ'ƌĞǇ&ŽǆZŽĂĚĨŽƌůƚĞƌŶĂƚŝǀĞϱ ϭ͗>ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ>ĞǆŝŶŐƚŽŶ^ƚĂƚŝŽŶĐŽŶƐŽůŝĚĂƚĞĚǁŝƚŚ>ĞǆŝŶŐƚŽŶΘdĂƌŐĞƚ^ŽƵƚŚĨŽƌůƚĞƌŶĂƚŝǀĞƐϬ͕ϭ͕Ϯ͕ϯ͕ϰ͕Θϱ Ϯ͗>ĞǆŝŶŐƚŽŶǀĞŶƵĞΘŶƚĞƌƉƌŝƐĞͬŝŐKdŝƌĞƐͬƌďǇΖƐĐŽŶƐŽůŝĚĂƚĞĚǁŝƚŚ>ĞǆŝŶŐƚŽŶΘdĂƌŐĞƚ^ŽƵƚŚĨŽƌůƚĞƌŶĂƚŝǀĞϱ ͬ zĞĂƌϮϬϰϬƵŝůĚůƚĞƌŶĂƚŝǀĞƐͲDĞĂƐƵƌĞƐŽĨĨĨĞĐƚŝǀĞŶĞƐƐ^ƵŵŵĂƌǇ /ŶƚĞƌƐĞĐƚŝŽŶ >dϯ >dϰ >dϱ >K^ ĞůĂǇ;ƐͿ >K^ ĞůĂǇ;ƐͿ >K^ ĞůĂǇ;ƐͿ ͬ ϮϬϰϬEŽƵŝůĚͲDWĞĂŬ,ŽƵƌ (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 ' ' % & & % & % $ % & % & 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 '$$$$$%$$$$$ $ 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 ''$''$%$$$$$ $ 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 &$$$$$$$$$$$ $ 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 $$$&$$$$$$$$ $ 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 '$$$$$$$$$$$ $ 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 &'%''$&$$%%% % 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 ' ) & $ $ $ $ & $ & % $ & 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 $$$(()&%$$&$ ' 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 :HVWERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO $ ,QWHUVHFWLRQ 7RWDO ,QWHUVHFWLRQ 7RWDO $$ 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO & 6RXWKERXQG$SSURDFK %$$ ,QWHUVHFWLRQ 7RWDO (DVWERXQG$SSURDFK $$& :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ Z ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK &&%% ,QWHUVHFWLRQ 02( 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK $ 6RXWKERXQG$SSURDFK %$$$ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ 'ƌĞǇ&ŽǆZŽĂĚ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ ŶƚĞƌƉƌŝƐĞͬƌďǇΖƐ ,QWHUVHFWLRQ ,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK $ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ >ĞǆŝŶŐƚŽŶ^ƚĂƚŝŽŶ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ dĂƌŐĞƚ^ŽƵƚŚ $ ,QWHUVHFWLRQ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ ƵďͬĂǀĂŶŶŝƐ %&) 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK %$$ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK & 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ ZĞĚ&ŽǆZŽĂĚ $%&% ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ/Ͳ ϲϵϰZĂŵƉƐ &%'$ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ/Ͳ ϲϵϰtZĂŵƉƐ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK ϮϬϰϬEŽƵŝůĚͲD/WĞĂŬ,ŽƵƌ (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 &&%''&%%%&&% & 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 )$$$$$&$$$$$ $ 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 &'$&&$%$$%$$ % 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 )$$$$$%$$$$$ $ 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 $$$)$)$$$%$$ & 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 )$)$$$%$$$$$ ) 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 ''&''&&'$'%% & 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 '&&$$$$%$'%$ % 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 $$$'%%&$$$&$ & 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ/Ͳ ϲϵϰtZĂŵƉƐ $&%& ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ/Ͳ ϲϵϰZĂŵƉƐ &$%% ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ ZĞĚ&ŽǆZŽĂĚ &'&& ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ >ĞǆŝŶŐƚŽŶ^ƚĂƚŝŽŶ )$$$ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ dĂƌŐĞƚ^ŽƵƚŚ $)$$ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ ŶƚĞƌƉƌŝƐĞͬƌďǇΖƐ ($$$ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ 'ƌĞǇ&ŽǆZŽĂĚ &&$$ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ ƵďͬĂǀĂŶŶŝƐ '$$$ &&%% ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ Z ϮϬϰϬEŽƵŝůĚͲWDWĞĂŬ,ŽƵƌ (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 ((('('''&((' ' 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 )$($$$&$$$$$ $ 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 ))(&&&%%%%%$ & 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 )$$$$$%%$$$$ $ 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 $ $ $ ) $ ) $ $ $ & $ $ & 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 )$)$$$&($$$$ ) 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 ) & % & & ( ' ) % ) & & ( 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 )))$$$$&&&%$ ' 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 $$$''&%$$$)( ' 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO (''' >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ Z ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ ƵďͬĂǀĂŶŶŝƐ ($$$ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ 'ƌĞǇ&ŽǆZŽĂĚ )&%% ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ ŶƚĞƌƉƌŝƐĞͬƌďǇΖƐ )$%$ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ dĂƌŐĞƚ^ŽƵƚŚ $)$$ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ >ĞǆŝŶŐƚŽŶ^ƚĂƚŝŽŶ )$($ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ ZĞĚ&ŽǆZŽĂĚ (((' ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ/Ͳ ϲϵϰZĂŵƉƐ )$&% ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ/Ͳ ϲϵϰtZĂŵƉƐ $&$) ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO ϮϬϰϬ>dϬͲWDWĞĂŬ,ŽƵƌ (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 ((('(''&%''& ' 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 )$&$$$'$$$$$ $ 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 ''&'(%'%$&%$ % 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 ($%$$$%$$$$$ $ 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 ) ) & ) ' % & $ $ ' $ $ $ 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 ('%''&''%(%% & 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 '(($$$$%$'%$ & 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 $$$(((&$$$'& & 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 $($' 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ/Ͳ ϲϵϰtZĂŵƉƐ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK ($%& ,QWHUVHFWLRQ 7RWDO 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ/Ͳ ϲϵϰZĂŵƉƐ '&'& ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO :HVWERXQG$SSURDFK >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ ZĞĚ&ŽǆZŽĂĚ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ''$$ &$$$ :HVWERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ dĂƌŐĞƚ^ŽƵƚŚ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ ƵďͬĂǀĂŶŶŝƐ ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ ŶƚĞƌƉƌŝƐĞͬƌďǇΖƐ '&%% ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ 'ƌĞǇ&ŽǆZŽĂĚ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK '$$$ :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ((&& ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘZ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK ϮϬϰϬ>dϭͲWDWĞĂŬ,ŽƵƌ (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 ) ) ) ' ( ( ' & % ' ' & ( 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 )$&$$$'$$$$$ $ 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 ''&'(&'$$&$$ % 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 )$$$$$%$$$$$ $ 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 ) ( & ) ( % & $ $ ' $ $ $ 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 ('%''&''%(%$ & 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 '''$$$$%$'%$ & 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 $$$'('&$$$'& & 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘZ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK '$$$ :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK )(&& ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ 'ƌĞǇ&ŽǆZŽĂĚ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ ƵďͬĂǀĂŶŶŝƐ ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ ŶƚĞƌƉƌŝƐĞͬƌďǇΖƐ ''%$ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ dĂƌŐĞƚ^ŽƵƚŚ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ''$$ &$$$ :HVWERXQG$SSURDFK >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ ZĞĚ&ŽǆZŽĂĚ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 02((DVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO :HVWERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ/Ͳ ϲϵϰZĂŵƉƐ '&'& ,QWHUVHFWLRQ $'$& 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ/Ͳ ϲϵϰtZĂŵƉƐ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK '$%% ϮϬϰϬ>dϮͲWDWĞĂŬ,ŽƵƌ (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 )))'(''&%''& ( 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 )$'$$$'$$$$$ $ 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 ''&'(&'%%&%$ % 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 )$$$$$%$$$$$ $ 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 ) ) % ) ( % & $ $ & $ $ $ 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 ' ' % ' ' & ( & $ ' % % & 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 '('$$$$%$'%$ & 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 $$$'('&$$$'& & 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘZ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK ($$$ :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK )(&' ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ 'ƌĞǇ&ŽǆZŽĂĚ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ ƵďͬĂǀĂŶŶŝƐ ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ ŶƚĞƌƉƌŝƐĞͬƌďǇΖƐ ''%% ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ dĂƌŐĞƚ^ŽƵƚŚ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK &'$$ &$$$ :HVWERXQG$SSURDFK >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ ZĞĚ&ŽǆZŽĂĚ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 02((DVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO :HVWERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ/Ͳ ϲϵϰZĂŵƉƐ ''&& ,QWHUVHFWLRQ $'$' 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ/Ͳ ϲϵϰtZĂŵƉƐ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK '$%& ϮϬϰϬ>dϯͲWDWĞĂŬ,ŽƵƌ (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 (''('''&%''& ' 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 )$'$$$'$$$$$ $ 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 ''&'(&&%$&%$ % 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 )$%$$$%$$$$$ $ 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 ) ( & ) ) % ' $ $ & $ $ $ 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 ('%''''&$'%% & 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 '''$$$$%$'%$ & 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 $$$'''&$$$'& & 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘZ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK )$$$ :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ('&' ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ 'ƌĞǇ&ŽǆZŽĂĚ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ ƵďͬĂǀĂŶŶŝƐ ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ ŶƚĞƌƉƌŝƐĞͬƌďǇΖƐ '&%% ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ dĂƌŐĞƚ^ŽƵƚŚ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ''$$ '$$$ :HVWERXQG$SSURDFK >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ ZĞĚ&ŽǆZŽĂĚ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 02((DVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO :HVWERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ/Ͳ ϲϵϰZĂŵƉƐ ''&& ,QWHUVHFWLRQ $'$' 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ/Ͳ ϲϵϰtZĂŵƉƐ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK '$%& ϮϬϰϬ>dϰͲWDWĞĂŬ,ŽƵƌ (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 ( ' ' ( ( ' ' & % ' ' & ' 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 $$&$$$$$$$$$ $ 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 ''&'(&'%%&%$ & 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 $$$$$$$$$$$$ $ 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 ) ( % ) ) % & $ $ & $ $ $ 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 '(%''&'&$'%% & 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 '''$$$$%$'%$ & 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 $$$(((&$$$'% & 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘZ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK &$$$ :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ((&& ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ 'ƌĞǇ&ŽǆZŽĂĚ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ ƵďͬĂǀĂŶŶŝƐ ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ ŶƚĞƌƉƌŝƐĞͬƌďǇΖƐ ''%% ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ dĂƌŐĞƚ^ŽƵƚŚ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ''$$ $$$$ :HVWERXQG$SSURDFK >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ ZĞĚ&ŽǆZŽĂĚ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 02((DVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO :HVWERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ/Ͳ ϲϵϰZĂŵƉƐ '&&& ,QWHUVHFWLRQ $($' 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ/Ͳ ϲϵϰtZĂŵƉƐ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK '$%& ϮϬϰϬ>dϱͲWDWĞĂŬ,ŽƵƌ (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 )''((''&%'&& ' 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 ''&'(&&%%&$$ % 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 ) ( % ) ( % & $ $ & $ $ $ 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 ''%''''&$'%% & 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 '''$$$$%$'%$ & 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 $$$'''&$$$'% & 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘZ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ('&& 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ 'ƌĞǇ&ŽǆZŽĂĚ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK '&%% ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ dĂƌŐĞƚ^ŽƵƚŚ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK &'$$ >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ ZĞĚ&ŽǆZŽĂĚ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 02((DVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO :HVWERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ/Ͳ ϲϵϰZĂŵƉƐ ''&& ,QWHUVHFWLRQ $'$& 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ/Ͳ ϲϵϰtZĂŵƉƐ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK '$%& ϮϬϰϬWZ&ZZ>dͲDWĞĂŬ,ŽƵƌ (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 ' & % ' & & % % $ & % % & 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 $$$$$$$$$$$$ $ 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 &'%''%%$$$$$ $ 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 $$%$$$$$$$$$ $ 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 ($$($$%$$$$$ $ 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 & & $ ' % $ ' % $ ' $ $ % 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 &'&$$$$&$'&$ & 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 $$$''((%$$&$ & 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 $$$$$$$$$$$$ $ 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 $(%& ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ/Ͳ ϲϵϰtZĂŵƉƐ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ/Ͳ ϲϵϰZĂŵƉƐ &%%$ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK &$&& :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ ZĞĚ&ŽǆZŽĂĚ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK %'$$ 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ dĂƌŐĞƚ^ŽƵƚŚ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ ŶƚĞƌƉƌŝƐĞͬƌďǇΖƐ &&$$ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK %$$$ :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ 'ƌĞǇ&ŽǆZŽĂĚ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ ^ŚĂŶŶŽŶ^ƋƵĂƌĞ &&%% ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK $$$$ :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ Z ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO ZĞĚ&ŽǆZŽĂĚ ΘdĂƌŐĞƚͬ'ĂƐ^ƚĂƚŝŽŶ $$$$ ϮϬϰϬWZ&ZZ>dͲD/WĞĂŬ,ŽƵƌ (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 ''&('&&%%&%% & 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 $$%$$$$$$$$$ $ 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 ''&'(%&$$&%$ % 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 $$$$$$$$$$$$ $ 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 ) $ & ) $ % ' $ $ & $ $ % 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 ' ' % ' & % ' & $ ' % $ & 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 '('$$$$%$'%$ % 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 $$$()%&$$$&$ & 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 $$$$$$&$$$$$ $ 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ/Ͳ ϲϵϰtZĂŵƉƐ '$%% ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK $'$& :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ/Ͳ ϲϵϰZĂŵƉƐ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ ZĞĚ&ŽǆZŽĂĚ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK '&&& :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ dĂƌŐĞƚ^ŽƵƚŚ $$$$ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK ''$$ :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ ŶƚĞƌƉƌŝƐĞͬƌďǇΖƐ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ 'ƌĞǇ&ŽǆZŽĂĚ %$$$ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK '&%% :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ ^ŚĂŶŶŽŶ^ƋƵĂƌĞ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK ''%% :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ Z ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK ZĞĚ&ŽǆZŽĂĚ ΘdĂƌŐĞƚͬ'ĂƐ^ƚĂƚŝŽŶ $$&$ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO ϮϬϰϬWZ&ZZ>dͲWDWĞĂŬ,ŽƵƌ (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 )''('''&%''& ' 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 $$&$$$$$$$$$ $ 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 ''&''%'%%&%$ & 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 $$%$$$$$$$$$ $ 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 ) ) & ) ( % ' $ $ & $ $ $ 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 ''%'&&'&$'%$ & 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 ''&$$$$%$'%$ & 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 $ $ $ ' ( ' & $ $ $ ' % & 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 (%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%5 0RYHPHQW'HOD\VHFYHK 7RWDO'HOD\KU 0RYHPHQW/26 $$$$$$&$$$$& $ 0RYHPHQW9ROXPH 0RYHPHQWWK4XHXHIW 6WRUDJH%D\'LVWDQFHIW $SSURDFK'HOD\VHFYHK $SSURDFK/26 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO ZĞĚ&ŽǆZŽĂĚ ΘdĂƌŐĞƚͬ'ĂƐ^ƚĂƚŝŽŶ $'$& ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK $$&& :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ/Ͳ ϲϵϰtZĂŵƉƐ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ/Ͳ ϲϵϰZĂŵƉƐ '&&& ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK '$%& :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ ZĞĚ&ŽǆZŽĂĚ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK ''$$ 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ dĂƌŐĞƚ^ŽƵƚŚ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ ŶƚĞƌƉƌŝƐĞͬƌďǇΖƐ '&%% ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK %$$$ :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ 'ƌĞǇ&ŽǆZŽĂĚ ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ ^ŚĂŶŶŽŶ^ƋƵĂƌĞ ('&& ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK &$$$ :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK ,QWHUVHFWLRQ 7RWDO >ĞǆŝŶŐƚŽŶǀĞŶƵĞΘ Z ,QWHUVHFWLRQ 02( (DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 7UDIILF6WXG\ /H[LQJWRQ$YHQXH5HFRQVWUXFWLRQ $OOLDQW1R% $SSHQGL[% 'HWDLOHG6LJQDO:DUUDQW$QDO\VLV 7$%/(%6,*1$/:$55$17$1$/<6,6:$55$17/2&$7,21/H[LQJWRQ$YHQXH 5HG)R[5RDG&RXQW'DWH180%(52) 63(('6RXUFH$3352$&+ '(6&5,37,21 /$1(6 03+)DFWRU 3RSXODWLRQ"126SHHGRYHUPSK"1292/80(5(4$712120$-25675((70,125675((7:$55$170(7 :$55$170(7$3352$&+ :$55$170(7 $3352$&+ :$55$170(7$3352$&+ :$55$170(7$3352$&+ 6$0(+285621 6$0(+28562192/80( &RQG$ &RQG% $ %&RPE ([LVWLQJ6LJQDO 92/80( &RQG$ &RQG% $ %&RPE ([LVWLQJ6LJQDO &RQG$ &RQG% $ %&RPE ([LVWLQJ6LJQDO 0$-25$1'0,125675((76 0$-25$1'0,125675((76727$/RI$ RI% RI$ RI% RI$ RI% RI$ RI% RI$ RI% RI$ RI%$ %&RPE ([LVWLQJ6LJQDO $ %&RPE ([LVWLQJ6LJQDO+285 &RQG$ &RQG%RI$ RI% RI$ RI%&RQG$ &RQG%RI$RU%RI$ RI% RI$ RI%$0 $0 $0 $0 $0 $0 ; $0 ;;;;;;;; $0 ;;;;;;; ;;; ; ;;; $0 ;;;;;;; ;;; ; ;;; $0 ;;;;;;;;;;;;;;;; $0 ;;;;;;;;;;;;;;; 1RRQ ;;;;;; ;;;;; ; ;;; ;;;;;30 ;;;;;;;;;;;; ; ;;;;;;;;;30 ;;;;;; ;;;;; ; ;;; ;;;;;30 ;;;;;; ;;;;; ; ;;; ;;;;;30 ;;;;;; ;;;;; ;;;;; ;;;;;30 ;;;;;; ;;;;;;;;;;;;;;;;;30 ;;;;;;;;;;;;;;;;;;;;;;;;30 ;;;;;; ;;;;; ; ; ;;;;;30 ;;;;;; ; ;;; ; ; ;;; 30 ;;;;;; ; ; ;;;; 30 ; ; ; 30 ; 0LGQLJKW 6800$5<2)5(68/76:DUUDQW&RQG$ZDV QRWPHW KRXUVVDWLVILHGUHTXLUHPHQWV:DUUDQW&RQG%ZDV PHW KRXUVVDWLVILHGUHTXLUHPHQWV:DUUDQW&RPELQH$ %ZDV PHW KRXUVVDWLVILHGUHTXLUHPHQWV([LVWLQJ6LJQDO:DUUDQW$ PHW KRXUVVDWLVILHGUHTXLUHPHQWV([LVWLQJ6LJQDO:DUUDQW% PHW KRXUVVDWLVILHGUHTXLUHPHQWV:DUUDQW PHW KRXUVVDWLVILHGUHTXLUHPHQWV:DUUDQW PHW KRXUVVDWLVILHGUHTXLUHPHQWV/H[LQJWRQ$YHQXH1%5HG)R[5RDG:%5HG)R[5RDG(%0DMRU$SSURDFK0DMRU$SSURDFK0LQRU$SSURDFK0LQRU$SSURDFK,ISRSXODWLRQLVOHVVWKDQRUWKHPDMRUVWUHHWVSHHGLVRYHUPSKVHYHQW\SHUFHQWIDFWRUFDQEHDSSOLHG$SSO\VHYHQW\SHUFHQWIDFWRU"/H[LQJWRQ$YHQXH6%:DUUDQW$QDO\VLVB5HG)R[5RDG[OV:DUUDQW$QDO\VLVB5HG)R[5RDG[OVVWB0DLQ7DE 6RXUFH0LQQHVRWD0DQXDORQ8QLIRUP7UDIILF&RQWURO'HYLFHV :DUUDQW$QDO\VLVB5HG)R[5RDG[OVVWB+U&KDUW 0LQRU6WUHHW+LJK9ROXPH$SSURDFK93+0DMRU6WUHHW7RWDORI%RWK$SSURDFKHV93+:$55$171270(7:$55$170(7 25025(/$1(6 25025(/$1(6/H[LQJWRQ$YHQXH 5HG)R[5RDG6,*1$/:$55$17$1$/<6,6([LVWLQJ:HHNGD\9ROXPHV7$%/(:$55$17)RXU+RXU:DUUDQW:DUUDQW0HWIRU+RXUV 127(YSKDSSOLHVDVWKHORZHUWKUHVKROGYROXPHIRUDPLQRUVWUHHWDSSURDFKZLWKWZRRUPRUHODQHV 7KHILUVWQXPEHUUHIHUVWRWKHQXPEHURIODQHVRIDSSURDFKRQWKHPDMRUVWUHHWDQGWKHVHFRQGQXPEHUUHIHUVWRWKHQXPEHURIODQHVRIDSSURDFKRQWKHPLQRUVWUHHW6RXUFH0LQQHVRWD0DQXDORQ8QLIRUP7UDIILF&RQWURO'HYLFHV 6RXUFH0LQQHVRWD0DQXDORQ8QLIRUP7UDIILF&RQWURO'HYLFHV :DUUDQW$QDO\VLVB5HG)R[5RDG[OVVWB3N+U&KDUW 0LQRU6WUHHW+LJK9ROXPH$SSURDFK93+0DMRU6WUHHW7RWDORI%RWK$SSURDFKHV93+:$55$171270(7:$55$170(7 25025(/$1(6 25025(/$1(67$%/(:$55$173HDN+RXU:DUUDQW:DUUDQW0HWIRU+RXUV 127(YSKDSSOLHVDVWKHORZHUWKUHVKROGYROXPHIRUDPLQRUVWUHHWDSSURDFKZLWKWZRODQHVRUPRUH 7KHILUVWQXPEHUUHIHUVWRWKHQXPEHURIODQHVRIDSSURDFKRQWKHPDMRUVWUHHWDQGWKHVHFRQGQXPEHUUHIHUVWRWKHQXPEHURIODQHVRIDSSURDFKRQWKHPLQRUVWUHHW6RXUFH0LQQHVRWD0DQXDORQ8QLIRUP7UDIILF&RQWURO'HYLFHV /H[LQJWRQ$YHQXH 5HG)R[5RDG6,*1$/:$55$17$1$/<6,6([LVWLQJ:HHNGD\9ROXPHV 7$%/(%6,*1$/:$55$17$1$/<6,6:$55$17/2&$7,21/H[LQJWRQ$YHQXH *UH\)R[5RDG&RXQW'DWH180%(52) 63(('6RXUFH$3352$&+ '(6&5,37,21 /$1(6 03+)DFWRU 3RSXODWLRQ"126SHHGRYHUPSK"1292/80(5(4$712120$-25675((70,125675((7:$55$170(7 :$55$170(7$3352$&+ :$55$170(7 $3352$&+ :$55$170(7$3352$&+ :$55$170(7$3352$&+ 6$0(+285621 6$0(+28562192/80( &RQG$ &RQG% $ %&RPE ([LVWLQJ6LJQDO 92/80( &RQG$ &RQG% $ %&RPE ([LVWLQJ6LJQDO &RQG$ &RQG% $ %&RPE ([LVWLQJ6LJQDO 0$-25$1'0,125675((76 0$-25$1'0,125675((76727$/RI$ RI% RI$ RI% RI$ RI% RI$ RI% RI$ RI% RI$ RI%$ %&RPE ([LVWLQJ6LJQDO $ %&RPE ([LVWLQJ6LJQDO+285 &RQG$ &RQG%RI$ RI% RI$ RI%&RQG$ &RQG%RI$RU%RI$ RI% RI$ RI%$0 $0 $0 $0 $0 $0 $0 ; ; ; ; ; ; ; $0 ;;;;;;;;;;;; $0 ;;;;;;;;;;;;; $0 ;;;;;;;;;;;;;; $0 ;;;;;; ; ; ;;;;; ;;;;;1RRQ ;;;;;; ; ; ;;;;;;;;;;;;;30 ;;;;;; ;;;;;;;;;;;;;30 ;;;;;; ;;;;;;;;;;;;;30 ;;;;;; ;;;;;;;;;;;;30 ;;;;;; ;;;;;;;;;;;;;30 ;;;;;; ;;;;;;;;;;;;30 ;;;;;; ;;;;;;;;;;;;30 ;;;;;; ;;;;;;;;;;;;;30 ;;;;;; ; ; ;;; ; ;;; 30 ;;;;;;;;;;;;; 30 ; ; ;;30 ;;0LGQLJKW 6800$5<2)5(68/76:DUUDQW&RQG$ZDV PHW KRXUVVDWLVILHGUHTXLUHPHQWV:DUUDQW&RQG%ZDV PHW KRXUVVDWLVILHGUHTXLUHPHQWV:DUUDQW&RPELQH$ %ZDV PHW KRXUVVDWLVILHGUHTXLUHPHQWV([LVWLQJ6LJQDO:DUUDQW$ PHW KRXUVVDWLVILHGUHTXLUHPHQWV([LVWLQJ6LJQDO:DUUDQW% PHW KRXUVVDWLVILHGUHTXLUHPHQWV:DUUDQW PHW KRXUVVDWLVILHGUHTXLUHPHQWV:DUUDQW PHW KRXUVVDWLVILHGUHTXLUHPHQWV/H[LQJWRQ$YHQXH1%*UH\)R[5RDG:%*UH\)R[5RDG(%0DMRU$SSURDFK0DMRU$SSURDFK0LQRU$SSURDFK0LQRU$SSURDFK,ISRSXODWLRQLVOHVVWKDQRUWKHPDMRUVWUHHWVSHHGLVRYHUPSKVHYHQW\SHUFHQWIDFWRUFDQEHDSSOLHG$SSO\VHYHQW\SHUFHQWIDFWRU"/H[LQJWRQ$YHQXH6%:DUUDQW$QDO\VLVB*UH\)R[5RDG[OV:DUUDQW$QDO\VLVB*UH\)R[5RDG[OVVWB0DLQ7DE 6RXUFH0LQQHVRWD0DQXDORQ8QLIRUP7UDIILF&RQWURO'HYLFHV :DUUDQW$QDO\VLVB*UH\)R[5RDG[OVVWB+U&KDUW 0LQRU6WUHHW+LJK9ROXPH$SSURDFK93+0DMRU6WUHHW7RWDORI%RWK$SSURDFKHV93+:$55$171270(7:$55$170(7 25025(/$1(6 25025(/$1(6/H[LQJWRQ$YHQXH *UH\)R[5RDG6,*1$/:$55$17$1$/<6,6([LVWLQJ:HHNGD\9ROXPHV7$%/(:$55$17)RXU+RXU:DUUDQW:DUUDQW0HWIRU+RXUV 127(YSKDSSOLHVDVWKHORZHUWKUHVKROGYROXPHIRUDPLQRUVWUHHWDSSURDFKZLWKWZRRUPRUHODQHV 7KHILUVWQXPEHUUHIHUVWRWKHQXPEHURIODQHVRIDSSURDFKRQWKHPDMRUVWUHHWDQGWKHVHFRQGQXPEHUUHIHUVWRWKHQXPEHURIODQHVRIDSSURDFKRQWKHPLQRUVWUHHW6RXUFH0LQQHVRWD0DQXDORQ8QLIRUP7UDIILF&RQWURO'HYLFHV 6RXUFH0LQQHVRWD0DQXDORQ8QLIRUP7UDIILF&RQWURO'HYLFHV :DUUDQW$QDO\VLVB*UH\)R[5RDG[OVVWB3N+U&KDUW 0LQRU6WUHHW+LJK9ROXPH$SSURDFK93+0DMRU6WUHHW7RWDORI%RWK$SSURDFKHV93+:$55$171270(7:$55$170(7 25025(/$1(6 25025(/$1(67$%/(:$55$173HDN+RXU:DUUDQW:DUUDQW0HWIRU+RXUV 127(YSKDSSOLHVDVWKHORZHUWKUHVKROGYROXPHIRUDPLQRUVWUHHWDSSURDFKZLWKWZRODQHVRUPRUH 7KHILUVWQXPEHUUHIHUVWRWKHQXPEHURIODQHVRIDSSURDFKRQWKHPDMRUVWUHHWDQGWKHVHFRQGQXPEHUUHIHUVWRWKHQXPEHURIODQHVRIDSSURDFKRQWKHPLQRUVWUHHW6RXUFH0LQQHVRWD0DQXDORQ8QLIRUP7UDIILF&RQWURO'HYLFHV /H[LQJWRQ$YHQXH *UH\)R[5RDG6,*1$/:$55$17$1$/<6,6([LVWLQJ:HHNGD\9ROXPHV 7$%/(%6,*1$/:$55$17$1$/<6,6:$55$17/2&$7,21/H[LQJWRQ$YHQXH 7DUJHW6RXWK&RXQW'DWH180%(52) 63(('6RXUFH$3352$&+ '(6&5,37,21 /$1(6 03+)DFWRU 3RSXODWLRQ"126SHHGRYHUPSK"1292/80(5(4$712120$-25675((70,125675((7:$55$170(7 :$55$170(7$3352$&+ :$55$170(7 $3352$&+ :$55$170(7$3352$&+ :$55$170(7$3352$&+ 6$0(+285621 6$0(+28562192/80( &RQG$ &RQG% $ %&RPE ([LVWLQJ6LJQDO 92/80( &RQG$ &RQG% $ %&RPE ([LVWLQJ6LJQDO &RQG$ &RQG% $ %&RPE ([LVWLQJ6LJQDO 0$-25$1'0,125675((76 0$-25$1'0,125675((76727$/RI$ RI% RI$ RI% RI$ RI% RI$ RI% RI$ RI% RI$ RI%$ %&RPE ([LVWLQJ6LJQDO $ %&RPE ([LVWLQJ6LJQDO+285 &RQG$ &RQG%RI$ RI% RI$ RI%&RQG$ &RQG%RI$RU%RI$ RI% RI$ RI%$0 $0 $0 $0 $0 $0 $0 ; ; ; ; $0 ;;;;;; $0 ;;;;;;$0 ;;;;;;$0 ;;;;;;1RRQ ;;;;;;30 ;;;;;; ; ;;;; ;;; 30 ;;;;;; ; ;;; 30 ;;;;;; ; ;;; 30 ;;;;;; ;;30 ;;;;;;30 ;;;;;; ;;30 ;;;;;; ; ;;; 30 ;;;;;; ; ;;;; ;;; 30 ;;;;;; ; ;;;; ;;; 30 ; ; ; ;;30 0LGQLJKW 6800$5<2)5(68/76:DUUDQW&RQG$ZDV QRWPHW KRXUVVDWLVILHGUHTXLUHPHQWV:DUUDQW&RQG%ZDV QRWPHW KRXUVVDWLVILHGUHTXLUHPHQWV:DUUDQW&RPELQH$ %ZDV QRWPHW KRXUVVDWLVILHGUHTXLUHPHQWV([LVWLQJ6LJQDO:DUUDQW$ QRWPHW KRXUVVDWLVILHGUHTXLUHPHQWV([LVWLQJ6LJQDO:DUUDQW% PHW KRXUVVDWLVILHGUHTXLUHPHQWV:DUUDQW QRWPHW KRXUVVDWLVILHGUHTXLUHPHQWV:DUUDQW PHW KRXUVVDWLVILHGUHTXLUHPHQWV/H[LQJWRQ$YHQXH1%7DUJHW6RXWK:%0DMRU$SSURDFK0DMRU$SSURDFK0LQRU$SSURDFK0LQRU$SSURDFK,ISRSXODWLRQLVOHVVWKDQRUWKHPDMRUVWUHHWVSHHGLVRYHUPSKVHYHQW\SHUFHQWIDFWRUFDQEHDSSOLHG$SSO\VHYHQW\SHUFHQWIDFWRU"/H[LQJWRQ$YHQXH6%:DUUDQW$QDO\VLVB7DUJHW6RXWK[OV:DUUDQW$QDO\VLVB7DUJHW6RXWK[OVVWB0DLQ7DE 6RXUFH0LQQHVRWD0DQXDORQ8QLIRUP7UDIILF&RQWURO'HYLFHV :DUUDQW$QDO\VLVB7DUJHW6RXWK[OVVWB+U&KDUW 0LQRU6WUHHW+LJK9ROXPH$SSURDFK93+0DMRU6WUHHW7RWDORI%RWK$SSURDFKHV93+:$55$171270(7:$55$170(7 25025(/$1(6 25025(/$1(6/H[LQJWRQ$YHQXH 7DUJHW6RXWK6,*1$/:$55$17$1$/<6,6([LVWLQJ:HHNGD\9ROXPHV7$%/(:$55$17)RXU+RXU:DUUDQW:DUUDQW0HWIRU+RXUV 127(YSKDSSOLHVDVWKHORZHUWKUHVKROGYROXPHIRUDPLQRUVWUHHWDSSURDFKZLWKWZRRUPRUHODQHV 7KHILUVWQXPEHUUHIHUVWRWKHQXPEHURIODQHVRIDSSURDFKRQWKHPDMRUVWUHHWDQGWKHVHFRQGQXPEHUUHIHUVWRWKHQXPEHURIODQHVRIDSSURDFKRQWKHPLQRUVWUHHW6RXUFH0LQQHVRWD0DQXDORQ8QLIRUP7UDIILF&RQWURO'HYLFHV 6RXUFH0LQQHVRWD0DQXDORQ8QLIRUP7UDIILF&RQWURO'HYLFHV :DUUDQW$QDO\VLVB7DUJHW6RXWK[OVVWB3N+U&KDUW 0LQRU6WUHHW+LJK9ROXPH$SSURDFK93+0DMRU6WUHHW7RWDORI%RWK$SSURDFKHV93+:$55$171270(7:$55$170(7 25025(/$1(6 25025(/$1(67$%/(:$55$173HDN+RXU:DUUDQW:DUUDQW0HWIRU+RXU 127(YSKDSSOLHVDVWKHORZHUWKUHVKROGYROXPHIRUDPLQRUVWUHHWDSSURDFKZLWKWZRODQHVRUPRUH 7KHILUVWQXPEHUUHIHUVWRWKHQXPEHURIODQHVRIDSSURDFKRQWKHPDMRUVWUHHWDQGWKHVHFRQGQXPEHUUHIHUVWRWKHQXPEHURIODQHVRIDSSURDFKRQWKHPLQRUVWUHHW6RXUFH0LQQHVRWD0DQXDORQ8QLIRUP7UDIILF&RQWURO'HYLFHV /H[LQJWRQ$YHQXH 7DUJHW6RXWK6,*1$/:$55$17$1$/<6,6([LVWLQJ:HHNGD\9ROXPHV 7UDIILF6WXG\ /H[LQJWRQ$YHQXH5HFRQVWUXFWLRQ $OOLDQW1R& $SSHQGL[& 3UHIHUUHG$OWHUQDWLYH&RQFHSW/D\RXW COUNTY ROAD ECANADIAN PACIFIC RAILROADISLAND LAKE AVE1103GOODWILL1195ESTREET FLATS3585WALGREENS1160AMERICANRED CROSSCARIBOU COFFEEGEORGES SHOESSUBWAYTMOBILEALLSTATECHINA EXPRESSGREAT CLIPSUPSH&R BLOCKNAILS 3000TOBACCONUTMEG BREWHOUSECLEAN N PRESSDAVANNIS3717CUB FOODS36733720AMBASSADORBAPTISTCHURCH10901084107610723592SUPERAMERICA1080ODDSANDENDSAGAIN3600STEPHENS ARTCENTENNIAL JEWLERSEDWARD JONESPIZZA HUTPIPES CIGARSTOP SHELF ATHLETICSGREY FOX RD13' THRU13' THRU13' LEFT (170')11' THRU13' THRU6' BLVD6' BLVD10' TRAILMODIFY MEDIAN TO OFFSETOPPOSING LEFT TURNS1:5 TAPER (55')10' LEFT 13' THRU/RIGHT 13' THRU 1:10 TAPER (110')1:10 TAPER (110')16' ALIGNMENT OFFSET WITH 3600' AND 1500' RADIUS REVERSE CURVESWITH A 70' LONG TANGENT BETWEEN CURVES(40 MPH DESIGN, NORMAL CROWN)13' THRU13' THRU13' THRU13' THRUVARIABLE MEDIAN8' WALK6' BLVD6' BLVD10' TRAIL40:1 ALIGNMENT TAPERS TO REDUCE MEDIAN FROM 16' TO 4'(40 MPH DESIGN, NORMAL CROWN)STORMWATER-- --POND LOCATION16' ALIGNMENT OFFSET WITH 22000' RADIUS CURVE FROM TAPER(40 MPH DESIGN, NORMAL CROWN)LEXINGTON AVENUECOUNTY ROAD ETOGREY FOX RDLEGENDROADWAY (CONCRETE)ROADWAY (BITUMINOUS)CURB & MEDIANCONCRETE WALKBITUMINOUS TRAILDRIVEWAYPARCEL BOUNDARYINPLACE RIGHT OF WAYTRAFFIC FLOW ARROWS GREY FOX RDRED FOX RDTARGET RD3737PACE INDUSTRIES3751ARBYS3757BIG OTIRES3761ENTERPRISE3775 - 3785JIMMY JOHNSBALANCE FOR LIFEBINDERY PLUSPAPA MURPHYSJIM LAABS PIANOSOLIVE ME CHIRO3833NOODLES AND COFROZEN YOGURTFANTASTIC SAMSROYAL NAILSPAPA JOHNSAT&TGNCPOTBELLYSTARBUCKS3836TCFBANK3780RAISINGCANES3800TARGET3760YMCA3720AMBASSADORBAPTISTCHURCHGREY FOX RD10' LEFT 13' THRU/RIGHT 13' THRU 13' THRU13' THRU13' LEFT (175')11' THRU11' THRU13' RIGHT (225')1:10 TAPER (110')1:10 TAPER (110')1:10 TAPER (110')1:10 TAPER (110')1:10 TAPER (110')10' TRAIL16' ALIGNMENT OFFSET WITH 1:40 TAPER(40 MPH DESIGN, NORMAL CROWN)13' THRU13' THRU13' THRU13' THRU1:10 TAPER (110')1:10 TAPER (110')VARIABLE (5' - 20') MEDIANLEXINGTON AVENUEGREY FOX RDTORED FOX RDLEGENDPRIVATE CONSTRUCTIONPOTENTIAL CONNECTIONSROADWAY (CONCRETE)ROADWAY (BITUMINOUS)CURB & MEDIANCONCRETE WALKBITUMINOUS TRAILDRIVEWAYPARCEL BOUNDARYINPLACE RIGHT OF WAYTRAFFIC FLOW ARROWS RED FOX RDI-694 SBI-694 NB3833NOODLES AND COFROZEN YOGURTFANTASTIC SAMSROYAL NAILSPAPA JOHNSAT&TGNCPOTBELLYSTARBUCKS3855PERKINS1125QUALITY INN3854EXXON CIRCLE K3836TCFBANK1051WENDYS11' LEFT (330')11' THRU11' THRU13' LEFT (275')13' THRU13' THRU13' THRU13' THRU16' ALIGNMENT OFFSET WITH 1500' RADIUS REVERSE CURVESWITH A 160' TANGENT BETWEEN CURVES(40 MPH DESIGN, NORMAL CROWN)13' RIGHT (225')1:5 TAPER (110')1:5 TAPER (55')6' BLVD10' TRAIL1:5 TAPER (55')16' ALIGNMENT OFFSET WITH 1:40 TAPER(40 MPH DESIGN, NORMAL CROWN)13' THRU13' THRU1:10 TAPER (110')VARIABLE (5' - 20') MEDIAN10' MEDIANLEXINGTON AVENUERED FOX RDTOI-694LEGENDROADWAY (CONCRETE)ROADWAY (BITUMINOUS)CURB & MEDIANCONCRETE WALKBITUMINOUS TRAILDRIVEWAYPARCEL BOUNDARYINPLACE RIGHT OF WAYTRAFFIC FLOW ARROWS ƉƉĞŶĚŝǆ >ĞǆŝŶŐƚŽŶ^ƚĂƚŝŽŶWŚĂƐĞϯŽŶĐĞƉƚWůĂŶ &ĞďƌƵĂƌǇϮϱ͕ϮϬϮϭ 12" CIP W(P)12" CIP W(P)LEXINGTON AVENUEEXISTINGBUILDING1 S3PROPOSED BUILDINGFFE = 934.00~43,000 SF282831186466666627517 ƉƉĞŶĚŝǆ& ŶŐŝŶĞĞƌ͛ƐƐƚŝŵĂƚĞĨŽƌZĂŵƐĞǇŽƵŶƚǇ>ĞǆŝŶŐƚŽŶ ǀĞŶƵĞWƌŽũĞĐƚ 52$':$<48$17,7<52$':$<&267672506(:(548$17,7<672506(:(5&26752$':$<48$17,7<52$':$<&267672506(:(548$17,7<672506(:(5&26752$':$<48$17,7<52$':$<&26752$':$<48$17,7<52$':$<&26748$17,7< &267 48$17,7< &267 $6%8,/7 /803680 02%,/,=$7,21 /803680 ),(/'2)),&(7<3('02',),(' ($&+ &/($5,1*$&5( *58%%,1* $&5( &/($5,1*75(( *58%%,1* 75(( 3$9(0(170$5.,1*5(029$/ /,1)7 3$9(0(170$5.,1*5(029$/ 64)7 5(029(3,3($3521 ($&+ 5(029(0$1+2/( ($&+ 5(029(*$7(9$/9( %2; ($&+ 5(029(+<'5$17 ($&+ 5(029('5$,1$*(6758&785( ($&+ 5(029(0$5.(5 ($&+ 5(029(6,*17<3(& ($&+ 5(029(6,*17<3(' ($&+ 5(029(/,*+7)281'$7,21 ($&+ 6$/9$*(7$1*(177(50,1$/ ($&+ 6$/9$*(/,*+767$1'$5' /80,1$,5( ($&+ 6$/9$*(6,*17<3(& ($&+ 6$/9$*(6,*17<3(' ($&+ 6$:,1*&21&5(7(3$9(0(17)8//'(37+ /,1)7 6$:,1*%,73$9(0(17)8//'(37+ /,1)7 5(029(:$7(50$,1 /,1)7 5(029(6(:(53,3(67250 /,1)7 5(029(6(:(53,3(6$1,7$5< /,1)7 5(029(&85% *877(5 /,1)7 5(029(5(7$,1,1*:$// /,1)7 5(029(&+$,1/,1.)(1&( /,1)7 5(029(:$7(56(59,&(3,3( /,1)7 6$/9$*(75$)),&%$55,(5 /,1)7 5(029(&21&5(7(0(',$1 64<' 5(029(&21&5(7(:$/. 64<' 5(029(&21&5(7('5,9(:$<3$9(0(17 64<' 5(029(&21&5(7(3$9(0(17 64<' 5(029(%,780,12863$9(0(17 64<' 5(029(%,780,1286:$/. 64)7 $%$1'21:$7(50$,1 /,1)7 *(27(;7,/()$%5,&7<3( 64<' +$8/ ',6326(2)&217$0,1$7('0$7(5,$/ 3 &8<' (;&$9$7,21&20021 3 &8<' (;&$9$7,2108&. &8<' (;&$9$7,2168%*5$'( 3 &8<' 6(/(&7*5$18/$5(0%$1.0(17&9 3 &8<' &20021(0%$1.0(17&9 3 &8<' &20021/$%25(56 +285 75$&72502817('%$&.+2( +285 675((76:((3(5:,7+3,&.83%5220 +285 :$7(50*$//21 $**5(*$7(%$6(&9&/$66 3 &8<' %,780,12863$7&+63(&,$/ 64<' 0,//%,780,1286685)$&( 64<' '2:(/%$5 ($&+ &21&5(7(3$9(0(17 64<' 6833/(0(17$/3$9(0(175(,1)25&(0(17 3281' '5,// *52875(,1)%$5(32;<&2$7(' ($&+ %,780,12860$7(5,$/)257$&.&2$7 *$//21 7<3(63:($5,1*&2856(0,;% 721 7<3(63121:($5&2856(0,;% 721 7<3(63:($5,1*&2856(0,;) 721 (;3$16,21-2,176'(6,*1(+ /,1)7 3/$67,&62,/6&$3&9 &8<' 6$1'%$&.),// &8<' 5&3,3($3521 ($&+ 5&3,3($3521 ($&+ 3(5)3(3,3('5$,1 /,1)7 3(5)3(3,3('5$,1 /,1)7 39&3,3(6(:(5 /,1)7 5&3,3(6(:(5'(6&/9 /,1)7 5&3,3(6(:(5'(6&/9 /,1)7 5&3,3(6(:(5'(6&/9 /,1)7 5&3,3(6(:(5'(6&/9 /,1)7 6$1,7$5<6(:(56<67(0 /803680 &211(&772(;,67,1*6$1,7$5<6(:(5 ($&+ &211(&772(;,67,1*672506(:(5 ($&+ &216758&7,21&267(67,0$7(&216758&7,213/$16,7(012'(6&5,37,21 81,76&6$+1213$57,&,3$7,1*/(;,1*721$9(18(5(&216758&7,216$3&6$+637+ 81,7&267727$/(67,0$7(48$17,7< &26701'2763$&,7<2)6+25(9,(:6$3&,7<2)$5'(1+,//66$3/5,3$1'&6$+3$57,&,3$7,1*&,7<2)6+25(9,(: &,7<2)$5'(1+,//65$06(<&2817<6$3 52$':$<48$17,7<52$':$<&267672506(:(548$17,7<672506(:(5&26752$':$<48$17,7<52$':$<&267672506(:(548$17,7<672506(:(5&26752$':$<48$17,7<52$':$<&26752$':$<48$17,7<52$':$<&26748$17,7< &267 48$17,7< &267&216758&7,21&267(67,0$7(&216758&7,213/$16,7(012'(6&5,37,21 81,76&6$+1213$57,&,3$7,1*/(;,1*721$9(18(5(&216758&7,216$3&6$+637+ 81,7&267727$/(67,0$7(48$17,7< &26701'2763$&,7<2)6+25(9,(:6$3&,7<2)$5'(1+,//66$3/5,3$1'&6$+3$57,&,3$7,1*&,7<2)6+25(9,(: &,7<2)$5'(1+,//65$06(<&2817<6$3 &211(&7,172(;,67,1*'5$,1$*(6758&785( ($&+ &211(&772(;,67,1*6$1,7$5<6(:(56(5 ($&+ 67((/&$6,1*3,3(-$&.(' /,1)7 7(0325$5<:$7(56(59,&( /803680 &211(&772(;,67,1*:$7(50$,1 ($&+ &211(&772(;,67,1*:$7(56(59,&( ($&+ +<'5$17($&+ $'-8679$/9(%2;:$7(5 ($&+ &25325$7,216723 ($&+ *$7(9$/9( %2; ($&+ *$7(9$/9( %2; ($&+ *$7(9$/9( %2; ($&+ 7<3(.&233(53,3( /,1)7 :$7(50$,1'8&7,/(,521&/ /,1)7 :$7(50$,1'8&7,/(,521&/ /,1)7 :$7(50$,1'8&7,/(,521&/ /,1)7 :$7(50$,1+'3( /,1)7 :$7(50$,1+'3(',5(&7,21$/'5,//(' /,1)7 39&:$7(50$,1 /,1)7 :$7(50$,1,168/$7,21 64<' :$7(50$,1),77,1*6 3281' &$67,1*$66(0%/< ($&+ $'-867)5$0( 5,1*&$67,1* ($&+ &2167'5$,1$*(6758&785('(6,*1* /,1)7 &2167'5$,1$*(6758&785('(6,*1+ /,1)7 &2167'5$,1$*(6758&785('(6,*16' /,1)7 &2167'5$,1$*(6758&785('(6,*163(&,$/ /,1)7 &2167'5$,1$*(6758&785('(6 /,1)7 &2167'5$,1$*(6758&785('(6 /,1)7 &2167'5$,1$*(6758&785('(6 /,1)7 &2167'5$,1$*(6758&785('(6 /,1)7 &2167'5$,1$*(6758&785('(6 /,1)7 &2167'5$,1$*(6758&785('(6 /,1)7 5(&216758&7'5$,1$*(6758&785( /,1)7 ,1),/75$7,21),/75$7,216<67(0 /803680 &216758&7&21752/6758&785( ($&+ *(27(;7,/(),/7(57<3( 64<' 5$1'205,35$3&/$66,, &8<' &21&5(7(:$/. 64)7 &21&5(7(:$/. 64)7 &21&5(7(&85% *877(5'(6,*1% /,1)7 &21&5(7(&85% *877(5'(6,*1% /,1)7 &21&5(7(&85% *877(5'(6,*1% /,1)7 &21&5(7(&85% *877(5'(6,*1% /,1)7 &21&5(7('5,9(:$<3$9(0(17 64<' 7581&$7(''20(6 64)7 3257$%/(35(&$67&21&%$55,(5'(6 /,1)7 /,*+7)281'$7,21'(6,*163(&,$/ ($&+ ,167$///,*+732/( ($&+ ,167$//75$)),&%$55,(5'(6,*1% /,1)7 ,167$//7$1*(177(50,1$/ ($&+ :,5()(1&('(6,*1 /,1)7 :,5()(1&('(6,*19 /,1)7 75$)),&&21752/683(59,625 /803680 75$)),&&21752/ /803680 $/7(51$7(3('(675,$15287( /803680 )/$**(5+285 32/,&(2)),&(5 +285 7(0325$5<,03$&7$77(18$725 $66(0%/< ,167$//6,*17<3(& ($&+ ,167$//6,*17<3(' ($&+ 2%-(&70$5.(57<3(; ($&+ 2%-(&70$5.(57<3(; ($&+ 2%-(&70$5.(57<3(; ($&+ 6,*17<3(& 64)7 (0(5*(1&<9(+,&/(35((037,216<67(0% /803680 (0(5*(1&<9(+,&/(35((037,216<67(0& /803680 (0(5*(1&<9(+,&/(35((037,216<67(0' /803680 (0(5*(1&<9(+,&/(35((037,216<67(0( /803680 (0(5*(1&<9(+,&/(35((037,216<67(0) /803680 75$)),&&21752/,17(5&211(&7 /803680 75$)),&&21752/6,*1$/6<67(0% 6<67(0 75$)),&&21752/6,*1$/6<67(0& 6<67(0 75$)),&&21752/6,*1$/6<67(0' 6<67(0 5(9,6(6,*1$/6<67(0$ 6<67(0 5(9,6(6,*1$/6<67(0( 6<67(0 5(9,6(6,*1$/6<67(0) 6<67(0 7(0325$5<6,*1$/6<67(0$ 6<67(0 7(0325$5<6,*1$/6<67(0% 6<67(0 7(0325$5<6,*1$/6<67(0' 6<67(0 7(0325$5<6,*1$/6<67(0( 6<67(0 52$':$<48$17,7<52$':$<&267672506(:(548$17,7<672506(:(5&26752$':$<48$17,7<52$':$<&267672506(:(548$17,7<672506(:(5&26752$':$<48$17,7<52$':$<&26752$':$<48$17,7<52$':$<&26748$17,7< &267 48$17,7< &267&216758&7,21&267(67,0$7(&216758&7,213/$16,7(012'(6&5,37,21 81,76&6$+1213$57,&,3$7,1*/(;,1*721$9(18(5(&216758&7,216$3&6$+637+ 81,7&267727$/(67,0$7(48$17,7< &26701'2763$&,7<2)6+25(9,(:6$3&,7<2)$5'(1+,//66$3/5,3$1'&6$+3$57,&,3$7,1*&,7<2)6+25(9,(: &,7<2)$5'(1+,//65$06(<&2817<6$3 *(27(;7,/(:(('%$55,(5)$%5,& 64<' 67$%,/,=('&216758&7,21(;,7 /803680 (526,21&21752/683(59,625 /803680 67250'5$,1,1/(73527(&7,21 ($&+ 6,/7)(1&(7<3(06 /,1)7 6(',0(17&21752//2*7<3(:22'),%(5 /,1)7 )(57,/,=(57<3( 3281' )(57,/,=(57<3( 3281' 62'',1*7<3(6$/772/(5$17 64<' 6((',1*$&5( 6(('0,;785( 3281' 6(('0,;785( 3281' +<'5$8/,&67$%,/,=('),%(50$75,; 3281' 52//('(526,2135(9(17,21&$7(*25< 64<' /$1'6&$3(52&. &8<' 5(029$%/(35()2503$9(0(170$5.,1*7$3( /,1)7 62/,'/,1(3$,17:5 /,1)7 62/,'/,1(3$,17:5 /,1)7 '277('/,1(3$,17:5 /,1)7 '%/(62/,'/,1(3$,17:5 /,1)7 62/,'/,1(08/7,&203*5,1:5 /,1)7 62/,'/,1(08/7,&203*5,1:5 /,1)7 62/,'/,1(08/7,&203*5,1:5 /,1)7 %52.(1/,1(08/7,&203*5,1:5 /,1)7 '277('/,1(08/7,&203*5,1:5 /,1)7 '277('/,1(08/7,&203*5,1:5 /,1)7 '%/(62/,'/,1(08/7,&203*5,1:5 /,1)7 62/,'/,1(35()7$3(*5,1:5&217 /,1)7 62/,'/,1(35()7$3(*5,1:5&217 /,1)7 %52.(1/,1(35()7$3(*5,1:5&217 /,1)7 '277('/,1(35()7$3(*5,1:5&217 /,1)7 3$97066*35()7+(502*5,1 64)7 &5266:$/.35()7+(502*5,1 64)7 127(63 '(127(63/$148$17,7<,7(0$ &223(5$7,9($*5((0(17 (;,67,1*7$1*(177(50,1$/,6(,7+(5(73/86256.7 )25$//6:((3,1*$6',5(&7('%<7+((1*,1((5,1&/8'(66:((3(57,0(21/<$1''2(6127,1&/8'(7,0(7275$1632576:((3(572$1')5206,7( %<3$663803,1*6<67(0)2586('85,1*6$1,7$5<6(:(5,167$//$7,21 3,3(%8567,1*,167$//$7,21 6$1,7$5<6(:(5$1':$7(50$,1,168/7$7,21$61(('('/2&$7,216$1',167$//$7,21:,//%(',5(&7('%<7+((1*,1((5 ,1&/8'(648$17,7<)25672506(:(5$1'6$1,7$5<6(:(5 6$1,7$5<0$1+2/(66((&,7<2)6+25(9,(:67$1'$5'3/$7(6$1 &216,6762)7:2/,)762)7<3(63:($5,1*&2856(63:(%%29(5$0,1,0802)&/$66$**5(*$7(%$6( 75$)),&&21752/6,*1$/6<67(0%,7(0)81',1*63/,75()/(&76/2&$/6+$5(2)/5,3)81',1*&216758&7,21727$/ ƉƉĞŶĚŝǆ' ZĂŵƐĞǇŽƵŶƚǇWƵďůŝĐtŽƌŬƐ ŽƐƚWĂƌƚŝĐŝƉĂƚŝŽŶWŽůŝĐǇ 22 APPENDIX A Ramsey County Public Works Cost Participation Policy Approved May 28, 2013 The intent of Ramsey County's Public Works Cost Participation Policy is to equitably distribute the cost of construction and major maintenance projects between the County and its partner communities. The policy recognizes that projects undertaken by the County should benefit the County and provide local benefits to the communities in which they are completed. The policy also defines the County's contributions to locally-initiated projects. All County cost contributions are subject to project feasibility and availability of funding. The policy, as amended on May 28, 2013, reflects Ramsey County's commitment to develop a safe, effective, multimodal transportation system for users of all abilities and incomes. It is upon that foundation the Public Works Department will work with partnering agencies to ensure investments in construction and major maintenance accommodate an appropriate mix of motorized and non-motorized travel options. County cost participation levels have been selectively increased in recognition of the growing importance of integrating pedestrian, bicycle, transit and American Disabilities Act (ADA) features into transportation planning and implementation. Amended policy provisions also remove former provisions which identified differing cost participation levels when federal funds have been secured. In the event unique design considerations or project impacts are identified, the Director of Public Works may negotiate mutually beneficial deviations from this policy, subject to review and approval of the County Board. 23 Department of Public Works Cost Participation PolicyRamsey County Public Works Cost Participation Policy for the Reconstruction and Major Maintenance of County Roads and County State Aid Highways ITEM: COUNTY SHARE: NOTES: Right of Way 50% County cost participation on right of way acquisition may be reduced or eliminated where the acquisition is specifically for detached trails, aesthetics, or special design elements requested by municipalities or other project partners. County participation on right of way acquisition applies only to construction projects and shall be 0% for maintenance projects, except where additional right of way is required to accommodate improvements within the curb or shoulder line. Removals 100% Travel Lanes 100% Parking Lanes 25% 100% in cities under 5,000 population or in White Bear Township. 100% on maintenance pavement preservation projects. Shoulders 100% 100% of the width required to meet State Aid design standards. 100% in cities under 5,000 population or in White Bear Township. 100% on maintenance pavement preservation projects. 50% outside of the required width. 24 ITEM: COUNTY SHARE: NOTES: Concrete Curb & Gutter (new) 25% Concrete Curb & Gutter (replacement) 100% 100% if in serviceable condition, as determined by the County Engineer; otherwise negotiable. 100% of curb and gutter as part of median construction required for traffic channelization or to serve as a pedestrian refuge. Storm Sewer % Eligible for State Aid Culverts 100% Water Main Modification 100% 100%, if required for construction. 0% on betterments. Sanitary Sewer Modification 100% 100%, if required for construction. 0% on betterments Private Utility Relocation 0% Traffic Signals 100% of County Legs Traffic Signal construction is addressed in a separate policy (County Board Resolution 81-1001). Electrical power shall be paid by the municipality. 25 ITEM: COUNTY SHARE: NOTES: Roundabouts 100% of County Legs Retaining Walls 50% 50% when retaining walls are constructed in lieu of right of way acquisition or to mitigate impacts; by negotiation when necessitated by design parameters. Grading Outside of Curb 100% 100% of area required for road construction. 50% of grading required specifically for sidewalks, trails, or other amenities. Medians 100% 100% of a standard concrete median design, including curb and gutter; municipalities shall pay for the additional cost of any decorative or aesthetic treatments. Sidewalks (new) 50% Includes grading, aggregate base, surfacing, and pedestrian ramps. Sidewalks (replacement) 100% 100% if in serviceable condition, as determined by the County Engineer; otherwise negotiable. Bituminous Trail (new) 50% Includes grading, aggregate base, surfacing, and pedestrian ramps. Bituminous Trail (replacement) 100% 100% if in serviceable condition, as determined by the County Engineer; otherwise negotiable. 26 ITEM: COUNTY SHARE: NOTES: Trail/Sidewalk Grade Separation 0% to 50%, by negotiation Bridge or underpass construction. Street Lighting 0% Street Lighting as part of a traffic signal shall be paid 100% by County. Electrical power shall be paid by the municipality. Replacement Trees 100% 100%, if 1:1 replacement; 50%, if greater than 1:1 Fence 100% 100% if serviceable; 0% if in County R/W Turf Restoration 100% Amenities and Aesthetics 0% Special surface treatments, ground covers, or plantings, ornamental railings, etc. Driveway Replacement 100% Stormwater Treatment % eligible for State Aid Maintenance shall be based on contributing flows. 27 ITEM: COUNTY SHARE: NOTES: Preliminary/Design Engineering % of Participation Construction Engineering % of Participation 28 All County participation is subject to the availability of funds. On Federal Aid Projects, the federal funds shall be applied to all eligible items before cost participation is calculated. Federal participation is typically 50-80% of the total project cost. Right of Way (ROW) acquisition continues to grow in cost and complexity. Setting the County Cost share at 50% is intended to make the County an equal partner with the municipality(s), regardless of funding source(s) secured for a project. Early creation of a cooperative partnership helps ensure project scoping and alternatives analysis are comprehensive and consider all benefits and costs -- including right of way cost and impacts. Joint efforts can also identify specific locations where extraordinary ROW impacts are likely. In those cases, the County and City(s) can revisit available options or consider appropriate design changes. Timely recognition of unavoidable impacts can provide additional time for all parties to secure their respective funding sources. Redevelopment and/or future land use changes may also provide an opportunity to reduce conflicts with programmed improvements. Individual parcels which present exceptional challenges may justify an unequal distribution of City/County cost shares for consideration and approval of the County Board. Retaining Walls are generally constructed to reduce right of way impacts or to protect environmental resources such as wetlands or wooded areas. County cost participation will be at the 50% level for those wall installations similar to ROW cost participation. In situations where wall options are locally preferred or part of a community's aesthetic design goals, County participation will be reduced or eliminated. Resulting County contributions will be limited to benefits reducing impacts to adjoining properties or environmental resources. Trail/Sidewalk Grade Separations are desirable bike and pedestrian features but can be cost prohibitive in many settings. ADA compliance and mitigating access/safety issues often add substantial construction costs to otherwise straightforward structures - particularly in locations where space is limited. Design options can also vary from simple box culvert underpasses to elaborate bridge structures. The intent of a negotiated cost participation level of 0-50% is an acknowledgement of the enormous range in costs that may be proposed. It is important County participation adhere to sound benefit/cost considerations. County participation levels may also consider the availability of federal or other outside funding sources that materially reduce County and local shares. ƉƉĞŶĚŝǆ, ĞŶĞĨŝƚŝŶŐWƌŽƉĞƌƚŝĞƐDĂƉ LEXINGTON AVENUE (CSAH 51)3780 LEXINGTON AVENUE N SHOREVIEW, MN 55126-2916 263023320014 GREY FOX RD RED FOX RD TARGET RD 3833 LEXINGTON AVENUE N ARDEN HILLS, MN 55126-2937 273023410023 3787 LEXINGTON AVENUE N ARDEN HILLS, MN 55126-2937 273023410024 3757 LEXINGTON AVENUE N ARDEN HILLS, MN 55126-2937 273023410020 3751 LEXINGTON AVENUE N ARDEN HILLS, MN 55126-2937 273023410021 3800 LEXINGTON AVENUE N SHOREVIEW, MN 55126-2916 263023320013 3845 LEXINGTON AVENUE N ARDEN HILLS, MN 55112 273023410022 PROPOSED TRAFFIC SIGNAL TRAFFIC SIGNAL SYSTEM LEXINGTON AVENUE AT TARGET ROAD BENEFITING PROPERTIES ƉƉĞŶĚŝǆ/ WƌĞůŝŵŝŶĂƌǇƐƐĞƐƐŵĞŶƚZŽůůƐ;WĞŶĚŝŶŐͿ ƉƉĞŶĚŝǆ: ŝƚǇŽĨƌĚĞŶ,ŝůůƐƐƐĞƐƐŵĞŶƚWŽůŝĐǇ City of Arden Hills 2004 Assessment Policy Index Page General Information............................................................................................1 Part I – Assessment Policy for Existing Streets..................................................1 Street Reconstruction..............................................................................3 Mill and Overlay Improvements.............................................................4 Alley .....................................................................................................5 Appurtenances.........................................................................................5 Maintenance/Rehabilitation Projects ......................................................6 Definitions and General Provisions ........................................................6 Assessment Units ..................................................................................10 Hardship Deferrals ................................................................................11 Appeals Process ....................................................................................12 Part II – Policy for New Developments............................................................13 Sanitary Sewer ......................................................................................14 Water Distribution System....................................................................16 Storm Sewer..........................................................................................20 Additional Definitions and General Provisions ....................................22 2004 Assessment Policy – Page 1 City of Arden Hills 2004 Assessment Policy General Information The City of Arden Hills has adopted a revised Assessment Policy for its existing streets that are part of the Pavement Management Program (PMP )).. The PMP is a long-term, multi-year plan that consists of proposed reconstruction and repair of the city’s streets. The goal and intent of this policy revision was to simplify and make the process easy to understand and implement. The Policy was drafted by a group of local citizens who served on the City’s 2004 Assessment Policy Task Force. This Policy document is divided into two parts. Part I deals with existing streets and Part II deals with new developments. Part I – Assessment Policy for Existing Streets The purpose of this assessment policy manual is to establish procedures to be utilized by the City of Arden Hills when preparing assessment rolls, so as to assure uniform and consistent treatment of the affected properties. Minnesota State Law, Chapter 429 provides that a municipality shall have the power to make public improvements such as sanitary sewers, storm sewers, water source and distribution facilities, street improvements including grading, curb and gutter, surfacing, sidewalks, street lighting and recreational facilities, etc. The various procedures that the municipality must follow including reports, notices and public hearings are well defined within the law. The Statute further defines that the cost of any improvement may be assessed upon property benefited by the improvement based upon the benefits received whether or not the property abuts on the improvement and whether or not any part of the cost of the improvement is paid from other funding sources. The law is not specific on how these benefits are to be measured or how the costs are to be apportioned, but rather makes it incumbent upon the municipality to determine with assistance of the City Engineer, City Attorney, appraisers or other qualified personnel, a fair and equitable method of cost-sharing among the properties involved. Throughout this policy manual, the total cost of an improvement shall include the construction cost, plus all associated overhead costs. The total cost of the associated overhead for a public improvement project would typically include the following as a percentage of the construction costs: 2004 Assessment Policy – Page 2 City Administration 2.5% Design Engineering Construction Engineering 10.0% 10.0% Legal 2.0% Fiscal 3.0% Interest During Construction 4.5% Assessment Roll Preparation 1.0% Contingencies 4.0% TOTAL 37.0% These overhead costs are estimates however; they are used to calculate actual assessments. The initiation of public improvement projects may happen utilizing two (2) different methods. The first method is by a petition of the affected property owners. The petition must be signed by not less than thirty-five percent (35%) of the owners of the frontage of the real property abutting the proposed improvements .. It should be noted that the City Council retains the right to review the merits of each project or improvement and establishes the priority as it deems proper. The second method is to initiate the proceedings by City Council direction, in which case no petition is needed. Any reference to land zoning in this policy manual shall mean the most current approved City Zoning Map available at the time. It should be emphasized that the special assessment methods and policies summarized herein cannot be considered as all-inclusive and that unusual circumstances may at times justify special consideration. Also, any fixed cost data and rates presented herein will be adjusted from year to year so as to reflect current costs. The City Council shall retain the right to review each project on its own merit and to deviate from any portion of this Assessment Policy Manual, as it deems proper. These deviations may occur in unique situations or where application of the policy produces unfair or undesirable results. The City of Arden Hills utilizes a Unit Cost methodology for the assessment of existing residential homes on a per-lot unit basis, with a lot unit being defined as a platted single- family residential lot or equivalent, which, according to current Arden Hills Municipal Code cannot be further subdivided for R-1 and R-2 residential use. The City will assess fifty percent (50%) of the total charges, as assessment, to the residents for existing roadways. Generally, no assessments are made to the residents for sanitary sewer, water, and storm water that are part of the PMP. 2004 Assessment Policy – Page 3 Street Reconstruction A. Residential Equivalent Assessment Rate All R-1 and R-2 residentially zoned properties with frontage abutting a street that is reconstructed shall be assessed on a per unit basis at the residential equivalent assessment rate. This rate shall apply, regardless of the street's classification (local, collector, arterial, trunk highway); designation (County State-Aid Highway, Municipal State-Aid Street); or jurisdiction (State, County or City). The residential equivalent assessment rate shall be based on fifty percent (50%) of the total cost of street reconstruction, including all associated overhead costs for a typical residential street section. This residential equivalent assessment rate shall be determined by the City Council. B. Commercial Equivalent Assessment Rate/All Other Zoning Classifications Assessment Rate Commercial properties with frontage abutting a street that is reconstructed shall be assessed on a per unit basis at the commercial/industrial equivalent assessment rate. The per unit basis is calculated based on the average neighborhood unit size, particularly in a mixed (residential and commercial) neighborhood. Larger sized commercial lots may be sub-divided into smaller units for assessment purposes and to ensure equity. This rate shall apply, regardless of the street's classification (local, collector, arterial, trunk highway); designation (County State-Aid Highway, Municipal State-Aid Street); or jurisdiction (State, County or City). The commercial/industrial equivalent assessment rate shall be based on seventy percent (70%) of the cost of street reconstruction plus all associated overhead costs for a typical commercial street section. This commercial/industrial equivalent assessment rate shall be determined by the City Council. C. Tax Exempt (non-profits, churches, schools, organizations, groups) Equivalent Assessment Rate The tax exempt equivalent assessment rate shall be based on one hundred percent (100%) of the total cost of street reconstruction, including all associated overhead costs for a typical residential street 2004 Assessment Policy – Page 4 section. This assessment rate shall be determined by the City Council. All properties with frontage abutting a street that is reconstructed shall be assessed on a per unit basis at the tax exempt equivalent assessment rate. This rate shall apply, regardless of the street's classification (local, collector, arterial, trunk highway); designation (County State-Aid Highway, Municipal State-Aid Street); or jurisdiction (State, County or City). Mill and Overlay Improvements Mill and overlay improvements are placed as a cost-effective measure to extend the useful street life of a particular roadway and to delay street reconstruction needs. As bituminous mill and overlays are constructed as long-term rehabilitation improvements, the cost of these improvements shall be assessed as described below. From time to time, however, the City's Operations and Maintenance Department may determine that small street areas need immediate bituminous overlay improvements for short- term maintenance purposes. These types of bituminous overlays, determined to be "stop gap" maintenance needs rather than long-term street rehabilitation improvements, shall not be assessed to abutting properties and shall be funded by the City. A. Residential Equivalent Assessment Rate All R-1 and R-2 residentially zoned properties with frontage abutting a street that is overlaid with bituminous surfacing shall be assessed on a per unit basis at the residential equivalent assessment rate. This rate shall apply, regardless of the street's classification (local, collector, arterial, trunk highway); designation (County State-Aid Highway, Municipal State-Aid Street); or jurisdiction (State, County or City). The residential equivalent assessment rate shall be based on fifty percent (50%) of the cost of bituminous overlay plus all associated overhead costs for a typical residential street section. This residential equivalent assessment rate shall be determined by the City Council. B. Comme rcial/Industrial Equivalent Assessment Rate All commercially or industrially zoned properties with frontage abutting a street that is overlaid with bituminous surfacing shall be assessed on a unit basis at the commercial/industrial equivalent assessment rate. 2004 Assessment Policy – Page 5 This rate shall apply, regardless of the street's classification (local, collector, arterial, trunk highway); designation (County State-Aid Highway, Municipal State-Aid Street); or jurisdiction (State, County or City). The commercial/industrial equivalent assessment rate shall be based on seventy percent (70%) of the cost of a bituminous overlay plus all associated overhead costs for a typical commercial street section. This commercial/industrial equivalent assessment rate shall be determined by the City Council. C. Tax Exempt (non-profits, churches, schools, organizations, groups) Equivalent Assessment Rate All tax exempt properties with frontage abutting a street that is overlaid with bituminous surfacing shall be assessed on a per unit basis at the tax exempt equivalent assessment rate. This rate shall apply, regardless of the street's classification (local, collector, arterial, trunk highway); designation (County State-Aid Highway, Municipal State-Aid Street); or jurisdiction (State, County or City). The tax exempt equivalent assessment rate shall be based on one hundred percent (100%) of the cost of bituminous overlay plus all associated overhead costs for a typical residential street section. This tax exempt equivalent assessment rate shall be determined by the City Council. Alley All reconstruction shall be assessed 50% to the abutting properties. The assessment shall be on a per unit basis for the property frontage on the alley. Appurtenances Appurtenances such as sidewalks, street lighting, trees, or other landscaping features are often encountered during street improvement projects. Appurtenances to new street construction, street reconstruction, or bituminous overlay improvements that are either existing or needed by the City shall be included in the cost of the street improvement project. Appurtenances constructed or provided in areas along an improvement project where they do not currently exist, shall be one hundred percent (100%) assessed to the benefiting properties on a per unit basis. The cost of these appurtenances shall be separated from the cost of the street improvement project. All costs of ornamental street lighting and/or any lighting shall be one hundred percent (100%) assessed to the benefiting properties on a per unit basis. 2004 Assessment Policy – Page 6 Maintenance/Rehabilitation Projects Concrete Pavement Restoration – Concrete pavement restoration is a maintenance procedure funded by the City. Crack Sealing – Crack sealing is a maintenance procedure funded by the city. Bituminous Seal Coating – Bituminous seal coating is a maintenance procedure funded by the City. Bituminous Surface Patching – Bituminous surfacing patching is a maintenance procedure funded by the City. Definitions & General Provisions A. Assessment Rate The assessment rate for any special assessment district is computed by dividing the total assessable costs of such improvement by the total number of assessment units. Residential Example: Roadway Project Cost $601,000 Drainage Improvements $205,000 Sanitary Improvements $245,000 Water Main Improvements $38,000 Total Project Cost: $1,089,000 Assessed to Property Owners: Roadway Project Cost $601,000 50% assessed $300,500 Number of units in the neighborhood 60 Per Unit Assessment: $300,500 divided by 60 equals $5,008 B. Assessable Costs The assessable cost of an improvement shall be defined as those costs that, in the opinion of the City Council, are attributable to the need for service in the area served by the improvement. 2004 Assessment Policy – Page 7 C. Petition Petition shall mean a written document presented to the City Council for purpose of initiating a public improvement project. The address of each signatory, the date of the signature and a printing of each signatory's name shall accompany all signatures. D. Total Project Cost Total project cost shall mean the total estimated construction cost plus all associated overhead costs. Overhead costs shall include, but not be limited to, City administration, engineering, legal, fiscal, and interest during construction and land acquisition. E. Assessment Period The length of payment period of various types of improvement projects shall be as follows: ? Mill and Overlay = 5 years ? Street Reconstruction = 10 years In the case where several areas of the improvements listed above are included in the same project, the assessment period shall be determined by the City Council. In no event shall an assessment period exceed ten (10) years. F. Municipal State-Aid Streets Municipal State-Aid Streets are routes designated by the City Council and approved by the Commissioner of Transportation for inclusion in the City's State-Aid system. All routes typically begin and end on another municipal state-aid road, county state-aid road, or trunk highway. The criteria used in selecting such routes are as follows: ? The route is projected to carry a relatively heavier traffic volume or is functionally classified as collector or arterial as identified on the City's functional plan as approved by the City Council; and, ? The route connects the points of a major traffic interest within the City; and, ? The route provides an integrated street system affording, within practical limits, a state-aid street network consistent with projected traffic demands. 2004 Assessment Policy – Page 8 G. Municipal State-Aid Construction Funds Municipal State-Aid construction funds are monies apportioned to the City from the State to be used for the construction of routes designated on the Municipal State-Aid system. All construction funded with these monies must be in accordance with the Minnesota Department of Transportation (MnDOT) Office of State-Aid design criteria. Municipal State Aid (MSA) Funds will be utilized to offset the city’s portion of the project cost. H. Interest Rate on Unpaid Balance The interest rate used for the assessment shall be designated at the prime rate plus two (2) percentage points, fixed for the duration of the outstanding balance. The effective date of the interest shall be the date the Council approval of the assessment role. I. Land Not Included in Assessment The City may reserve the right to delete land within the assessable area from the assessment roles if, in its opinion, the land cannot be developed and/or the improvement does not provide benefit. No development of that property shall be permitted, nor shall any physical connection to the City's utility or drainage facilities be made by any development on that property until the assessment or connection fees are paid. J. Service District A service district is the area, as determined by the City Engineer and approved by the City Council, which will receive benefit from a proposed improvement project. This type of approach for assessment purposes is typically used for trunk and subtrunk sanitary sewer projects; trunk, subtrunk, source, storage and treatment water projects; and trunk storm sewer projects. K. Certification of Assessment Roll At the time the assessment rolls are adopted by the City Council by resolution (refer to Appendix for a sample resolution), the property owner may pay the entire assessment against their property in full at Arden Hills City Hall, 1245 W. Highway 96, within thirty (30) days without interest charge. Beyond thirty (30) days, but prior to certification to the County, payment (principal plus interest from the assessment roll date) can be made at the City Hall. After the certification of assessment to the County is made, a resident may make a payment directly at the Ramsey County Government Center, 50 Kellogg Boulevard, St. Paul. Interest 2004 Assessment Policy – Page 9 charges apply effective from the date of Council approval of the assessment role. It should be noted that the certification is made to the County in early September. A property owner may pay the total assessment against their property with accrued interest at any time during the life of the project assessment period. If paid before November 15th, interest is calculated to December 31st of the year the payment is made. If paid after November 15th, interest will be calculated through December 31st of the next year. Once the assessments are certified to the County, it is the responsibility of the County staff to calculate the interest charges and include them in the annual property tax payment schedule. Example: Assessment Amount $4,500 No. of years assessed 10 Interest Rate 6% Assessment Roll Approval Date 5/1/2005 Est. Total Interest over the life $1665 Schedule of Payments: Interest Principal Total Balance Year 1* $ 450.00 $ 450.00 $ 900.00 $4,050.00 Year 2 $ 243.00 $ 450.00 $ 693.00 $3,600.00 Year 3 $ 216.00 $ 450.00 $ 666.00 $3,150.00 Year 4 $ 189.00 $ 450.00 $ 639.00 $2,700.00 Year 5 $ 162.00 $ 450.00 $ 612.00 $2,250.00 Year 6 $ 135.00 $ 450.00 $ 585.00 $1,800.00 Year 7 $ 108.00 $ 450.00 $ 558.00 $1,350.00 Year 8 $ 81.00 $ 450.00 $ 531.00 $ 900.00 Year 9 $ 54.00 $ 450.00 $ 504.00 $ 450.00 Year 10 $ 27.00 $ 450.00 $ 477.00 $ - $1,665.00 $4,500.00 $6,165.00 * Note: Interest in year 1 is for twenty (20) months (May 1 ,2005 – December 31, 2006). 1. Ad Valorem Tax The City Council may, at their discretion, utilize ad valorem taxes to fund portions of the project cost of any public improvement. This shall be done in accordance with the appropriate Minnesota State Statutes. 2004 Assessment Policy – Page 10 2. Petition for Non-Programmed Projects The City of Arden Hills has established a formal capital improvement program for street reconstruction and rehabilitation projects. It is the intent of the City to generally follow this established program. The Arden Hills City Council will accept petitions from property owners requesting non- programmed projects. Generally, the assessment rate for non-programmed improvement projects initiated by petition of the affected property owners, and approved by the Council, shall be one-hundred percent (100%) of the total project cost. 3. Improvements to Roadways Not Under City Jurisdiction The City may assess properties that abut roadways not under City jurisdiction, but receiving reconstruction or bituminous overlay improvements. The assessment rate levied against these properties shall be the same as those established for City reconstruction or bituminous overlay projects. Assessment Units The City shall levy special assessments on adjacent benefiting properties for street improvement projects. The assessment rate shall be computed on a per-lot unit basis, with a lot unit being defined as a platted single-family residential lot or equivalent, which, according to current Arden Hills Municipal Code cannot be further subdivided for R-1 and R-2 residential use. If a property has been assessed on a lot unit basis for a public improvement, and subsequently a property division is made creating additional lot units, then a supplemental charge shall be made to the property at the same rate which applied under the original assessments. All tax exempt status properties shall be subdivided to determine the assessable lot units or part thereof. Corner lots shall be assessed on the street that is used for the mailing address. If a street improvement project is requested to be constructed to a greater width and/or thickness than the standard by the abutting property owners, the excess cost above that of the standard reconstruction cost shall be assessed one hundred percent (100%) to those properties. All properties with tax exempt status and abutting new street reconstruction, street reconstruction, or bituminous overlay improvements shall be assessed at one hundred percent (100%) of the cost of the improvement. 2004 Assessment Policy – Page 11 The assessment process shall be carried out in accordance with Minnesota Statutes Chapter 429. The assessment rate shall be on a per-lot unit basis and shall be calculated and processed in accordance with the current Arden Hills Pavement Management Program and Assessment Policy. Hardship Deferrals Minnesota Statute No. 435.193 allows the City, at its own discretion, to defer the payment of any assessment for any homestead property, that is a primary place of residence, owned by a person sixty-five (65) years of age or older, or retired by virtue of a permanent and total disability for which it would be a hardship to make the payments. Under the hardship criteria, no payment amount is reduced or eliminated, but deferred to a future date. Eventually, a payment in full with interest will be due to the City/County. The person filing for a senior deferment must be sixty-five (65) of age on or before December 31st of the assessment year. In order to receive such a deferment, the affected person must establish the economic hardship that would be incurred to the reasonable satisfaction of the Arden Hills City Council by providing documentation showing an annual gross income less than fifty percent (50%) of the Ramsey County median household income as determined by the most recent census. The deferral will last for a period of not more than ten (10) years, and will terminate before ten (10) years if any one of the following conditions is present: ? The owner of the property dies and the spouse is not eligible for a deferment; ? The property is sold; ? The property is no longer homestead; ? The City Council determines that there is no longer hardship incurred in immediately requiring either full or partial payment of the assessment. The City reserves the right to periodically request verification of continued eligibility for a hardship deferral. It should be noted that during the term of the deferral, interest will accrue. At the termination of the deferral period, interest and principal will be due in a lump sum amount. An application for deferment of special assessments is available at the City Offices. It is the responsibility of the resident to submit a completed deferral form, along with tax documents, to the Finance Director for approval. This application must be filed within 30 days of the assessment role. The submission of a deferral form to the City does not automatically qualify a resident for the deferral. If a resident is approved for the deferral, the City staff will notify the resident of the approval. The City staff on a periodic basis may request the resident to verify their eligibility. 2004 Assessment Policy – Page 12 Appeals Process An owner of the property has the opportunity to appeal the assessment amount at various stages of the assessment process. The first stage is when the assessment amount is initially estimated by staff based on the interpretation of the existing Assessment Policy. If the estimate was based on inaccurate or incomplete information, the owner may work directly with staff to clarify or rectify the situation. If the owner is not satisfied with the outcome at this stage, known as the first stage, they may file a formal appeal with the City Council, prior to the adoption of the assessment roll. This is known as the second stage of the appeal’s process. If the appeal is denied by the City Council, the owner may appeal to the district court pursuant to Minnesota Statutes, Section 429.081, by serving notice of the appeal to the Mayor or the City Administrator within thirty (30) days after the adoption of the assessment. 2004 Assessment Policy – Page 13 Part II – Policy for New Developments The assessment policy for anyone who wishes to make public improvements within the City of Arden Hills, as part of a proposed development shall conform to the policies established herein and as modified below. It is the responsibility of the developer to assume total costs (100%) for all new road and street construction including, lights, sanitary sewer, water, and storm water. Prior to any action on the part of the City to determine the feasibility of providing public improvements, the developer shall deposit such amount as determined by the City Administrator to adequately reimburse the City for all engineering, legal and planning, and other consultant fees for work performed in regard to such improvements. In addition, the developer shall be required prior to the City ordering the installation of any City financed improvements, to enter into a Development Contract insuring compliance with the policies set out herein and all subdivision requirements of the City. The developer shall also be required to post all cash deposits, and/or letters of credit prior to such action by the City Council. In all projects that the City constructs and finances, the following security provisions shall apply. A. For single family, two family or townhouse residential developments, the developer shall deposit with the City a cash escrow or an irrevocable letter of credit of not less than one hundred twenty-five percent (125%) of the estimated project cost as determined by the City Engineer. If the estimated project cost, as determined after receipt of bids for construction, exceeds the Engineer's estimate by ten percent (10%) or more, the deposit shall be increased proportionately. The total project costs shall be assessed in equal annual installments according to the assessment period. B. In the case where the improvements benefit not only the property being developed, but other areas within the City, the developer shall provide to the City a security deposit in accordance with paragraphs described above for the portion of the estimated project costs that represent the benefit to the proposed development. Such portion shall be assessed against the properties benefited. For all other types of development, the developer shall deposit with the City a cash escrow or irrevocable letter of credit of not less than one hundred twenty-five percent (125%) of the estimated project cost as determined by the City Engineer. If the estimated project cost as determined after receipt of bids for construction exceeds the Engineer's estimate by ten percent (10%) or more, the deposit shall be increased proportionately. The total project costs shall be assessed in equal annual installments according to the assessment period. The security deposit shall be irrevocable for the full term of any assessments for which given. The agreement shall be so conditioned as to guarantee payment of the 2004 Assessment Policy – Page 14 assessments as due or to pay for the cost of all improvements that the developer agreed to install. The required security deposit may consist of a cash escrow deposit or irrevocable letter of credit, in form acceptable to the City Attorney, and with firms authorized to do business in the State of Minnesota. Sanitary Sewer A. Definitions and General Provisions 1. Sanitary Sewer Interceptors A network of relatively large diameter, deep sewer pipe and associated pumping stations and appurtenances. The interceptors are designed as collectors for large areas within the sanitary sewer service area. 2. Sanitary Sewer Trunks and Subtrunks Sanitary sewer pumping stations, including associated forcemain and/or a network of gravity pipes ranging in size generally from ten inch (10") through eighteen inch (18") and extending away from respective interceptor mains. Pumping station, forcemains, trunks and subtrunks are designed as collectors for areas usually less than three hundred (300) acres. Because sewer lines flow by gravity, the pipes can become quite deep at some locations and very costly to install. A trunk or subtrunk assessment is, in certain cases, utilized so that costs due to extra depth (and/or oversizing) will be spread over the entire service district rather than becoming a burden on just those properties abutting that portion of the pipe network constructed. 3. Sanitary Sewer Laterals A network of pipes, usually eight inch (8") in size that are installed eight (8) to twenty (20) feet deep and are designed to serve those buildings abutting a given street or easement. The laterals drain to trunks, subtrunks or directly to interceptors. 4. Sanitary Sewer Building Services Those pipes, usually four-inch (4") or six-inch (6") in size leading from laterals (or sometimes from trunks, subtrunks and interceptors) that serve individual buildings. The services are plugged at the property line until such time that a building is connected to the sewer system. The property owner must make arrangements with a licensed, bonded plumber to complete the service connection. 2004 Assessment Policy – Page 15 5. Sanitary Sewer Availability Charge (SAC) This is a charge billed to all properties at the time of connection to the sanitary sewer system. The charge is the individual property share of the cost of the interceptor trunk and treatment facilities that make sewer service available. The charge is based on an equivalent unit basis. The method used to calculate the total number of units for any specific property and the current unit charge are based on the Metropolitan Council Environmental Services (MCES) for expected sewage flow from various dwellings or businesses. A listing of the MCES sewer availability charges is available on the Metropolitan Council website: www.metrocouncil.org. This charge may not be assessed against the property. 6. Sanitary Sewer Lateral Benefits Lateral benefit may be provided by connection to trunk, subtrunk or lateral pipes. The calculation of lateral benefit from a trunk or subtrunk pipe will be based on the cost of an eight inch (8") pipe along the same alignment at a depth adequate to provide services to the abutting properties. 7. Infrastructure Rehabilitation Projects Any project or portion of a project that reconstructs an existing sanitary sewer facility. A rehabilitation project may occur on the existing alignment of the sewer line or on a new alignment, thus allowing the existing line to be abandoned or its status downgraded (i.e., trunk or subtrunk to lateral). B. Determining Sanitary Sewer Assessment Rates 1. Sanitary Sewer Interceptor Rates All properties that lie within the approved Service District shall bear the cost of sanitary sewer interceptor projects. The costs shall be spread equally, based on a gross area basis within the Service District, and will be known as an interceptor assessment. 2. Sanitary Sewer Trunk/Subtrunk Rates The lateral and building service assessments described below will be deducted from the total improvement cost to be assessed. The amount remaining after said deductions will be assessed on a gross area basis to all propertied within the Service District, and will be known as a trunk assessment and/or subtrunk assessment. 2004 Assessment Policy – Page 16 3. Sanitary Sewer Lateral Rates The building service assessments described below will be deducted from the total improvement cost to be assessed. The amount remaining after said deductions will be assessed by the following method. The resulting assessment will be known as a lateral benefit assessment. Each assessable unit shall be assessed as follows: ? R-1 and R-2 residential lots at 100% of the total project cost ? All other land uses at 100% of the total project cost 4, Sanitary Sewer Building Service The assessment rate for each size of building service; four inch (4"), six inch (6"), or eight inch (8") shall be determined by adding all the costs associated with each size of service and dividing by the total number of services constructed. Each unit will be assessed at the determined rate for each size and number of services installed. This will be known as the building service assessment. Water Distribution System A. Definitions and General Provisions 1. Water Source and Treatment Facilities The City of Arden Hills purchases water from the City of Roseville to supply the water distribution system. Water enters the system at three (3) separate meter stations. The water purchased from Roseville is treated, and Arden Hill does not add any water treatment to the distribution system. 2. Water Storage Facilities The City of Arden Hills has a total water storage capacity of 1.5 million gallons comprised by two (2) elevated storage tanks. One tank has a capacity of 1.0 million gallons and is located south of I-694 along Red Fox Road. The other storage tank has a capacity of 0.5 million gallons and is located north of I-694 along Fernwood Avenue. 2004 Assessment Policy – Page 17 3. Water Trunk and Subtrunk Distribution Mains A network of pipes and related appurtenances usually in the size range of ten inch (10") to sixteen inch (16"). These pipes are designed to carry large volumes of water and interconnect various point sources of water supply and storage reservoirs. Appurtenances to these facilities would include valves and fittings, but not fire hydrants. 4. Water Main Laterals A network of water pipes and related appurtenances usually six inches (6") or eight inches (8") in size that are installed with approximately eight feet (8') of ground cover to retard freezing and are designed to serve those buildings abutting a given street or easement. Lateral mains are "looped" wherever possible to balance pressures and to provide water from at least two (2) directions so that continuous water service is maintained for most people during a water main break. Looping of lateral mains eliminates dead end water mains that cause a variety of distribution and stagnation problems. Appurtenances to these facilities would include valves, fittings and fire hydrants. 5. Water Main Building Service These pipes lead from laterals (or sometimes from trunk and subtrunk mains) and serve individual buildings abutting thereon. The size of the service usually ranges from three-quarter inch (3/4") to six-inch (6"), depending upon the type of building served. The lines terminate at the property line with a shut off valve and are plugged until such time that the building is connected to the water system. The property owner must make arrangements with a licensed, bonded plumber to complete the service connection. 6. Water Connection Charge This is a charge billed to all properties at the time of connection to the water system. The charge is the individual property share of the cost of the trunk, source, and storage facilities that make water service available. The charge is based on the size of the connection, plus the material and installation cost of a water meter. The current charges are outlined in the City Fee Schedule. Neither of these charges may be assessed against the property. 2004 Assessment Policy – Page 18 7. Water Main Lateral Benefits The benefit resulting to a property abutting or utilizing a water main where a direct connection to that water main via a building service is reasonably possible without additional lateral pipes. Lateral benefit may be provided by connection to trunk, subtrunk or lateral pipes. The calculation of lateral benefit from a trunk or subtrunk pipe will be based on the cost of an eight inch (8") pipe along the same alignment for commercial or industrial zoned property and a six inch (6") pipe for all other areas. 8. Infrastructure Rehabilitation Projects Any project or portion of a project that reconstructs an existing water system facility. A rehabilitation project may occur on the existing alignment of the water line or on a new alignment, thus allowing the existing line to be abandoned or its status downgraded (i.e., trunk or subtrunk to lateral). B. Determining Water Main Assessment Rates 1. Trunk, Subtrunk, Storage and Treatment Facility Rates Any lateral and building service assessments described below will be deducted from the total improvement cost to be assessed. The remaining costs shall be spread equally to all properties that lie within the approved Service District. The costs shall be spread on a gross area basis and will be known as all or any of the following as appropriate: trunk, subtrunk, source, storage, and treatment assessment. 2. Water Main Lateral Rates The building service assessments described below will be deducted from the total improvement cost to be assessed. The amount remaining after said deductions will be assessed by the following method. ? R-1 and R-2 residential lots at 100% of the total project cost ? All other land uses at 100% of the total project cost 3. Water Main Building Service The assessment rate for each size of building service three-quarter inch (3/4") to eight inch (8") inch shall be determined by adding all the costs associated with each size of service and dividing by the total number of services 2004 Assessment Policy – Page 19 constructed. Each unit will be assessed at the determined rate for each size and number of services installed. This will be known as the building service assessment. Storm Sewer A. Definitions and General Provisions 1. Storm Sewer Improvement District The City Council may, at its discretion, construct and finance storm sewer improvements by utilizing a storm sewer tax district, pursuant to Minnesota Statute 444.16 through 444.21. 2. Storm Sewer Trunk Facilities a. Ponds A basin or wetland constructed or naturally located within a permanent easement for the purpose of containing storm runoff. May be a retention (permanent) pond; detention (temporary) pond; or a combination of both. Arden Hills is within the Rice Creek Watershed District (RCWD), which may require additional improvement to control flow discharge from the ponds. The RCWD has a formal permitting process governing pond construction. b. Pipe Network A network of pipes ranging in size generally from thirty inches (30") through seventy-two inches (72"). The trunk pipe networks are designed to collect stormwater runoff from an area generally larger than forty (40) acres. 3. Channels, Ditches and Swales Conveyance network constructed within permanent easements for the purposes of transporting stormwater runoff. 4. Storm Sewer Lateral Facilities A network of pipes ranging in size generally from twelve inches (12") to twenty-seven inches (27") designed to collect stormwater runoff from a specified small area to a trunk facility. The lateral facilities also include street 2004 Assessment Policy – Page 20 overland flow and inlet structures such as catch basins, manholes and flared end sections. 5. Storm Sewer Taxing District A drainage area determined by using topographical maps and surveys that mutually benefit from storm sewer improvements in conformance with Minnesota Statute, Section 444.16 through 444.21 6. Watershed District A formally established area and Board that protects and controls the water management aspects of subdivisions and developments within the region. B. Determining Storm Sewer Assessment Rates 1. Storm Sewer Trunk Rates Design and estimate the total improvement cost of the ultimate trunk system needed to provide complete service to each property in the Service District considered. Also, include the total cost of any existing facilities and/or previous storm sewer assessments to be credited. Determine the base assessment rate by dividing the ultimate system cost described above by the sum total of the following: ? Gross area of low-density residential properties times 1.0. ? Gross area of medium and high density residential, church and school properties times 1.25. ? Gross area of commercial property times 1.5. ? Gross area of industrial property times 2.0. Assessment rates would be set as follows: ? The base rate shall apply to low density residential properties. ? The base rate times 1.25 shall apply to medium and high- density residential, church and school properties. ? The base rate times 1.5 shall apply to commercial property. ? The base rate times 2.0 shall apply to industrial property. Credits may be given for previous storm sewer assessments, existing systems and any future additional construction that may be necessary as determined by 2004 Assessment Policy – Page 21 the City Engineer for complete service to each property. Credit rates for future construction shall be based on current prices. The City may determine that storm sewer trunk cost be assessed to all properties within a respective storm sewer taxing district under Minnesota Statute 444.16 through 444.21 2. Storm Sewer Lateral Rates The lateral storm sewer project costs will be assessed by one of the following methods as determined by the City Council after the project feasibility study. 3. Lot/Equivalent Lot Basis Determine the total number of lots and equivalent lot units receiving lateral benefit and divide the project cost equally among them. ? R-1 and R-2 residential lots at 100% of the total project cost ? All other land uses at 100% of the total project cost B. Municipal State-Aid Construction Fund Contributions When a Municipal State-Aid Street project includes either trunk or lateral storm sewer, which the Minnesota Department of Transportation (MnDOT) determines may be funded by Municipal State-Aid construction funds, the amount determined to be actually funded by MnDOT may be deducted from the total improvement costs to be assessed. C. Infrastructure Reconstruction Projects Any project or portion of a project that reconstructs an existing storm sewer system facility. A reconstruction project may occur in the existing alignment of the storm sewer pipe or on a new alignment, thus allowing the existing line to be abandoned or its status downgraded (i.e., trunk to lateral). All properties with tax exempt status and abutting new street reconstruction, street reconstruction, or bituminous overlay improvements shall be assessed at one hundred percent (100%) of the cost of the improvement. 2004 Assessment Policy – Page 22 Additional Definitions and General Provisions A. Federal, State and County Highways These streets are classified as expressways, freeways, and principal arterials constructed and maintained by the State or County Highway Departments. They will carry large volumes of traffic at peak loading times. B. Minnesota State-Aid (MSA) Streets These are termed collector streets that interconnect other collector streets, State or County highways, or with Minnesota State-Aid streets in the municipality. Municipal State-Aid funds, apportioned from the gasoline tax, are used to help finance the cost of Minnesota State-Aid Street. The design for a Minnesota State-Aid road is dependent on traffic volumes and the urban setting. C. Commercial/Industrial Streets These are streets that generally serve commercial/industrial property. They would typically have a projected traffic volume higher than a residential street. A typical design would be thirty-six feet (36') wide with concrete curb and gutter, and nine (9) tone design in accordance with current MnDOT standards. D. Residential Streets Primarily serve adjoining residents with little or no through traffic. Almost all trips have either an origin or destination on that street. (18.5 miles throughout the City) Street width: Minimum of 28 feet. E. Neighborhood Streets Provide access to residences on that street and provide a route through neighborhood for residents on other streets. A large proportion of trips have neither an origin nor destination on that street. (4.5 miles throughout the City) Street width: Minimum of 30 feet. F. Community Street Provide access to the residences, institutions and businesses on that street, providing a route through the neighborhood or business district for residents of other neighborhoods. (6.0 miles throughout the City) Street width: Case specific, 32 foot minimum. 2004 Assessment Policy – Page 23 G. Special Cases Streets which do not fir into any of the above descriptions and have a very low usage, (1-3 residences); streets which provide secondary access (i.e. alleys); or, streets defined by extreme limitations due to narrow right-of-way, topography, etc. H. Appurtenances 1. Sidewalks The City may require sidewalks or trails on or adjacent to selected streets or in selected subdivisions. 2. Street Lighting The City has a separate plan that indicates where lights are typically installed. Additional street lights or ornamental lights may be installed at the written request of the abutting property owners. 3. Trees Trees and other types of landscaping may be required on selected streets. 4. Seeding/Sod Boulevard restoration by seeding/sodding may be required to prevent erosion. 5. Existing Street Reconstruction Projects Projects that reconstruct existing City streets shall be to the minimum applicable standards for the type of street classification, consistent with the Arden Hills Pavement Management Program (PMP) (as found in the Appendix) 6. Maintenance/Rehabilitation Projects a. Cold in Place Recycling and Repaving (CIR/Repaving) 2004 Assessment Policy – Page 24 Recycling of existing deteriorated pavements by pulverizing, mixing with new asphaltic oils and compacting in place. New paving materials are then placed over the cold recycled pavement similar to a standard overlay. b. Bituminous Overlay Placement of an additional bituminous layer, generally one inch (1") to two inches (2") thick, over an existing bituminous surfaced street. c. Concrete Pavement Restoration Replacement of existing concrete panels that have deteriorated, mudjacking panels to improve rideability, and the filling of joints and cracks with petroleum based material to eliminate flow water to the base below the surface. d. Crack Sealing Placement of petroleum based material in the cracks of a bituminous surfaced street for the purpose of eliminating the flow of water from the surface to the aggregate base material blow. e. Bituminous Seal Coating Placement of petroleum based material and aggregate on an existing bituminous surfaced street for the purpose of filling cracks and covering mild wear. f. Bituminous Surfacing Patching Repair or replacement of existing bituminous surfacing that has deteriorated. \\Earth\Finance\FinanceDirector\APTF\2004Assessment Policy: Revised 9/1/04 2004 Assessment Policy – Page 25 The City of Arden Hills appreciates and acknowledges all the contributions made by the Assessment Policy Task Force in the drafting of this document. The City acknowledges the following individuals who served on the Task Force: Gerald Garski Bill Gillies Jim Holden Andy Holewa Raymond McGraw Charles Stoddard David Grant (Council Liaison) Gregg Larson (Council Liaison) Murtuza Siddiqui, Finance Director (staff liaison) Tom Moore, Operations and Maintenance Director (staff liaison) CITY OF ARDEN HILLS COUNTY OF RAMSEY STATE OF MINNESOTA RESOLUTION NO. 2021-044 A RESOLUTION RECEIVING FEASIBILITY REPORT AND CALLING FOR A PUBLIC HEARING ON IMPROVEMENTS FOR PROPOSED TRAFFIC SIGNAL IMPROVEMENTS AS PART OF THE LEXINGTON AVENUE RECONSTRUCTION PROJECT WHEREAS, pursuant to Resolution 2021-011 of the Council adopted February 22, 2021, a report has been prepared by the City’s Consultant Engineer Alliant Engineering, Inc., dated July 27, 2021 with reference to the Lexington Avenue Reconstruct Project and the proposed traffic signal improvement at the proposed Target Road intersection: WHEREAS, this report was received and reviewed by the Council on August 9, 2021; and WHEREAS, the report provides information regarding whether the proposed project is necessary, cost effective, and feasible; whether it should best be made as proposed or in connection with some other improvement; the estimated cost of the improvement as recommended; and a description of the methodology used to calculate individual assessments for affected parcels. NOW THEREFORE, BE IT RESOLVED BY THE CITY COUNCIL OF ARDEN HILLS MINNESOTA: 1. The Council will consider the improvement of such streets in accordance with the report and the assessment of abutting property for all or a portion of the cost of the improvement pursuant to Minnesota Statutes, Chapter 429. 2. A public hearing shall be held on such proposed improvement on the 23rd day of August, 2021, in the Council Chambers of the City Hall at 7:00 p.m. and the City Administrator shall give mailed and published notice of such hearing and improvement as required by law. ADOPTED BY THE CITY COUNCIL OF THE CITY OF ARDEN HILLS THIS 9th DAY OF AUGUST, 2021. David Grant, Mayor ATTEST: Julie Hanson, City Clerk To view the final document, access adopted Resolutions via Arden Hills Public Laserfiche Weblink by visiting cityofardenhills.org and clicking on Archived Documents under Helpful Links on our main webpage. Page 1 of 2 CONSENT ITEM – 7H MEMORANDUM DATE: August 9, 2021 TO: Honorable Mayor and City Councilmembers Dave Perrault, City Administrator FROM: David Swearingen, Interim Public Works Director SUBJECT: 2021 PMP Street and Utility Improvements – Payment No. 2 Budgeted Amount: Actual Amount: Funding Source: $3,807,000 $3,423,767.10 PIR, Special Assessments Utility Funds Council Should Consider Motions to approve, table, or deny the following: • Payment No. 2 for the 2021 PMP Street and Utility Improvements Project to C&L Excavating in the amount of $828,296.71 All items need a simple majority for action unless otherwise noted. Background/Discussion On April 12, 2021, City Council approved Resolution 2021-021 Awarding the 2021 PMP Street and Utility Improvements construction contract to C&L Excavating, Inc. The project is approximately 45% complete with the watermain and utility services completed along Glenpaul Avenue and Jerrold Avenue. Storm sewer construction is near completion across the project site and concrete curb and gutter has been placed on Glenpaul Avenue. Five percent of payment is being withheld from the work completed in accordance with the contract documents as retainage. Payment No. 2 is in the amount of $828,296.71. Bolton & Menk has provided a recommendation to accept Payment No. 2 (Attachment A). Staff recommends that Council approve Payment No. 2. Page 2 of 2 Budget Impact Total Construction Expenses: Original Contract Amount: $2,704,412.10 Change Order No. 1: $ 4,200.00 Total: $2,708,612.10 Other Expenses: Engineering Design: $ 179,069.00 Construction Mgmt: $ 191,198.00 Gen Admin & Legal: $ 85,000.00 Finance & Interest: $ 60,000.00 Material Testing: $ 34,888.00 Const. Contingency: $ 165,000.00 $ 715,155.00 Attachments Attachment A: Bolton & Menk Letter of Recommendation Attachment B: Pay Request No. 2 H:\ARDH\T13122417\7_Construction\D_Pay Applications\Pay App 2_July 2021\2021-08-03 Pay Application No 2 Recommendation.docx August 3, 2021 Mr. David Swearingen, P.E. City of Arden Hills 1245 W Highway 96 Arden Hills, MN 55112 Re: Pay Application No. 2 2021 PMP Street & Utility Improvements City of Arden Hills, Minnesota BMI Project No. T13.122417 Dear Mr. Swearingen: We are recommending approval of the enclosed Pay Application No. 2 and payment to C&L Excavating, Inc. Please request approval from the Mayor and Council at the August 9th Council Meeting. If approved, please sign the Pay Application, and return a copy to me. I will then forward the signed cop y to C&L Excavating, Inc. for their records. Please call if you have any questions regarding this recommendation or the enclosed pay application. Sincerely, Bolton & Menk, Inc. Nick Amatuccio, P.E. Project Engineer Enclosures 8-3-21 Pay Request No.: 22021 PMP STREET & UTILITY IMPROVEMENTSCITY OF ARDEN HILLSBMI PROJECT NO. T13.122417WORK COMPLETED THROUGH FRIDAY, JULY 30, 2021ITEM UNITESTIMATEDESTIMATEDESTIMATEDESTIMATEDESTIMATEDNO.ITEMPRICEQUANTITYAMOUNTQUANTITYAMOUNTQUANTITYAMOUNT1 MOBILIZATION$133,000.00 1.00 LUMP SUM $133,000.00 0.25 LUMP SUM $33,250.00 0.45 LUMP SUM $59,850.002 LANDSCAPE ALLOWANCE$30,000.00 1.00 LUMP SUM $30,000.00 0.00 LUMP SUM $0.00 0.00 LUMP SUM $0.003 CLEARING$515.00 19.00 TREE $9,785.00 13.00 TREE $6,695.00 13.00 TREE $6,695.004 GRUBBING$515.00 19.00 TREE $9,785.00 13.00 TREE $6,695.00 13.00 TREE $6,695.005 SALVAGE SIGN$45.00 17.00 EACH $765.00 0.00 EACH $0.00 5.00 EACH $225.006 SALVAGE MAIL BOX $47.00 80.00 EACH $3,760.00 50.00 EACH $2,350.00 74.00 EACH$3,478.007 SALVAGE PAVERS$5.00 52.00 SQ FT $260.00 0.00 SQ FT $0.00 0.00 SQ FT $0.008 SALVAGE RETAINING WALL (BLOCK)$7.00 47.00 SQ FT $329.00 0.00 SQ FT $0.00 0.00 SQ FT $0.009 SALVAGE RETAINING WALL (WOOD TIMBER) $10.00 14.00 LIN FT $140.00 0.00 LIN FT $0.00 0.00 LIN FT $0.0010 TREE TRIMMING$1,500.00 1.00 LUMP SUM $1,500.00 0.75 LUMP SUM $1,125.000.75 LUMP SUM $1,125.0011 REMOVE DRAINAGE STRUCTURE$400.00 7.00 EACH $2,800.00 0.00 EACH $0.00 4.00 EACH $1,600.0012 REMOVE SANITARY MANHOLE$400.00 1.00 EACH $400.00 1.00 EACH $400.00 1.00 EACH $400.0013 REMOVE CASTING$200.00 25.00 EACH $5,000.00 8.00 EACH $1,600.00 8.00 EACH $1,600.0014 REMOVE HYDRANT$200.00 11.00 EACH $2,200.00 5.00 EACH $1,000.00 10.00 EACH$2,000.0015 SAWING CONCRETE PAVEMENT (FULL DEPTH) $5.50 524.00 LIN FT $2,882.00 0.00 LIN FT $0.00 284.00 LIN FT $1,562.0016 SAWING BITUMINOUS PAVEMENT (FULL DEPTH) $2.00 1,214.00 LIN FT $2,428.00 0.00 LIN FT $0.00 435.00 LIN FT $870.0017 REMOVE CURB AND GUTTER$6.50 1,166.00 LIN FT $7,579.00 0.00 LIN FT $0.00 568.00 LIN FT $3,692.0018 REMOVE SEWER PIPE (STORM)$10.00 245.00 LIN FT $2,450.00 65.00 LIN FT $650.00 178.00LIN FT $1,780.0019 REMOVE WATERMAIN$1.00 2,721.00 LIN FT $2,721.00 1,763.50 LIN FT $1,763.502,659.50 LIN FT $2,659.5020 ABANDON WATER MAIN$3.00 1,305.00 LIN FT $3,915.00 0.00 LIN FT $0.00 45.00 LIN FT $135.0021 REMOVE CONCRETE DRIVEWAY PAVEMENT $3.75 979.00 SQ YD$3,671.25 0.00 SQ YD $0.00 564.10 SQ YD $2,115.3822 REMOVE BITUMINOUS DRIVEWAY PAVEMENT $4.75 1,260.00 SQ YD $5,985.00 0.00 SQ YD $0.00 774.70 SQ YD $3,679.8323 REMOVE CONCRETE WALK$12.50 106.00 SQ YD $1,325.00 0.00 SQ YD $0.00 0.00 SQ YD $0.0024 REMOVE BITUMINOUS WALK$1.75 2,021.00 SQ FT $3,536.75 0.00 SQ FT $0.00 564.50 SQ FT $987.8825 EXPLORATORY EXCAVATION$850.00 32.00 HOUR $27,200.00 0.00 HOUR $0.00 5.50 HOUR $4,675.0026COMMON EXCAVATION (EV) (P) $19.00 13,403.00 CU YD $254,657.00 2,016.00 CU YD $38,304.00 9,386.00 CU YD $178,334.0027 SUBGRADE EXCAVATION (EV)$9.50 648.00 CU YD $6,156.00 0.00 CU YD $0.00 74.20 CU YD $704.9028 STABILIZING AGGREGATE$5.00 648.00 CU YD $3,240.00 0.00 CU YD $0.00 74.20 CU YD $371.0029 SELECT GRANULAR BORROW (CV) $26.75 6,050.00 CU YD $161,837.50 0.00 CU YD $0.00 2,728.90 CU YD $72,998.0830 GEOTEXTILE FABRIC TYPE V$2.10 19,833.00 SQ YD $41,649.30 0.00 SQ YD $0.00 8,299.70SQ YD $17,429.3731 SUBGRADE PREPARATION$2.75 8,200.00 SQ YD $22,550.00 0.00 SQ YD $0.00 0.00 SQ YD$0.0032 AGGREGATE BASE CLASS 5$15.75 7,568.00 TON $119,196.00 0.00 TON $0.00 2,663.90 TON$41,956.4333 AGGREGATE SURFACING CLASS 2$80.00 15.00 TON $1,200.00 0.00 TON $0.00 0.00 TON $0.0034 FULL DEPTH RECLAMATION$1.55 24,539.00 SQ YD $38,035.45 7,640.00 SQ YD $11,842.00 16,739.00 SQ YD $25,945.4535 BITUMINOUS MATERIAL FOR TACK COAT$3.30 1,630.00 GAL $5,379.00 0.00 GAL $0.00 0.00 GAL $0.0036 TYPE SPWEA240C WEARING COURSE MIXTURE $69.00 2,946.00 TON $203,274.00 0.00 TON $0.00 0.00 TON $0.0037 TYPE SPNWB230C NON WEARING COURSE MIXTURE $66.00 2,946.00 TON $194,436.00 0.00 TON $0.00 0.00 TON $0.0038 3" BITUMINOUS DRIVEWAY PAVEMENT$33.00 746.00 SQ YD $24,618.00 0.00 SQ YD $0.00 0.00 SQ YD $0.0039 MANHOLE REHABILITATION$750.00 9.00 LIN FT $6,750.00 0.00 LIN FT $0.00 9.00 LIN FT$6,750.0040 LINING SEWER PIPE 8"$37.00 197.00 LIN FT $7,289.00 0.00 LIN FT $0.00 0.00 LIN FT $0.0041 LINING SEWER PIPE 18"$62.50 218.00 LIN FT $13,625.00 0.00 LIN FT $0.00 0.00 LIN FT $0.0042 LINING SEWER PIPE 21"$80.00 1,107.00 LIN FT $88,560.00 0.00 LIN FT $0.00 0.00 LIN FT $0.0043 TRIM PROTRUDING TAP$500.00 1.00 EACH $500.00 0.00 EACH $0.00 1.00 EACH $500.0044 CIPP SHORT LINER$3,300.00 2.00 EACH $6,600.00 0.00 EACH $0.00 0.00 EACH $0.0045 SEWER PIPE LATERAL GROUTING$340.00 16.00 EACH $5,440.00 0.00 EACH $0.00 0.00 EACH $0.0046 6" PVC PIPE SEWER$30.00 218.00 LIN FT $6,540.00 37.00 LIN FT $1,110.00 202.50 LIN FT $6,075.0047 8" PVC PIPE SEWER$65.00 48.00 LIN FT $3,120.00 22.00 LIN FT $1,430.00 37.50LIN FT $2,437.5048 8"X6" PVC WYE$400.00 8.00 EACH $3,200.00 1.00 EACH $400.00 5.00 EACH $2,000.0049 RECONNECT SANITARY SEWER SERVICE $200.00 8.00 EACH $1,600.00 5.00 EACH $1,000.00 24.00 EACH $4,800.0050 CONNECT TO EXISTING SANITARY SEWER $875.00 19.00 EACH $16,625.00 5.00 EACH $4,375.00 13.00 EACH $11,375.00ESTIMATEDAS BID PREVIOUS ESTIMATE COMPLETED TO DATEH:\ARDH\T13122417\7_Construction\D_Pay Applications\Pay App 2_July 2021\T13.122417 Pay Application No 2.xlsmPage 2 of 48/3/20217:55 AM Pay Request No.: 22021 PMP STREET & UTILITY IMPROVEMENTSCITY OF ARDEN HILLSBMI PROJECT NO. T13.122417WORK COMPLETED THROUGH FRIDAY, JULY 30, 2021ITEM UNITESTIMATEDESTIMATEDESTIMATEDESTIMATEDESTIMATEDNO.ITEMPRICEQUANTITYAMOUNTQUANTITYAMOUNTQUANTITYAMOUNTESTIMATEDAS BID PREVIOUS ESTIMATE COMPLETED TO DATE51 CONNECT TO EXISTING FORCEMAIN$1,150.00 1.00 EACH $1,150.00 0.00 EACH $0.00 1.00 EACH $1,150.0052 CONNECT TO EXISTING MANHOLES (SAN) $1,000.00 1.00 EACH $1,000.00 0.00 EACH $0.00 1.00 EACH $1,000.0053 SANITARY MANHOLE$425.00 11.30 LIN FT $4,802.50 11.30 LIN FT $4,802.50 11.30 LIN FT $4,802.50546" SANITARY SEWER FORCEMAIN (PIPE BURST) - 6 INCH - HDPE DR 11 DIPS$65.00 870.00 LIN FT $56,550.00 0.00 LIN FT $0.00 945.00 LIN FT $61,425.0055 ACCESS PIT EXCAVATION W/ RECONNECTION $2,500.00 3.00 EACH $7,500.00 0.00 EACH $0.00 3.00 EACH $7,500.0056 6" SANITARY SEWER FORCEMAIN (OPEN CUT) - 6 INCH - DIP $64.00 67.00 LIN FT $4,288.00 0.00 LIN FT $0.00 20.00 LIN FT $1,280.0057 TELEVISE SANITARY SEWER FORCEMAIN $4.00 937.00 LIN FT $3,748.00 0.00 LIN FT $0.00 0.00 LIN FT $0.0058 TEMPORARY CONVEYANCE FOR FORCEMAIN $25,000.00 1.00 LUMP SUM $25,000.00 0.00 LUMP SUM $0.00 1.00 LUMP SUM $25,000.0059 PUBLIC/PRIVATE UTILITY DOCUMENTATION FOR PIPE BURSTING $7,500.00 1.00 LUMP SUM $7,500.00 0.00 LUMP SUM $0.00 1.00 LUMP SUM $7,500.0060 TEMPORARY WATER SERVICE$250.00 79.00 EACH $19,750.00 58.00 EACH $14,500.00 82.00 EACH $20,500.0061 HYDRANT$4,400.00 11.00 EACH $48,400.00 5.00 EACH $22,000.00 10.00EACH $44,000.0062 6" GATE VALVE & BOX$1,500.00 13.00 EACH $19,500.00 5.00 EACH $7,500.00 10.00 EACH $15,000.0063 8" GATE VALVE & BOX$2,000.00 9.00 EACH $18,000.00 6.00 EACH $12,000.00 10.00 EACH $20,000.0064 CONNECT TO EXISTING WATER SERVICE $50.00 79.00 EACH $3,950.00 26.00 EACH $1,300.00 80.00 EACH $4,000.0065 ADJUST VALVE BOX$300.00 2.00 EACH $600.00 0.00 EACH $0.00 0.00 EACH $0.0066 CONNECT TO EXISTING WATERMAIN$1,200.00 8.00 EACH $9,600.00 4.00 EACH $4,800.00 6.00 EACH$7,200.0067 6" WATERMAIN DUCTILE IRON CL 52$40.00 222.00 LIN FT $8,880.00 69.50 LIN FT $2,780.00 152.50 LIN FT $6,100.0068 8" WATERMAIN DUCTILE IRON CL 52$48.00 3,518.00 LIN FT $168,864.00 1,784.00 LIN FT $85,632.00 3,494.00 LIN FT $167,712.0069 12" WATERMAIN DUCTILE IRON CL 52$185.00 6.00 LIN FT $1,110.00 32.00 LIN FT $5,920.00 32.00LIN FT $5,920.0070 WATERMAIN FITTINGS$7.00 1,802.00 POUND $12,614.00 952.00 POUND $6,664.00 1,844.00 POUND $12,908.0071 1" CURB STOP & BOX$385.00 79.00 EACH $30,415.00 26.00 EACH $10,010.00 79.00 EACH $30,415.0072 1" CORPORATION STOP$270.00 79.00 EACH $21,330.00 26.00 EACH $7,020.00 80.00 EACH $21,600.0073 FORD TYPE A-1 CURB BOX COVER$125.00 7.00 EACH $875.00 0.00 EACH $0.00 0.00 EACH $0.0074 1" TYPE K COPPER PIPE$24.00 2,700.00 LIN FT $64,800.00 944.50 LIN FT $22,668.00 2,730.00 LIN FT $65,520.0075 2" POLYSTYRENE INSULATION$26.00 152.00 SQ YD $3,952.00 32.00 SQ YD $832.00 42.70 SQ YD $1,110.2076 ADJUST FRAME AND RING CASTING (STORM) $450.00 8.00 EACH $3,600.00 0.00 EACH $0.00 0.00 EACH $0.0077 LOWER EXISTING MANHOLE (SANITARY) $1,000.00 1.00 EACH $1,000.00 0.00 EACH $0.00 0.00 EACH $0.0078 CASTING ASSEMBLY TYPE R-1733$900.00 29.00 EACH $26,100.00 0.00 EACH $0.00 0.00 EACH $0.0079 CASTING ASSEMBLY TYPE R-3067-V$900.00 23.00 EACH $20,700.00 0.00 EACH $0.00 0.00 EACH $0.0080 CASTING ASSEMBLY TYPE R-4342$750.00 2.00 EACH $1,500.00 0.00 EACH $0.00 0.00 EACH $0.0081 12" RC PIPE SEWER$65.00 8.00 LIN FT $520.00 0.00 LIN FT $0.00 8.00 LIN FT $520.0082 15" RC PIPE SEWER$45.00 1,826.00 LIN FT $82,170.00 0.00 LIN FT $0.00 696.00LIN FT $31,320.0083 18" RC PIPE SEWER$47.00 929.00 LIN FT $43,663.00 0.00 LIN FT $0.00 929.00 LIN FT $43,663.0084 CONNECT TO EXISTING STORM SEWER $800.00 3.00 EACH $2,400.00 0.00 EACH $0.00 1.00 EACH $800.0085 CONNECT INTO EXISTING DRAINAGE STRUCTURE $1,000.001.00 EACH $1,000.00 0.00 EACH $0.00 1.00 EACH $1,000.0086 CONSTRUCT DRAINAGE STRUCTURE DESIGN 48-4020 $2,000.00 1.00 EACH $2,000.00 0.00 EACH $0.00 0.00 EACH $0.0087 CONSTRUCT DRAINAGE STRUCTURE DESIGN 48-4022 $2,200.00 5.00 EACH $11,000.00 0.00 EACH $0.00 5.00 EACH $11,000.0088 CONSTRUCT DRAINAGE STRUCTURE DESIGN 60-4020 $4,200.00 2.00 EACH $8,400.00 0.00 EACH $0.00 1.00 EACH $4,200.0089 CONSTRUCT CATCH BASIN - DESIGN R-1, 2'X3' $1,700.00 18.00 EACH $30,600.00 0.00 EACH $0.00 8.00 EACH $13,600.0090 CONSTRUCT DRAINAGE STRUCTURE - DESIGN H $1,400.00 1.00 EACH $1,400.00 0.00 EACH $0.00 1.00 EACH $1,400.0091 CONSTRUCT DRAINAGE STRUCTURE - DESIGN G $2,000.00 1.00 EACH $2,000.00 0.00 EACH $0.00 1.00 EACH $2,000.0092 6" PERF PVC PIPE DRAIN$8.50 1,472.00 LIN FT $12,512.00 0.00 LIN FT $0.00 572.00 LIN FT $4,862.0093 6" PVC PIPE DRAIN CLEANOUT$125.00 30.00 EACH $3,750.00 0.00 EACH $0.00 12.00 EACH $1,500.0094 RANDOM RIP RAP CLASS 3$85.00 15.00 CU YD $1,275.00 0.00 CU YD $0.00 0.00 CU YD $0.0095 4" CONCRETE WALK$14.00 111.00 SQ FT $1,554.00 0.00 SQ FT $0.00 0.00 SQ FT $0.0096 6" CONCRETE WALK (PEDESTRIAN RAMP) $16.50 541.00 SQ FT $8,926.50 0.00 SQ FT $0.00 0.00 SQ FT $0.0097 3" BITUMINOUS WALK$5.50 1,432.00 SQ FT $7,876.00 0.00 SQ FT $0.00 0.00 SQ FT $0.0098 REINSTALL PAVERS$16.00 47.00 SQ FT $752.00 0.00 SQ FT $0.00 0.00 SQ FT $0.0099 REINSTALL RETAINING WALL (BLOCK)$10.00 47.00 SQ FT $470.00 0.00 SQ FT $0.00 0.00 SQ FT $0.00100 REINSTALL RETAINING WALL (WOOD TIMBER) $28.00 14.00 LIN FT $392.00 0.00 LIN FT $0.00 0.00 LIN FT $0.00101 CONCRETE CURB & GUTTER DESIGN B618 $14.75 9,525.00LIN FT $140,493.75 0.00 LIN FT $0.00 4,431.00 LIN FT $65,357.25H:\ARDH\T13122417\7_Construction\D_Pay Applications\Pay App 2_July 2021\T13.122417 Pay Application No 2.xlsmPage 3 of 48/3/20217:55 AM Pay Request No.: 22021 PMP STREET & UTILITY IMPROVEMENTSCITY OF ARDEN HILLSBMI PROJECT NO. T13.122417WORK COMPLETED THROUGH FRIDAY, JULY 30, 2021ITEM UNITESTIMATEDESTIMATEDESTIMATEDESTIMATEDESTIMATEDNO.ITEMPRICEQUANTITYAMOUNTQUANTITYAMOUNTQUANTITYAMOUNTESTIMATEDAS BID PREVIOUS ESTIMATE COMPLETED TO DATE102 CONCRETE CURB & GUTTER DESIGN SURMOUNTABLE $30.0030.00 LIN FT $900.00 0.00 LIN FT $0.00 0.00 LIN FT $0.00103 CONCRETE CURB & GUTTER (SPOT REPLACEMENT) $26.00 946.00 LIN FT $24,596.00 0.00 LIN FT $0.00 0.00 LIN FT $0.00104 6" CONCRETE DRIVEWAY PAVEMENT$59.00 1,270.00 SQ YD $74,930.00 0.00 SQ YD $0.00 0.00 SQ YD $0.00105 TRUNCATED DOMES$52.00 84.00 SQ FT $4,368.00 0.00 SQ FT $0.00 0.00 SQ FT $0.00106 TRAFFIC CONTROL $4,500.00 1.00 LUMP SUM $4,500.00 0.25 LUMP SUM $1,125.000.45 LUMP SUM $2,025.00107 INSTALL SIGN$150.00 17.00 EACH $2,550.00 0.00 EACH $0.00 0.00 EACH $0.00108 SIGN POST$50.00 2.00 EACH $100.00 0.00 EACH $0.00 0.00 EACH $0.00109 SIGN PANEL TYPE C$33.00 12.00 SQ FT $396.00 0.00 SQ FT $0.00 0.00 SQ FT $0.00110 STORM DRAIN INLET PROTECTION$125.00 40.00 EACH $5,000.00 2.00 EACH $250.00 13.00 EACH $1,625.00111 ROCK CONSTRUCTION ENTRANCE$750.00 5.00 EACH $3,750.00 1.00 EACH $750.00 1.00 EACH $750.00112 SEDIMENT CONTROL LOG TYPE WOOD FIBER $4.00 600.00 LIN FT $2,400.00 0.00 LIN FT $0.00 0.00 LIN FT $0.00113 INSTALL MAIL BOX $57.00 80.00 EACH $4,560.00 0.00 EACH $0.00 0.00 EACH $0.00114 TEMPORARY MAIL BOX$42.00 85.00 EACH $3,570.00 58.00 EACH $2,436.00 82.00 EACH$3,444.00115 DECIDUOUS TREE - 2-INCH DIAMETER B&B $575.00 18.00EACH $10,350.00 0.00 EACH $0.00 0.00 EACH $0.00116 HYDROMULCH TYPE 7 & SEED MIX 25-151 $3.00 400.00 SQ YD $1,200.00 0.00 SQ YD $0.00 0.00 SQ YD $0.00117 SODDING TYPE LAWN$6.60 8,411.00 SQ YD $55,512.60 0.00 SQ YD $0.00 0.00 SQ YD$0.00118 SHREDDED WOOD MULCH$65.00 10.00 CU YD $650.00 0.00 CU YD $0.00 0.00 CU YD $0.00119 COMMON TOPSOIL BORROW (LV)$27.50 1,623.00 CU YD $44,632.50 0.00 CU YD $0.00 24.00 CU YD $660.00120 CROSSWALK MARKING - MULTI-COMPONENT LIQUID $8.00 90.00 SQ FT $720.00 0.00 SQ FT $0.00 0.00 SQ FT $0.00121 CHANGE ORDER 1 - 12" GATE VALVE & BOX $4,200.00 1.00 EACH $4,200.00 1.00 EACH $4,200.00 1.00 EACH $4,200.00FINALTOTAL AMOUNT:$2,708,612.10 $331,179.00 $1,203,070.27H:\ARDH\T13122417\7_Construction\D_Pay Applications\Pay App 2_July 2021\T13.122417 Pay Application No 2.xlsmPage 4 of 48/3/20217:55 AM