Loading...
HomeMy WebLinkAbout08-23-21-RAPPROVAL OF AGENDA PUBLIC INQUIRIES/INFORMATIONAL This is an opportunity for citizens to bring to the Council ’s attention any items not currently on the agenda which are relevant to the City. In addressing the Council, you must first state your name and address for the record. To allow adequate time for each person wishing to address the Council, speakers must limit their comments to three (3) minutes. Written documents may be distributed to the Council prior to the meeting to allow a more timely presentation. Speakers should not use obscene, profane, or threatening language, or make personal attacks. Matters of litigation involving the City shall not be discussed during Public Inquiry by citizens or Council. The Council may not respond to speaker comments, engage in a debate, or take any action on the issues raised by citizens, but may direct City staff to research or follow up on an issue, if desired by Council. If Council directs further review by staff, the results of that review will be presented at a following regular Council meeting. RESPONSE TO PUBLIC INQUIRIES Public Inquiry Response From August 9, 2021 City Council Meeting Gayle Bauman, Finance Director MEMO.PDF STAFF COMMENTS Transportation Update David Swearingen, Interim Public Works Director MEMO.PDF APPROVAL OF MINUTES July 19, 2021 City Council Work Session 07 -19 -21 -WS.PDF July 26, 2021 Special City Council Work Session 07 -26 -21 -SWS.PDF July 26, 2021 Regular City Council 07 -26 -21 -R.PDF CONSENT CALENDAR Those items listed under the Consent Calendar are considered to be routine by the City Council and will be enacted by one motion under a Consent Calendar format. There will be no separate discussion of these items, unless a Councilmember so requests, in which event, the item will be removed from the general order of business and considered separately in its normal sequence on the agenda. Motion To Approve Claims And Payroll Gayle Bauman, Finance Director Pang Silseth, Accounting Analyst MEMO.PDF Motion To Approve Resolution 2021 -045 Accepting A Donation From The Arden Hills Foundation Joe Vaughan, Recreation Programmer MEMO.PDF ATTACHMENT A.PDF Motion To Approve Appointment Of Building Inspector Dave Perrault, City Administrator MEMO.PDF Motion To Accept Resignation Of Communications Coordinator Dave Perrault, City Administrator MEMO.PDF Motion To Approve Recruiting Communications Coordinator Dave Perrault, City Administrator MEMO.PDF ATTACHMENT A.PDF PULLED CONSENT ITEMS Those items that are pulled from the Consent Calendar will be removed from the general order of business and considered separately in its normal sequence on the agenda. PUBLIC HEARINGS Arden Oaks Street Improvements Project Larry Poppler, TKDA David Swearingen, Interim Public Works Director MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF Lexington Avenue And Target Road Traffic Signal System Improvements David Swearingen, Interim Public Works Director MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF ATTACHMENT C.PDF Planning Case 21 -017 –Planned Unit Development Amendment -Mounds View Public Schools Jessica Jagoe, Senior Planner MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF ATTACHMENT C.PDF ATTACHMENT D.PDF ATTACHMENT E.PDF ATTACHMENT F.PDF ATTACHMENT G.PDF ATTACHMENT H.PDF Planning Case 21 -018 –Ordinance Amendment Chapter 13, Zoning Code, Section 1330.02, Subd. 1, Classification Of Lakes Jessica Jagoe, Senior Planner MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF ATTACHMENT C.PDF ATTACHMENT D.PDF ATTACHMENT E.PDF ATTACHMENT F.PDF ATTACHMENT G.PDF Planning Case 21 -016 –Site Plan Review –3900 Bethel Drive –Bolton & Menk On Behalf Of Bethel University Jessica Jagoe, Senior Planner MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF ATTACHMENT C.PDF ATTACHMENT D.PDF ATTACHMENT E.PDF ATTACHMENT F.PDF ATTACHMENT G.PDF ATTACHMENT H.PDF ATTACHMENT I.PDF ATTACHMENT J.PDF ATTACHMENT K.PDF NEW BUSINESS Resolution 2021 -046 Ordering Improvements And Preparation Of Plans And Specifications –Arden Oaks Street Improvements Project David Swearingen, Interim Public Works Director MEMO.PDF ATTACHMENT A.PDF Resolution 2021 -047 Ordering Improvements And Preparation Of Plans And Specifications –Lexington Avenue And Target Road Traffic Signal System Improvements David Swearingen, Interim Public Works Director MEMO.PDF ATTACHMENT A.PDF Planning Case 21 -017 –Planned Unit Development Amendment -Mounds View Public Schools Jessica Jagoe, Senior Planner MEMO.PDF ATTACHMENT A.PDF Planning Case 21 -018 –Ordinance 2021 -007 Amending Chapter 13, Zoning Code, Section 1330.02, Subd. 1, Classification Of Lakes And Authorizing Publication Of Ordinance Jessica Jagoe, Senior Planner MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF ATTACHMENT C.PDF Planning Case 21 -016 –Resolution 2021 -048 –Site Plan Review –3900 Bethel Drive –Bolton & Menk On Behalf Of Bethel University Jessica Jagoe, Senior Planner MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF UNFINISHED BUSINESS COUNCIL/STAFF COMMENTS ADJOURN Mayor: David Grant Councilmembers: Brenda Holden Fran Holmes Dave McClung Steve Scott Regular City Council Agenda August 23, 2021 7:00 p.m. City Hall Address: 1245 W Highway 96 Arden Hills MN 55112 Phone: 651 -792 -7800 Website : www.cityofardenhills.org City Vision Arden Hills is a strong community that values its unique environmental setting, strong residential neighborhoods, vital business community, well -maintained infrastructure, fiscal soundness, and our long -standing tradition as a desirable City in which to live, work, and play. This meeting will be streamed live on local Cable Channel 16 and available for playback on our website. CALL TO ORDER 1. 2. 3. 3.A. Documents: 4. 4.A. Documents: 5. 5.A. Documents: 5.B. Documents: 5.C. Documents: 6. 6.A. Documents: 6.B. Documents: 6.C. Documents: 6.D. Documents: 6.E. Documents: 7. 8. 8.A. Documents: 8.B. Documents: 8.C. Documents: 8.D. Documents: 8.E. Documents: 9. 9.A. Documents: 9.B. Documents: 9.C. Documents: 9.D. Documents: 9.E. Documents: 10. 11. APPROVAL OF AGENDAPUBLIC INQUIRIES/INFORMATIONALThis is an opportunity for citizens to bring to the Council ’s attention any items not currently on the agenda which are relevant to the City. In addressing the Council, you must first state your name and address for the record. To allow adequate time for each person wishing to address the Council, speakers must limit their comments to three (3) minutes. Written documents may be distributed to the Council prior to the meeting to allow a more timely presentation. Speakers should not use obscene, profane, or threatening language, or make personal attacks. Matters of litigation involving the City shall not be discussed during Public Inquiry by citizens or Council. The Council may not respond to speaker comments, engage in a debate, or take any action on the issues raised by citizens, but may direct City staff to research or follow up on an issue, if desired by Council. If Council directs further review by staff, the results of that review will be presented at a following regular Council meeting.RESPONSE TO PUBLIC INQUIRIESPublic Inquiry Response From August 9, 2021 City Council MeetingGayle Bauman, Finance DirectorMEMO.PDFSTAFF COMMENTS Transportation Update David Swearingen, Interim Public Works Director MEMO.PDF APPROVAL OF MINUTES July 19, 2021 City Council Work Session 07 -19 -21 -WS.PDF July 26, 2021 Special City Council Work Session 07 -26 -21 -SWS.PDF July 26, 2021 Regular City Council 07 -26 -21 -R.PDF CONSENT CALENDAR Those items listed under the Consent Calendar are considered to be routine by the City Council and will be enacted by one motion under a Consent Calendar format. There will be no separate discussion of these items, unless a Councilmember so requests, in which event, the item will be removed from the general order of business and considered separately in its normal sequence on the agenda. Motion To Approve Claims And Payroll Gayle Bauman, Finance Director Pang Silseth, Accounting Analyst MEMO.PDF Motion To Approve Resolution 2021 -045 Accepting A Donation From The Arden Hills Foundation Joe Vaughan, Recreation Programmer MEMO.PDF ATTACHMENT A.PDF Motion To Approve Appointment Of Building Inspector Dave Perrault, City Administrator MEMO.PDF Motion To Accept Resignation Of Communications Coordinator Dave Perrault, City Administrator MEMO.PDF Motion To Approve Recruiting Communications Coordinator Dave Perrault, City Administrator MEMO.PDF ATTACHMENT A.PDF PULLED CONSENT ITEMS Those items that are pulled from the Consent Calendar will be removed from the general order of business and considered separately in its normal sequence on the agenda. PUBLIC HEARINGS Arden Oaks Street Improvements Project Larry Poppler, TKDA David Swearingen, Interim Public Works Director MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF Lexington Avenue And Target Road Traffic Signal System Improvements David Swearingen, Interim Public Works Director MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF ATTACHMENT C.PDF Planning Case 21 -017 –Planned Unit Development Amendment -Mounds View Public Schools Jessica Jagoe, Senior Planner MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF ATTACHMENT C.PDF ATTACHMENT D.PDF ATTACHMENT E.PDF ATTACHMENT F.PDF ATTACHMENT G.PDF ATTACHMENT H.PDF Planning Case 21 -018 –Ordinance Amendment Chapter 13, Zoning Code, Section 1330.02, Subd. 1, Classification Of Lakes Jessica Jagoe, Senior Planner MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF ATTACHMENT C.PDF ATTACHMENT D.PDF ATTACHMENT E.PDF ATTACHMENT F.PDF ATTACHMENT G.PDF Planning Case 21 -016 –Site Plan Review –3900 Bethel Drive –Bolton & Menk On Behalf Of Bethel University Jessica Jagoe, Senior Planner MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF ATTACHMENT C.PDF ATTACHMENT D.PDF ATTACHMENT E.PDF ATTACHMENT F.PDF ATTACHMENT G.PDF ATTACHMENT H.PDF ATTACHMENT I.PDF ATTACHMENT J.PDF ATTACHMENT K.PDF NEW BUSINESS Resolution 2021 -046 Ordering Improvements And Preparation Of Plans And Specifications –Arden Oaks Street Improvements Project David Swearingen, Interim Public Works Director MEMO.PDF ATTACHMENT A.PDF Resolution 2021 -047 Ordering Improvements And Preparation Of Plans And Specifications –Lexington Avenue And Target Road Traffic Signal System Improvements David Swearingen, Interim Public Works Director MEMO.PDF ATTACHMENT A.PDF Planning Case 21 -017 –Planned Unit Development Amendment -Mounds View Public Schools Jessica Jagoe, Senior Planner MEMO.PDF ATTACHMENT A.PDF Planning Case 21 -018 –Ordinance 2021 -007 Amending Chapter 13, Zoning Code, Section 1330.02, Subd. 1, Classification Of Lakes And Authorizing Publication Of Ordinance Jessica Jagoe, Senior Planner MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF ATTACHMENT C.PDF Planning Case 21 -016 –Resolution 2021 -048 –Site Plan Review –3900 Bethel Drive –Bolton & Menk On Behalf Of Bethel University Jessica Jagoe, Senior Planner MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF UNFINISHED BUSINESS COUNCIL/STAFF COMMENTS ADJOURN Mayor:David GrantCouncilmembers:Brenda HoldenFran HolmesDave McClungSteve Scott Regular City Council AgendaAugust 23, 2021 7:00 p.m. City Hall Address:1245 W Highway 96Arden Hills MN 55112Phone:651 -792 -7800Website:www.cityofardenhills.orgCity VisionArden Hills is a strong community that values its unique environmental setting, strong residential neighborhoods, vital business community, well -maintained infrastructure, fiscal soundness, and our long -standing tradition as a desirable City in which to live, work, and play.This meeting will be streamed live on local Cable Channel 16 and available for playback on our website.CALL TO ORDER1.2.3.3.A.Documents:4. 4.A. Documents: 5. 5.A. Documents: 5.B. Documents: 5.C. Documents: 6. 6.A. Documents: 6.B. Documents: 6.C. Documents: 6.D. Documents: 6.E. Documents: 7. 8. 8.A. Documents: 8.B. Documents: 8.C. Documents: 8.D. Documents: 8.E. Documents: 9. 9.A. Documents: 9.B. Documents: 9.C. Documents: 9.D. Documents: 9.E. Documents: 10. 11. APPROVAL OF AGENDAPUBLIC INQUIRIES/INFORMATIONALThis is an opportunity for citizens to bring to the Council ’s attention any items not currently on the agenda which are relevant to the City. In addressing the Council, you must first state your name and address for the record. To allow adequate time for each person wishing to address the Council, speakers must limit their comments to three (3) minutes. Written documents may be distributed to the Council prior to the meeting to allow a more timely presentation. Speakers should not use obscene, profane, or threatening language, or make personal attacks. Matters of litigation involving the City shall not be discussed during Public Inquiry by citizens or Council. The Council may not respond to speaker comments, engage in a debate, or take any action on the issues raised by citizens, but may direct City staff to research or follow up on an issue, if desired by Council. If Council directs further review by staff, the results of that review will be presented at a following regular Council meeting.RESPONSE TO PUBLIC INQUIRIESPublic Inquiry Response From August 9, 2021 City Council MeetingGayle Bauman, Finance DirectorMEMO.PDFSTAFF COMMENTSTransportation UpdateDavid Swearingen, Interim Public Works DirectorMEMO.PDFAPPROVAL OF MINUTESJuly 19, 2021 City Council Work Session07-19 -21 -WS.PDFJuly 26, 2021 Special City Council Work Session07-26 -21 -SWS.PDFJuly 26, 2021 Regular City Council07-26 -21 -R.PDFCONSENT CALENDARThose items listed under the Consent Calendar are considered to be routine by the City Council and will be enacted by one motion under a Consent Calendar format. There will be no separate discussion of these items, unless a Councilmember so requests, in which event, the item will be removed from the general order of business and considered separately in its normal sequence on the agenda.Motion To Approve Claims And PayrollGayle Bauman, Finance DirectorPang Silseth, Accounting AnalystMEMO.PDFMotion To Approve Resolution 2021 -045 Accepting A Donation From The Arden Hills FoundationJoe Vaughan, Recreation Programmer MEMO.PDF ATTACHMENT A.PDF Motion To Approve Appointment Of Building Inspector Dave Perrault, City Administrator MEMO.PDF Motion To Accept Resignation Of Communications Coordinator Dave Perrault, City Administrator MEMO.PDF Motion To Approve Recruiting Communications Coordinator Dave Perrault, City Administrator MEMO.PDF ATTACHMENT A.PDF PULLED CONSENT ITEMS Those items that are pulled from the Consent Calendar will be removed from the general order of business and considered separately in its normal sequence on the agenda. PUBLIC HEARINGS Arden Oaks Street Improvements Project Larry Poppler, TKDA David Swearingen, Interim Public Works Director MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF Lexington Avenue And Target Road Traffic Signal System Improvements David Swearingen, Interim Public Works Director MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF ATTACHMENT C.PDF Planning Case 21 -017 –Planned Unit Development Amendment -Mounds View Public Schools Jessica Jagoe, Senior Planner MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF ATTACHMENT C.PDF ATTACHMENT D.PDF ATTACHMENT E.PDF ATTACHMENT F.PDF ATTACHMENT G.PDF ATTACHMENT H.PDF Planning Case 21 -018 –Ordinance Amendment Chapter 13, Zoning Code, Section 1330.02, Subd. 1, Classification Of Lakes Jessica Jagoe, Senior Planner MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF ATTACHMENT C.PDF ATTACHMENT D.PDF ATTACHMENT E.PDF ATTACHMENT F.PDF ATTACHMENT G.PDF Planning Case 21 -016 –Site Plan Review –3900 Bethel Drive –Bolton & Menk On Behalf Of Bethel University Jessica Jagoe, Senior Planner MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF ATTACHMENT C.PDF ATTACHMENT D.PDF ATTACHMENT E.PDF ATTACHMENT F.PDF ATTACHMENT G.PDF ATTACHMENT H.PDF ATTACHMENT I.PDF ATTACHMENT J.PDF ATTACHMENT K.PDF NEW BUSINESS Resolution 2021 -046 Ordering Improvements And Preparation Of Plans And Specifications –Arden Oaks Street Improvements Project David Swearingen, Interim Public Works Director MEMO.PDF ATTACHMENT A.PDF Resolution 2021 -047 Ordering Improvements And Preparation Of Plans And Specifications –Lexington Avenue And Target Road Traffic Signal System Improvements David Swearingen, Interim Public Works Director MEMO.PDF ATTACHMENT A.PDF Planning Case 21 -017 –Planned Unit Development Amendment -Mounds View Public Schools Jessica Jagoe, Senior Planner MEMO.PDF ATTACHMENT A.PDF Planning Case 21 -018 –Ordinance 2021 -007 Amending Chapter 13, Zoning Code, Section 1330.02, Subd. 1, Classification Of Lakes And Authorizing Publication Of Ordinance Jessica Jagoe, Senior Planner MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF ATTACHMENT C.PDF Planning Case 21 -016 –Resolution 2021 -048 –Site Plan Review –3900 Bethel Drive –Bolton & Menk On Behalf Of Bethel University Jessica Jagoe, Senior Planner MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF UNFINISHED BUSINESS COUNCIL/STAFF COMMENTS ADJOURN Mayor:David GrantCouncilmembers:Brenda HoldenFran HolmesDave McClungSteve Scott Regular City Council AgendaAugust 23, 2021 7:00 p.m. City Hall Address:1245 W Highway 96Arden Hills MN 55112Phone:651 -792 -7800Website:www.cityofardenhills.orgCity VisionArden Hills is a strong community that values its unique environmental setting, strong residential neighborhoods, vital business community, well -maintained infrastructure, fiscal soundness, and our long -standing tradition as a desirable City in which to live, work, and play.This meeting will be streamed live on local Cable Channel 16 and available for playback on our website.CALL TO ORDER1.2.3.3.A.Documents:4.4.A.Documents:5.5.A.Documents:5.B.Documents:5.C.Documents:6.6.A.Documents:6.B.Documents: 6.C. Documents: 6.D. Documents: 6.E. Documents: 7. 8. 8.A. Documents: 8.B. Documents: 8.C. Documents: 8.D. Documents: 8.E. Documents: 9. 9.A. Documents: 9.B. Documents: 9.C. Documents: 9.D. Documents: 9.E. Documents: 10. 11. APPROVAL OF AGENDAPUBLIC INQUIRIES/INFORMATIONALThis is an opportunity for citizens to bring to the Council ’s attention any items not currently on the agenda which are relevant to the City. In addressing the Council, you must first state your name and address for the record. To allow adequate time for each person wishing to address the Council, speakers must limit their comments to three (3) minutes. Written documents may be distributed to the Council prior to the meeting to allow a more timely presentation. Speakers should not use obscene, profane, or threatening language, or make personal attacks. Matters of litigation involving the City shall not be discussed during Public Inquiry by citizens or Council. The Council may not respond to speaker comments, engage in a debate, or take any action on the issues raised by citizens, but may direct City staff to research or follow up on an issue, if desired by Council. If Council directs further review by staff, the results of that review will be presented at a following regular Council meeting.RESPONSE TO PUBLIC INQUIRIESPublic Inquiry Response From August 9, 2021 City Council MeetingGayle Bauman, Finance DirectorMEMO.PDFSTAFF COMMENTSTransportation UpdateDavid Swearingen, Interim Public Works DirectorMEMO.PDFAPPROVAL OF MINUTESJuly 19, 2021 City Council Work Session07-19 -21 -WS.PDFJuly 26, 2021 Special City Council Work Session07-26 -21 -SWS.PDFJuly 26, 2021 Regular City Council07-26 -21 -R.PDFCONSENT CALENDARThose items listed under the Consent Calendar are considered to be routine by the City Council and will be enacted by one motion under a Consent Calendar format. There will be no separate discussion of these items, unless a Councilmember so requests, in which event, the item will be removed from the general order of business and considered separately in its normal sequence on the agenda.Motion To Approve Claims And PayrollGayle Bauman, Finance DirectorPang Silseth, Accounting AnalystMEMO.PDFMotion To Approve Resolution 2021 -045 Accepting A Donation From The Arden Hills FoundationJoe Vaughan, Recreation ProgrammerMEMO.PDFATTACHMENT A.PDFMotion To Approve Appointment Of Building InspectorDave Perrault, City AdministratorMEMO.PDFMotion To Accept Resignation Of Communications CoordinatorDave Perrault, City AdministratorMEMO.PDFMotion To Approve Recruiting Communications CoordinatorDave Perrault, City AdministratorMEMO.PDFATTACHMENT A.PDFPULLED CONSENT ITEMSThose items that are pulled from the Consent Calendar will be removed from the general order of business and considered separately in its normal sequence on the agenda.PUBLIC HEARINGSArden Oaks Street Improvements Project Larry Poppler, TKDADavid Swearingen, Interim Public Works DirectorMEMO.PDFATTACHMENT A.PDFATTACHMENT B.PDFLexington Avenue And Target Road Traffic Signal System ImprovementsDavid Swearingen, Interim Public Works Director MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF ATTACHMENT C.PDF Planning Case 21 -017 –Planned Unit Development Amendment -Mounds View Public Schools Jessica Jagoe, Senior Planner MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF ATTACHMENT C.PDF ATTACHMENT D.PDF ATTACHMENT E.PDF ATTACHMENT F.PDF ATTACHMENT G.PDF ATTACHMENT H.PDF Planning Case 21 -018 –Ordinance Amendment Chapter 13, Zoning Code, Section 1330.02, Subd. 1, Classification Of Lakes Jessica Jagoe, Senior Planner MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF ATTACHMENT C.PDF ATTACHMENT D.PDF ATTACHMENT E.PDF ATTACHMENT F.PDF ATTACHMENT G.PDF Planning Case 21 -016 –Site Plan Review –3900 Bethel Drive –Bolton & Menk On Behalf Of Bethel University Jessica Jagoe, Senior Planner MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF ATTACHMENT C.PDF ATTACHMENT D.PDF ATTACHMENT E.PDF ATTACHMENT F.PDF ATTACHMENT G.PDF ATTACHMENT H.PDF ATTACHMENT I.PDF ATTACHMENT J.PDF ATTACHMENT K.PDF NEW BUSINESS Resolution 2021 -046 Ordering Improvements And Preparation Of Plans And Specifications –Arden Oaks Street Improvements Project David Swearingen, Interim Public Works Director MEMO.PDF ATTACHMENT A.PDF Resolution 2021 -047 Ordering Improvements And Preparation Of Plans And Specifications –Lexington Avenue And Target Road Traffic Signal System Improvements David Swearingen, Interim Public Works Director MEMO.PDF ATTACHMENT A.PDF Planning Case 21 -017 –Planned Unit Development Amendment -Mounds View Public Schools Jessica Jagoe, Senior Planner MEMO.PDF ATTACHMENT A.PDF Planning Case 21 -018 –Ordinance 2021 -007 Amending Chapter 13, Zoning Code, Section 1330.02, Subd. 1, Classification Of Lakes And Authorizing Publication Of Ordinance Jessica Jagoe, Senior Planner MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF ATTACHMENT C.PDF Planning Case 21 -016 –Resolution 2021 -048 –Site Plan Review –3900 Bethel Drive –Bolton & Menk On Behalf Of Bethel University Jessica Jagoe, Senior Planner MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF UNFINISHED BUSINESS COUNCIL/STAFF COMMENTS ADJOURN Mayor:David GrantCouncilmembers:Brenda HoldenFran HolmesDave McClungSteve Scott Regular City Council AgendaAugust 23, 2021 7:00 p.m. City Hall Address:1245 W Highway 96Arden Hills MN 55112Phone:651 -792 -7800Website:www.cityofardenhills.orgCity VisionArden Hills is a strong community that values its unique environmental setting, strong residential neighborhoods, vital business community, well -maintained infrastructure, fiscal soundness, and our long -standing tradition as a desirable City in which to live, work, and play.This meeting will be streamed live on local Cable Channel 16 and available for playback on our website.CALL TO ORDER1.2.3.3.A.Documents:4.4.A.Documents:5.5.A.Documents:5.B.Documents:5.C.Documents:6.6.A.Documents:6.B.Documents:6.C.Documents:6.D.Documents:6.E.Documents:7.8.8.A.Documents:8.B.Documents: 8.C. Documents: 8.D. Documents: 8.E. Documents: 9. 9.A. Documents: 9.B. Documents: 9.C. Documents: 9.D. Documents: 9.E. Documents: 10. 11. APPROVAL OF AGENDAPUBLIC INQUIRIES/INFORMATIONALThis is an opportunity for citizens to bring to the Council ’s attention any items not currently on the agenda which are relevant to the City. In addressing the Council, you must first state your name and address for the record. To allow adequate time for each person wishing to address the Council, speakers must limit their comments to three (3) minutes. Written documents may be distributed to the Council prior to the meeting to allow a more timely presentation. Speakers should not use obscene, profane, or threatening language, or make personal attacks. Matters of litigation involving the City shall not be discussed during Public Inquiry by citizens or Council. The Council may not respond to speaker comments, engage in a debate, or take any action on the issues raised by citizens, but may direct City staff to research or follow up on an issue, if desired by Council. If Council directs further review by staff, the results of that review will be presented at a following regular Council meeting.RESPONSE TO PUBLIC INQUIRIESPublic Inquiry Response From August 9, 2021 City Council MeetingGayle Bauman, Finance DirectorMEMO.PDFSTAFF COMMENTSTransportation UpdateDavid Swearingen, Interim Public Works DirectorMEMO.PDFAPPROVAL OF MINUTESJuly 19, 2021 City Council Work Session07-19 -21 -WS.PDFJuly 26, 2021 Special City Council Work Session07-26 -21 -SWS.PDFJuly 26, 2021 Regular City Council07-26 -21 -R.PDFCONSENT CALENDARThose items listed under the Consent Calendar are considered to be routine by the City Council and will be enacted by one motion under a Consent Calendar format. There will be no separate discussion of these items, unless a Councilmember so requests, in which event, the item will be removed from the general order of business and considered separately in its normal sequence on the agenda.Motion To Approve Claims And PayrollGayle Bauman, Finance DirectorPang Silseth, Accounting AnalystMEMO.PDFMotion To Approve Resolution 2021 -045 Accepting A Donation From The Arden Hills FoundationJoe Vaughan, Recreation ProgrammerMEMO.PDFATTACHMENT A.PDFMotion To Approve Appointment Of Building InspectorDave Perrault, City AdministratorMEMO.PDFMotion To Accept Resignation Of Communications CoordinatorDave Perrault, City AdministratorMEMO.PDFMotion To Approve Recruiting Communications CoordinatorDave Perrault, City AdministratorMEMO.PDFATTACHMENT A.PDFPULLED CONSENT ITEMSThose items that are pulled from the Consent Calendar will be removed from the general order of business and considered separately in its normal sequence on the agenda.PUBLIC HEARINGSArden Oaks Street Improvements Project Larry Poppler, TKDADavid Swearingen, Interim Public Works DirectorMEMO.PDFATTACHMENT A.PDFATTACHMENT B.PDFLexington Avenue And Target Road Traffic Signal System ImprovementsDavid Swearingen, Interim Public Works DirectorMEMO.PDFATTACHMENT A.PDFATTACHMENT B.PDFATTACHMENT C.PDFPlanning Case 21 -017 –Planned Unit Development Amendment -Mounds View Public SchoolsJessica Jagoe, Senior PlannerMEMO.PDFATTACHMENT A.PDFATTACHMENT B.PDFATTACHMENT C.PDFATTACHMENT D.PDFATTACHMENT E.PDFATTACHMENT F.PDFATTACHMENT G.PDFATTACHMENT H.PDFPlanning Case 21 -018 –Ordinance Amendment Chapter 13, Zoning Code, Section 1330.02, Subd. 1, Classification Of LakesJessica Jagoe, Senior PlannerMEMO.PDFATTACHMENT A.PDFATTACHMENT B.PDFATTACHMENT C.PDFATTACHMENT D.PDFATTACHMENT E.PDFATTACHMENT F.PDFATTACHMENT G.PDFPlanning Case 21 -016 –Site Plan Review –3900 Bethel Drive –Bolton & Menk On Behalf Of Bethel UniversityJessica Jagoe, Senior PlannerMEMO.PDFATTACHMENT A.PDFATTACHMENT B.PDFATTACHMENT C.PDFATTACHMENT D.PDFATTACHMENT E.PDFATTACHMENT F.PDFATTACHMENT G.PDFATTACHMENT H.PDFATTACHMENT I.PDF ATTACHMENT J.PDF ATTACHMENT K.PDF NEW BUSINESS Resolution 2021 -046 Ordering Improvements And Preparation Of Plans And Specifications –Arden Oaks Street Improvements Project David Swearingen, Interim Public Works Director MEMO.PDF ATTACHMENT A.PDF Resolution 2021 -047 Ordering Improvements And Preparation Of Plans And Specifications –Lexington Avenue And Target Road Traffic Signal System Improvements David Swearingen, Interim Public Works Director MEMO.PDF ATTACHMENT A.PDF Planning Case 21 -017 –Planned Unit Development Amendment -Mounds View Public Schools Jessica Jagoe, Senior Planner MEMO.PDF ATTACHMENT A.PDF Planning Case 21 -018 –Ordinance 2021 -007 Amending Chapter 13, Zoning Code, Section 1330.02, Subd. 1, Classification Of Lakes And Authorizing Publication Of Ordinance Jessica Jagoe, Senior Planner MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF ATTACHMENT C.PDF Planning Case 21 -016 –Resolution 2021 -048 –Site Plan Review –3900 Bethel Drive –Bolton & Menk On Behalf Of Bethel University Jessica Jagoe, Senior Planner MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF UNFINISHED BUSINESS COUNCIL/STAFF COMMENTS ADJOURN Mayor:David GrantCouncilmembers:Brenda HoldenFran HolmesDave McClungSteve Scott Regular City Council AgendaAugust 23, 2021 7:00 p.m. City Hall Address:1245 W Highway 96Arden Hills MN 55112Phone:651 -792 -7800Website:www.cityofardenhills.orgCity VisionArden Hills is a strong community that values its unique environmental setting, strong residential neighborhoods, vital business community, well -maintained infrastructure, fiscal soundness, and our long -standing tradition as a desirable City in which to live, work, and play.This meeting will be streamed live on local Cable Channel 16 and available for playback on our website.CALL TO ORDER1.2.3.3.A.Documents:4.4.A.Documents:5.5.A.Documents:5.B.Documents:5.C.Documents:6.6.A.Documents:6.B.Documents:6.C.Documents:6.D.Documents:6.E.Documents:7.8.8.A.Documents:8.B.Documents:8.C.Documents:8.D.Documents:8.E.Documents: 9. 9.A. Documents: 9.B. Documents: 9.C. Documents: 9.D. Documents: 9.E. Documents: 10. 11. APPROVAL OF AGENDAPUBLIC INQUIRIES/INFORMATIONALThis is an opportunity for citizens to bring to the Council ’s attention any items not currently on the agenda which are relevant to the City. In addressing the Council, you must first state your name and address for the record. To allow adequate time for each person wishing to address the Council, speakers must limit their comments to three (3) minutes. Written documents may be distributed to the Council prior to the meeting to allow a more timely presentation. Speakers should not use obscene, profane, or threatening language, or make personal attacks. Matters of litigation involving the City shall not be discussed during Public Inquiry by citizens or Council. The Council may not respond to speaker comments, engage in a debate, or take any action on the issues raised by citizens, but may direct City staff to research or follow up on an issue, if desired by Council. If Council directs further review by staff, the results of that review will be presented at a following regular Council meeting.RESPONSE TO PUBLIC INQUIRIESPublic Inquiry Response From August 9, 2021 City Council MeetingGayle Bauman, Finance DirectorMEMO.PDFSTAFF COMMENTSTransportation UpdateDavid Swearingen, Interim Public Works DirectorMEMO.PDFAPPROVAL OF MINUTESJuly 19, 2021 City Council Work Session07-19 -21 -WS.PDFJuly 26, 2021 Special City Council Work Session07-26 -21 -SWS.PDFJuly 26, 2021 Regular City Council07-26 -21 -R.PDFCONSENT CALENDARThose items listed under the Consent Calendar are considered to be routine by the City Council and will be enacted by one motion under a Consent Calendar format. There will be no separate discussion of these items, unless a Councilmember so requests, in which event, the item will be removed from the general order of business and considered separately in its normal sequence on the agenda.Motion To Approve Claims And PayrollGayle Bauman, Finance DirectorPang Silseth, Accounting AnalystMEMO.PDFMotion To Approve Resolution 2021 -045 Accepting A Donation From The Arden Hills FoundationJoe Vaughan, Recreation ProgrammerMEMO.PDFATTACHMENT A.PDFMotion To Approve Appointment Of Building InspectorDave Perrault, City AdministratorMEMO.PDFMotion To Accept Resignation Of Communications CoordinatorDave Perrault, City AdministratorMEMO.PDFMotion To Approve Recruiting Communications CoordinatorDave Perrault, City AdministratorMEMO.PDFATTACHMENT A.PDFPULLED CONSENT ITEMSThose items that are pulled from the Consent Calendar will be removed from the general order of business and considered separately in its normal sequence on the agenda.PUBLIC HEARINGSArden Oaks Street Improvements Project Larry Poppler, TKDADavid Swearingen, Interim Public Works DirectorMEMO.PDFATTACHMENT A.PDFATTACHMENT B.PDFLexington Avenue And Target Road Traffic Signal System ImprovementsDavid Swearingen, Interim Public Works DirectorMEMO.PDFATTACHMENT A.PDFATTACHMENT B.PDFATTACHMENT C.PDFPlanning Case 21 -017 –Planned Unit Development Amendment -Mounds View Public SchoolsJessica Jagoe, Senior PlannerMEMO.PDFATTACHMENT A.PDFATTACHMENT B.PDFATTACHMENT C.PDFATTACHMENT D.PDFATTACHMENT E.PDFATTACHMENT F.PDFATTACHMENT G.PDFATTACHMENT H.PDFPlanning Case 21 -018 –Ordinance Amendment Chapter 13, Zoning Code, Section 1330.02, Subd. 1, Classification Of LakesJessica Jagoe, Senior PlannerMEMO.PDFATTACHMENT A.PDFATTACHMENT B.PDFATTACHMENT C.PDFATTACHMENT D.PDFATTACHMENT E.PDFATTACHMENT F.PDFATTACHMENT G.PDFPlanning Case 21 -016 –Site Plan Review –3900 Bethel Drive –Bolton & Menk On Behalf Of Bethel UniversityJessica Jagoe, Senior PlannerMEMO.PDFATTACHMENT A.PDFATTACHMENT B.PDFATTACHMENT C.PDFATTACHMENT D.PDFATTACHMENT E.PDFATTACHMENT F.PDFATTACHMENT G.PDFATTACHMENT H.PDFATTACHMENT I.PDFATTACHMENT J.PDFATTACHMENT K.PDFNEW BUSINESSResolution 2021 -046 Ordering Improvements And Preparation Of Plans And Specifications –Arden Oaks Street Improvements ProjectDavid Swearingen, Interim Public Works DirectorMEMO.PDFATTACHMENT A.PDFResolution 2021 -047 Ordering Improvements And Preparation Of Plans And Specifications –Lexington Avenue And Target Road Traffic Signal System ImprovementsDavid Swearingen, Interim Public Works DirectorMEMO.PDFATTACHMENT A.PDFPlanning Case 21 -017 –Planned Unit Development Amendment -Mounds View Public SchoolsJessica Jagoe, Senior PlannerMEMO.PDFATTACHMENT A.PDFPlanning Case 21 -018 –Ordinance 2021 -007 Amending Chapter 13, Zoning Code, Section 1330.02, Subd. 1, Classification Of Lakes And Authorizing Publication Of OrdinanceJessica Jagoe, Senior PlannerMEMO.PDFATTACHMENT A.PDFATTACHMENT B.PDFATTACHMENT C.PDFPlanning Case 21 -016 –Resolution 2021 -048 –Site Plan Review –3900 Bethel Drive –Bolton & Menk On Behalf Of Bethel UniversityJessica Jagoe, Senior Planner MEMO.PDF ATTACHMENT A.PDF ATTACHMENT B.PDF UNFINISHED BUSINESS COUNCIL/STAFF COMMENTS ADJOURN Mayor:David GrantCouncilmembers:Brenda HoldenFran HolmesDave McClungSteve Scott Regular City Council AgendaAugust 23, 2021 7:00 p.m. City Hall Address:1245 W Highway 96Arden Hills MN 55112Phone:651 -792 -7800Website:www.cityofardenhills.orgCity VisionArden Hills is a strong community that values its unique environmental setting, strong residential neighborhoods, vital business community, well -maintained infrastructure, fiscal soundness, and our long -standing tradition as a desirable City in which to live, work, and play.This meeting will be streamed live on local Cable Channel 16 and available for playback on our website.CALL TO ORDER1.2.3.3.A.Documents:4.4.A.Documents:5.5.A.Documents:5.B.Documents:5.C.Documents:6.6.A.Documents:6.B.Documents:6.C.Documents:6.D.Documents:6.E.Documents:7.8.8.A.Documents:8.B.Documents:8.C.Documents:8.D.Documents:8.E.Documents:9.9.A.Documents:9.B.Documents:9.C.Documents:9.D.Documents:9.E. Documents: 10. 11. Page 1 of 1 RESPONSE TO PUBLIC INQUIRIES – 3A MEMORANDUM DATE: August 23, 2021 TO: Honorable Mayor and City Councilmembers Dave Perrault, City Administrator FROM: Gayle Bauman, Finance Director SUBJECT: Public Inquiry Response from August 9, 2021 City Council meeting Budgeted Amount: Actual Amount: Funding Source: $ $ $ Background At the August 9, 2021, City Council meeting, a resident inquired about the public presentation portion of the agenda. A verbal response will be provided at the August 23, 2021 City Council meeting. Page 1 of 1 STAFF COMMENTS – 4A MEMORANDUM DATE: TO: FROM: August 23, 2021 Honorable Mayor and City Councilmembers Dave Perrault, City Administrator David Swearingen, Interim Public Works Director/City Engineer SUBJECT: Transportation Update Budgeted Amount: Actual Amount: Funding Source: $ $ $ A verbal update will be provided at the City Council meeting. Approved: Approved: August 23, 2021 CITY OF ARDEN HILLS, MINNESOTA CITY COUNCIL WORK SESSION JULY 19, 2021 5:00 P.M. - ARDEN HILLS CITY COUNCIL CHAMBERS CALL TO ORDER/ROLL CALL Pursuant to due call and notice thereof, Mayor Grant called to order the City Council Work Session at 5:00 p.m. Present: Mayor David Grant, Councilmembers Brenda Holden, Fran Holmes, Dave McClung (attending remotely) and Steve Scott Absent: None Also present: City Administrator Dave Perrault, Interim Public Works Director David Swearingen, Finance Director Gayle Bauman, Senior Planner Jessica Jagoe, Deputy City Clerk Jolene Trauba, TKDA Project Manager Larry Poppler, HR Green Regional Director John Morast and Project Manager Chris Herrington Mayor Grant asked to add an item discussing park benches between items D and E. 1. AGENDA ITEMS A. Review Draft Feasibility Report – Arden Oaks Improvement Project TKDA Project Manager Larry Poppler introduced his presentation for the Arden Oaks neighborhood, which is near the intersection of Snelling and County Road E. He reviewed existing conditions, proposed improvements, public input, project funding, project schedule, recommendations and next steps. Options included pavement reclamation or mill and overlay. There was a 70% questionnaire return rate from 42 properties with identified topics of interest being localized drainage issues, pedestrian safety and truck access/cut through traffic. Estimated costs were $583,000 for the Option 1 – full depth reclamation, with a per unit assessment of $6,560 and $396,000 for Option 2 – mill and overlay with an assessment of $4,425 per unit. They would like to have Council accept the feasibility report at the next City Council meeting, and have the assessment hearing on August 23rd. Plans would be completed in January, followed by the bidding and assessment processes, with construction in the spring of 2022. He recommended Option 1. Mayor Grant noted the mill and overlay is not really an option due to the deteriation of the roadways. ARDEN HILLS CITY COUNCIL WORK SESSION – JULY 19, 2021 2 TKDA Project Manager Poppler said they will take the mill and overlay option out of the feasibility report. Councilmember Holden asked to discuss the first cul-de-sac off of Snelling Avenue. The semi’s that use it to turn around are breaking the street up. She felt they should plan to not allow semi’s. Councilmember Holmes suggested staff speak to Lindey’s because it is delivery trucks to their business using the cul-de-sac to turn around. Mayor Grant said they should plan for the semi’s to not use any of the roads in that neighborhood to turn around. Interim Public Works Director Swearingen asked if TKDA could continue with the project design and prepare a proposal for Council to review. Council agreed. B. Speed Limits Discussion HR Green Regional Director John Morast presented information regarding neighboring communities’ decisions, an update on Local Road Research Board (LRRB), provided a map and list of eligible streets, speed limit decision options, recommendations and next steps. Mayor Grant said if the City puts up signs to change the speed limits the Council will want to know how many signs the City would need, how much the signs would cost and who would be responsible for installing the signs. He felt 30 miles per hour seemed too high due to people walking on streets and trails. Mr. Morast said the Minneapolis and St Paul studies showed a large reduction in the severity of crashes with lowering speed limits. He also commented on the benefits of having flashing speed signs. Councilmember McClung discussed the signs that were posted along Royal Hills Drive that were 25 miles per hour. Councilmember Holden expressed concern with the fact new cars were very quiet and were difficult to tell how fast they were going. Mayor Grant stated another concern of his was that the entire City did not have sidewalks, which meant pedestrians were walking in the streets in many neighborhoods throughout the community. Councilmember Holmes indicated she was not in favor of changing the speed limit. She commented she didn’t know what the expense would be to make this change and she feared if the speed limit were reduced there wouldn’t be enough enforcement efforts. Councilmember Holden explained she brought this item up and noted speeding traffic in residential neighborhoods was the number one complaint she received from residents. She stated she would not mind lowering the speed on residential streets to 25 miles per hour. She indicated she would like to know more about the cost of replacing/posting signs. ARDEN HILLS CITY COUNCIL WORK SESSION – JULY 19, 2021 3 Mr. Morast reported the City could not set the speed limit to 25 miles per hour on MSA streets but could request a speed study from MNDOT. Mayor Grant explained the City has received complaints regarding over the years. He discussed how the City was turning over and believed it would benefit the City to lower the residential speed limit to 25 miles per hour. Councilmember Scott reported he supported the reduction to 25 miles per hour. Councilmember McClung indicated there were a lot of cars in his neighborhood going more than 35 miles per hour. He stated he supported a reduction citywide to 25 miles per hour. Councilmember Holden recommended the matter be reviewed by the Planning Commission and a public hearing be held. Councilmember Holmes suggested a public forum be held versus a public hearing at a Planning Commission meeting. She questioned how the city of St. Anthony addressed this topic. Mr. Morast explained St. Anthony held a public hearing at a City Council meeting and then took action on the matter. Councilmember Holmes recommended the City Council learn more about the cost of making this change prior to moving this matter forward. The Council supported holding a public hearing for the change in speed limit at the Planning Commission and City Council. The Council requested staff report back on pricing for the project via the Admin Update. C. CIP Budget Finance Director Bauman stated annually, the City prepares a five year Capital Improvement Plan for budgeting and forecasting. The focus of the CIP is on the maintenance and protection of the City’s existing assets, redevelopment, and investment in new initiatives. The CIP is part of the budget process, but it is not a budget, it is a plan, and one that changes often. The CIP does not commit the council to the proposed projects, nor implement the assumptions made during the preparation; however, this is the basis for the 2022 Budget as we continue with its preparation. Finance Director Bauman reported the City has a finite number of resources, so prioritizing and then being able to finance projects is crucial for ensuring the city’s long-term sustainability and being responsible stewards of the city’s investments. Staff has been working on completing a comprehensive study of the City’s current and future needs for infrastructure projects to better estimate project costs and ensure more accurate forecasting of available fund balances. Finance Director Bauman reported a preliminary plan has been prepared and includes a summary of projects, detailed project sheets, sources of funds, and estimated fund balances (since the operating budgets have not yet been completed, these fund balances are estimated operating costs). Information is included on street and park projects going out ten (10) years even though ARDEN HILLS CITY COUNCIL WORK SESSION – JULY 19, 2021 4 our CIP is only for five years. The 2021-2025 CIP was an $18.8 Million plan, while the proposed 2022-2026 CIP is listed for $15.3 Million in expenditures. This is an 18.7% decrease from the previous year’s program or $3,526,490. The biggest change is found in street projects. Staff commented further on the CIP and requested feedback from the Council. Mayor Grant asked if the estimate for the court replacement was correct. Interim Public Works Director Swearingen stated the estimates may be slightly inflated. He indicated he would have more information for the Council once soil borings were completed. Councilmember Holden requested staff check on the condition of the courts that have been replaced to ensure they were holding up. Councilmember Holmes stated she would like to see the City continuing to lease a warming house for Hazelnut Park. Mayor Grant commented another option for the City would be to build a warming house with the assistance of the ICWC workers. He noted this would provide the City with labor and the only expense would be materials, so long as the City provides the crew with plans. Further discussion ensued regarding the Old Snelling Avenue street and trail project. Councilmember Holmes asked what the budget was for the Old Snelling Avenue project for both the road and trail. Interim Public Works Director Swearingen explained Bolton & Menk has the project coming in at $1.25 million. Finance Director Bauman reported this expense would be slightly lower because 24 properties would be assessed for the project. Councilmember Holmes recommended the assessment amount be similar to the assessments charged for Arden Oaks. Interim Public Works Director Swearingen indicated he would look through the assessment amounts and the Council could discuss this further at a future worksession meeting. Councilmember Holmes stated she would like an update from staff on how the City was doing with lining, the progress being made on the lift stations, manhole covers, etc. Mayor Grant expressed concern with how often the City was replacing its trailers. Interim Public Works Director Swearingen indicated he would provide the Council with further information on the trailer that was being replaced. Mayor Grant recommended the Code Enforcement vehicle not be replaced because it only had 60,000 miles on it. He suggested this vehicle be pushed out three or four years. ARDEN HILLS CITY COUNCIL WORK SESSION – JULY 19, 2021 5 City Administrator Perrault stated this was simply a placeholder item. He explained this item was not used much in the last year. He commented further on how the used vehicle market was at this time. Finance Director Bauman discussed the expense of replacing all of the City’s water meters and noted staff would have to work on how to fund this project. Councilmember Holden suggested some of the federal government money be used to assist with covering the expense of replacing water meters. She asked if Federal funds can be used for stormwater expenditures in 2022. Finance Director Bauman stated she would have to research this further to ensure that this type of project could be covered by Federal ARPA funds. Mayor Grant questioned if the City has received the Federal ARPA funds. Finance Director Bauman explained she expected the City would receive the funds next week. Councilmember Holden asked if the City applied for an I&I grant from the Met Council. Interim Public Works Director Swearingen stated he had applied for a grant in the amount of $250,000. He reported the City would be receiving a grant, but he would not know the grant amount until later this fall. Councilmember Holden recommended $250,000 in sewer lining be added to the CIP for 2023. Finance Director Bauman questioned where the fund balance from the end of 2020 ($548,000) should be placed. She indicated the Council typically puts this surplus into the PIR Fund. The Council supported the surplus being placed in the PIR Fund. D. Water Meters Discussion Finance Director Bauman stated sometime around December 31, 2020, when staff was working on the 4th quarter utility billing for 2020, it became apparent that we weren’t receiving reads on about 300 of our 2600+ meters, mostly in the southern portion of the City. Staff needed to complete the billing cycle per City Code and went about estimating the 4th quarter reads for properties based on usage amounts from the past three years. Staff met with employees from Metering & Technology Solutions who deal with the meters, transmitters and collectors in conjunction with Badger Meter. It was determined that the collectors and meters were operating properly and that the likely cause was signal interference. Finance Director Bauman commented Metering & Technology Solutions suggested that the City have Ancom conduct an RF Study in an attempt to locate the source of any potential interference to the automated water meter reporting system. Ancom had recently worked with another City on identifying interference issues. As staff was preparing the 1st quarter utility billing for 2021, it became apparent that we were still not getting reads on about 150 properties. A note was included in the 03/26/21 Admin Update indicating that letters were being sent out to these properties in an attempt to get accurate meter reads for the billing cycle. The City received about 95 responses to ARDEN HILLS CITY COUNCIL WORK SESSION – JULY 19, 2021 6 their inquiry so only about 55 accounts needed to be estimated. The Ancom Study has since been completed and it was determined that the only likely source of interference was an elevated noise floor, as there were no other discernable sources of interference present during the testing. Finance Director Bauman explained for this 2nd quarter billing, the City ended up not getting reads on about 140 properties. In looking back, the meter readings seemed to drop off about a week before Thanksgiving, which is also the same time the State went into lockdown again because of COVID 19. It also appears as if some of the reads came back on line, at least intermittently, in mid-January. This would correspond to the time the lockdown started to be lifted. There is a possibility that some of this interference had to do with an increased use of electronic devices and companies working to increase their signal strength for their customers. Finance Director Bauman stated the three solutions presented to the City by Ancom were to replace our antennas, upgrade our antennas, or install a 4th collector in the City. Metering & Technology Solutions also strongly suggested that we upgrade our Read Center software as they no longer support the transmitters we currently use. As we need additional transmitters or as the old ones start to fail, they will be replaced with ones that use a cellular signal to transmit data and the Read Center software does not work with them. Staff is moving forward with upgrading our Read Center software to Beacon software. This should be completed by the end of July. This upgrade won’t help with the interference issues we are having but we were told it will take care of the power issues we are experiencing at the North Tower. Also, it will enable us to obtain additional transmitters as old ones wear out and new services are added. Finance Director Bauman commented a benefit of the new Beacon software is a Customer Portal that will be made available to all customers, regardless of the type of transmitter they have in their home/business. Once customers sign up for this portal, they will be notified of abnormal water usage (potential leaks) in real time, and the City will no longer need to prepare the courtesy leak letters. Staff is currently working with Metering & Technology Solutions and Badger Meter to overcome the interference issues we are experiencing. Councilmember Holmes stated she was having a problem with the explanation being “signal interference”. She expressed concern with the fact the City was proposing to spend more money when it does not know what the actual problem was. Mayor Grant reported there were more and more people and companies using radio frequency which meant it was getting harder for the City to listen or hear the meters. He questioned what improvements staff was proposing at this time. Finance Director Bauman reviewed the improvements she was proposing to complete at this time, which included software updates and a 4th collector for the south end of the City. Mayor Grant indicated staff was requesting to spend $13,000 to get the existing system properly reading the City’s meters. Finance Director Bauman stated this was the case. She reported the water meter replacement throughout the City would be an entirely different project. ARDEN HILLS CITY COUNCIL WORK SESSION – JULY 19, 2021 7 Mayor Grant asked if the Council could support the $13,000 expenditure. The Council supported this expense. Mayor Grant commented staff brought up another project the Council will have to consider, which will be the replacement of all of the City’s water meters. He noted the batteries were reaching the end of their useful life. He reported the cost to replace the batteries was around $1 to $1.2 million. He explained this was a project the City would have to begin planning for. Councilmember Holmes asked if the water meters were replaced 20 years ago. Finance Director Bauman explained the transmitters were replaced in 2012 or 2013 and the meters were more than 15 years old. Mayor Grant reported he has been on the City Council for 20 years and he does not recall doing the meters under Dennis Probst. He anticipated the meters were 16+ years old. Councilmember Holden suggested staff speak with Badger Meters. Councilmember Holmes supported the City putting aside a portion of the Federal dollars for this project. Mayor Grant requested staff investigate the age of the existing meters and report back to the Council at a future meeting. D1. Park Benches Mayor Grant discussed a park bench situation at Crepeau Park that involved Rich Straumann and the insurance agent at State Farm. He explained he received an email from the PTRC Chair John Van Valkenburg stating the bench should be installed at Crepeau Park and it had to mention Dan Messerli. Councilmember Holmes commented further on the park bench application. She reported the application states City staff should be contacting the applicant on where the bench should be located. Mayor Grant discussed the proposed park bench location and asked if this new bench would be replacing a deteriorated bench. He was of the opinion the proposed park bench location was not a good spot. He commented further on how upset the PTRC Chair and Rich Straumann were about this situation. Interim Public Works Director Swearingen stated the bench for Dan Reichert had been assembled but not installed. He noted another bench would have to be ordered for Dan Messerli. Councilmember Holden indicated a request has been made for an additional park bench for Crepeau Park in memory of Dan Messerli. She believed that whoever paid for the bench should have the right to select a placement for the bench. ARDEN HILLS CITY COUNCIL WORK SESSION – JULY 19, 2021 8 Mayor Grant agreed this should be the case. He recommended the existing composite bench in Crepeau Park be power washed. Councilmember Holden supported Dan Reichert’s bench be installed by staff in a location that would be frequently used. She commented she did not support the bench in Crepeau Park being removed unless it was damaged beyond the point of repair. Mayor Grant concurred. He noted he would speak with the PTRC Chair regarding this matter. He supported the PTRC bench being located where the PTRC would like it. E. Community Development Staffing City Administrator Perrault reported the City Council discussed Community Development Staffing at its June work session and Staff was asked to bring back a draft job description for a Community Development Director position that had a focus on planning duties. The City currently has a Senior Planner on staff. Prior the departure of the previous Community Development Manager/City Planner, Council intended to hire two positions to facilitate the City’s planning functions. One option proposed would be to have a Community Development Director who has a focus on planning, but also oversees the Building Department and is the overall head for the Community Development Department. Another option would be to re-post for a City Planner position and see what the pool of applicants looks like; however, this approach would still leave a gap in the Community Development Department Head function. Councilmember Holden discussed how Mike Mrosla managed the position. She indicated she supported the City having a Community Development Director that also worked on planning cases. City Administrator Perrault stated this was his intention for the Community Development Director position. Councilmember Holmes suggested language be added to the job description to make it clear the position involves responsibility for developing and working on planning cases. Councilmember McClung agreed the City should be pursuing a Community Development Director that also worked as a City Planner. He noted this position would have significant oversight in the Planning Department. Councilmember Holden indicated she would like the job description amended to include more planning duties. The Council directed staff to move forward with the Community Development Director position and requested staff bring the job description back to Council for approval at its next meeting. Point of order was noted and Council agreed to extend the meeting until 8:30 p.m. F. Council Tracker City Administrator Perrault reviewed the Council Tracker with the Council. ARDEN HILLS CITY COUNCIL WORK SESSION – JULY 19, 2021 9 Councilmember Holden requested staff investigate the new sidewalk Chick-Fil-A would be installing to ensure that it connects with the County sidewalk. She questioned when the Hamline Avenue retaining wall would be fixed. Councilmember Scott explained the County contractor would not be fixing the retaining wall this year, but would be addressing the concern in 2022. Councilmember Holden encouraged staff to look into the numerous grants that were available from the State and other agencies for elections, EAB, and other initiatives. 2. COUNCIL COMMENTS AND STAFF UPDATES Councilmember Holden explained she spoke with staff about why Stowe Avenue was striped. She asked staff look into it. Councilmember Scott requested further information regarding the City’s water level situation. City Administrator Perrault reported the City received its water from St. Paul and the City had no concerns at this time. ADJOURN Mayor Grant adjourned the City Council Work Session at 8:31 p.m. __________________________ __________________________ Jolene Trauba David Grant Deputy City Clerk Mayor Approved: August 23, 2021 CITY OF ARDEN HILLS, MINNESOTA CITY COUNCIL SPECIAL WORK SESSION JULY 26, 2021 5:00 P.M. - ARDEN HILLS CITY HALL CALL TO ORDER/ROLL CALL Pursuant to due call and notice thereof, Mayor Grant called to order the City Council Special Work Session at 5:00 p.m. Present: Mayor David Grant; Councilmembers Brenda Holden, Fran Holmes, Dave McClung (attending remotely) and Steve Scott Absent: None Also present: City Administrator Dave Perrault; Interim Public Works Director David Swearingen; Senior Planner Jessica Jagoe; Recreation Programmer Joe Vaughan, City Clerk Julie Hanson; and PTRC Chair Jon Van Valkenburg (arrived at 5:05 p.m.) 1. AGENDA ITEMS A. PTRC Trail Priority/Work Plan Discussion Interim Public Works Director Swearingen stated the PTRC recently submitted its trail priority list to the City Council dated April 20, 2021; following a discussion the City Council requested a meeting with the PTRC Chair to discuss future PTRC work plans and direction from the City Council. This meeting will serve as a preliminary meeting with the PTRC Chair to discuss PTRC priorities, workplans, and set the stage for a future joint meeting between the City Council and the PTRC. Mayor Grant commented on the ten trails the PTRC selected. He noted this was a recommendation from the PTRC and may or may not match up with the City’s priorities at this time. He explained he saw the list as input from the PTRC. Councilmember Holden stated the order of the projects should be considered in order to align with the City’s street improvement program. She explained she was not interested in pursuing Item #9 or #10. Councilmember Holmes believed it would be beneficial for the city to clarify this was not a trail priority list but rather was a recommended trail list to provide residents with greater clarity. ARDEN HILLS CITY COUNCIL SPECIAL WORK SESSION – JULY 26, 2021 2 PTRC Chair Jon Van Valkenburg stated this may be a good idea for clarity purposes. He understood that the list was a recommendation and that none of the projects were guaranteed or funded. He explained that the PTRC had tried to coordinate trail recommendations with projects that were happening in the City. He understood that the PTRC was making recommendations and was a resource available for the City Council. He suggested a point person that was knowledgeable about the trails be considered. Councilmember Holden indicated she had some concern about the “point person”. She discussed how not all information was shared with the PTRC when it came to grants due to the fact the City did not want to miss out on opportunities and to keep projects from getting too competitive. Mayor Grant explained in the last 20 years while he has served on the Council, the City has only received a handful of grants from 2000 to 2015. However, in the last five years the City has been successful in receiving more grant funding from the State. Councilmember Holden reported the City Council was working hard to get more money for trails. She suggested that if the PTRC had a point person that this person be in communication with the City Council liaison. PTRC Chair Van Valkenburg stated he liked this recommendation. Councilmember Holden suggested the PTRC members have a point person to inspect existing trails to ensure they are being properly maintained. She recommended that the PTRC map out the buckthorn in the City’s parks as well. Mayor Grant supported this recommendation. He commented further on how the PTRC was completing park tours in order to track the condition of each park in the City. Councilmember Holden recommended the PTRC create a park amenity/equipment replacement plan as well. Councilmember Holmes stated she believed it made more sense for the PTRC to have a point person on the different parks in the City than on specific future trails that may or may not be completed. Further discussion ensued regarding the potential of having point people within the PTRC to get trails and projects done in the City’s parks. Councilmember Holden requested the language for Trail #8 be rewritten because wood chips had been placed on this trail. Mayor Grant commented on the condition of several bench throughout the park system that were in need of attention. Councilmember Holden recommended Trail #9 and #10 be removed from the priority list. She noted this was AHATS and TCAAP property and was not City owned land. ARDEN HILLS CITY COUNCIL SPECIAL WORK SESSION – JULY 26, 2021 3 PTRC Chair Van Valkenburg questioned if the Council wants the PTRC to reorganize the trail priority list. Councilmember Holmes explained it should be made clear this list was a recommendation and was not setting priorities for the City. Councilmember Holden encouraged the PTRC to focus on additional recreational activities that could be held in the community. PTRC Chair Van Valkenburg supported this recommendation. Councilmember Holden commented she would like the PTRC to consider taking an inventory of dead trees within the City’s parks when making their park tours. She indicated the City had tree replacement funds that could be used to replace dead and diseased trees. PTRC Chair Van Valkenburg recommended the PTRC come before the City Council on an annual basis as well to provide the Council with an update. Councilmember McClung stated he supported the City offering more recreation programming, whether this was the City conducting this on its own, or through partnerships. Councilmember Holden supported the City consider sponsoring movies in the park in the community. Interim Public Works Director Swearingen explained he would provide the Council and PTRC with a list of the work the ICWC crews would be completing. City Administrator Perrault suggested a joint meeting between staff, the City Council and the PTRC members to lay out Council expectations in early 2022. He reported a follow up meeting could then be held at the end of 2022. B. Chicken Ordinance Discussion Senior Planner Jagoe stated at the July 12, 2021 Special Work Session, the City Council reviewed the first draft ordinance for the keeping of chickens and provided staff with guidance on language to be modified or researched for inclusion in the ordinance. Council direction was to bring this matter back at an upcoming work session for further review. For this meeting, staff has prepared an updated draft ordinance with new language for review. Staff reviewed the proposed changes and requested comment from the Council on how to proceed. Councilmember Holden indicated her main concern was with the fact the chickens would be making noise at all times and could not be silenced like a barking dog. Mayor Grant discussed the Cottage Grove ordinance. ARDEN HILLS CITY COUNCIL SPECIAL WORK SESSION – JULY 26, 2021 4 Councilmember Holmes stated she supported the recommendations from the Municipal Chicken organization and suggested applicants be required to receive 100% support from all contiguous neighbors. She recommended the support/approval process being conducted by City staff. Councilmember Holden explained she would like the support/approval process being done by the applicant. Mayor Grant discussed Items 9 and 10. Councilmember Holmes stated she would like to give chicken owners somewhere between seven and ten days to remedy a problem. Mayor Grant commented he could support ten days. Councilmember Holden indicated she did not want residents turning abandoned chicken coops into sheds, if they were no longer keeping chickens. Councilmember Holmes stated it may be better to have all coops removed if a property owner was no longer keeping chickens instead of having the coops repurposed. She suggested property owners have the coops removed within 60 days. Mayor Grant supported this recommendation. Councilmember Holden asked how much would be charged for chicken keeping permits. Councilmember Holmes reported this fee has not been set. Senior Planner Jagoe explained the five cities surveyed charged a license fee between $30 and $50. She reported residents seeking to keep chickens would also need to apply for a zoning permit ($65) to build the chicken coop and possibly installation of fencing. Councilmember Scott supported the fee being set at $50. Councilmember Holden supported the fee being $10. Councilmember Holmes recommended the chicken fee be set at $30. She reported chicken keepers would be paying the City $30 every other year. Mayor Grant indicated he could support a $30 fee for chicken keeping. Councilmember McClung stated he could support a $30 to $40 fee. Councilmember Holmes questioned if the pen had to be removed if the coop was removed. The Council supported removal of the coop, run, and pen/exercise yard if a resident was no longer keeping chickens. ARDEN HILLS CITY COUNCIL SPECIAL WORK SESSION – JULY 26, 2021 5 Councilmember Holmes asked if a specific coop height should be set within the ordinance or that the language from the Municipal Chicken organization be used to ensure humans could stand up in the coop for maintenance and egg collection. The Council supported this recommendation. Councilmember Holmes questioned if the exercise yard had to be fenced. Senior Planner Jagoe reviewed the definition of an exercise yard within the Ordinance. Councilmember Holden suggested the City require chickens to be banded for identification purposes. Mayor Grant asked if a public hearing for this Ordinance would be held before the Planning Commission and City Council. Senior Planner Jagoe reported this Ordinance amendment would require a public hearing before the Planning Commission and City Council. City Administrator Perrault explained this matter would go before the Planning Commission in September. 2. COUNCIL COMMENTS AND STAFF UPDATES Councilmember McClung reported the Fire Board met last Wednesday where confidential matters were discussed regarding personnel along with the 2022 budget. Councilmember Holden questioned if the bench at Crepeau Park had been removed. Interim Public Works Director Swearingen stated it had not yet been removed. Mayor Grant discussed Council comments in general. ADJOURN Mayor Grant adjourned the City Council Work Session meeting at 6:50 p.m. __________________________ __________________________ Julie Hanson David Grant City Clerk Mayor Approved: August 23, 2021 CITY OF ARDEN HILLS, MINNESOTA REGULAR CITY COUNCIL MEETING JULY 26, 2021 7:00 P.M. - ARDEN HILLS CITY COUNCIL CHAMBERS CALL TO ORDER/ROLL CALL Pursuant to due call and notice thereof, Mayor David Grant called to order the regular City Council meeting at 7:00 p.m. Present: Mayor David Grant, Councilmembers Brenda Holden, Fran Holmes, Dave McClung (attending remotely) and Steve Scott Absent: None Also present: City Administrator Dave Perrault; Interim Public Works Director David Swearingen; Senior Planner Jessica Jagoe; Finance Director Gayle Bauman; City Attorney Joel Jamnik; and City Clerk Julie Hanson PLEDGE OF ALLEGIANCE 1. APPROVAL OF AGENDA MOTION: Councilmember Holden moved and Councilmember Holmes seconded a motion to approve the meeting agenda as presented. A roll call vote was taken. The motion carried (5-0). 2. PUBLIC INQUIRIES/INFORMATIONAL None. 3. RESPONSE TO PUBLIC INQUIRIES None. 4. STAFF COMMENTS A. Transportation Update ARDEN HILLS CITY COUNCIL – JULY 26, 2021 2 Interim Public Works Director Swearingen reported the Arden Hills 2021 PMP project was underway. He explained utility work on Glen Paul Avenue had been completed and the street was prepared for curb and gutter. He noted the utility work on Gerald Avenue was now underway which would disturb traffic during typical working hours from 7:00 a.m. to 7:00 p.m. He reported residents would continue to receive newsletters throughout the project. In addition, information regarding the 2021 PMP was available on the City’s website. Interim Public Works Director Swearingen stated the Hamline Avenue crosswalk improvements project was wrapping up and a final inspection would be conducted on Tuesday, July 27, 2021. Interim Public Works Director Swearingen provided the Council with an update on the I-35W MNDOT MNPASS project. Councilmember Holden stated she has heard from several residents that live on Glen Paul Avenue and they have appreciated all of the communication from the City. B. Night to Unite Update City Clerk Hanson stated Night to Unite would be held on Tuesday, August 3, 2021. She reported the City currently has 19 events registered. She encouraged residents to consider donating school supplies at their Night to Unite event. Councilmember Holden requested staff provide the Council with talking points regarding upcoming City streets and park projects to discuss with neighborhood residents. 5. APPROVAL OF MINUTES A. June 21, 2021, City Council Work Session B. June 28, 2021 Special Executive Session (Closed) C. June 28, 2021, Regular City Council MOTION: Councilmember Holden moved and Councilmember Holmes seconded a motion to approve the June 21, 2021, City Council Work Session meeting minutes, June 28, 2021, Special Executive Session (Closed) meeting minutes; and June 28, 2021, Regular City Council meeting minutes as presented. A roll call vote was taken. The motion carried (5-0). 6. CONSENT CALENDAR A. Motion to Approve Consent Agenda Item - Claims and Payroll B. Motion to Approve 2021 2nd Quarter Financials C. Motion to Approve Transfer Fund Balance from General Fund to PIR Capital Fund D. Motion to Adopt Resolution 2021-040 in Support of the City of Shoreview’s Bonding Request for the Lake Johanna Fire Department Station Project E. Motion to Approve Master Development Contract and Planned Unit Development Agreement – Chick-Fil-A – 3855 Lexington Avenue – Planning Case 21-011 ARDEN HILLS CITY COUNCIL – JULY 26, 2021 3 F. Motion to Adopt Resolution 2021-041 for Findings of Fact and Decision Regarding Variance at 3493 Siems Court – Planning Case 20-017 G. Motion to Approve Planned Unit Development Agreement – JAB Real Estate, LLC (Lifelong Wealth Advisors) – 1150 County Road E – Planning Case 21-014 H. Motion to Approve Assignment and Assumption of Development Agreement – JAB Real Estate, LLC (Lifelong Wealth Advisors) – 1150 County Road E – Planning Case 21-014 I. Motion to Approve Professional Services Agreement Amendment for Potable Water System Risk and Resilience Assessment – HR Green J. Motion to Adopt Resolution 2021-042 Receiving Feasibility Report and Calling for a Public Hearing – Arden Oaks Street Improvement Project K. Motion to Authorize Recruitment for Community Development Director MOTION: Councilmember Holden moved and Councilmember Holmes seconded a motion to approve the Consent Calendar as presented and to authorize execution of all necessary documents contained therein. A roll call vote was taken. The motion carried (5-0). 7. PULLED CONSENT ITEMS None. 8. PUBLIC HEARINGS None. 9. NEW BUSINESS None. 10. UNFINISHED BUSINESS None. 11. COUNCIL COMMENTS Mayor Grant reported Crumbl Cookies would be holding a grand opening on August 6, 2021 at 7:45 am. Councilmember Scott reminded residents that the last three days of the Ramsey County Mobile Hazardous Collection site would be this Friday through Sunday. He noted information regarding the items that would be collected free of charge was available on Ramsey County’s website. Councilmember Holmes stated on July 20, 2021 the Army and the US Fish and Wildlife Service held an open house where the restoration of Round Lake was discussed. ARDEN HILLS CITY COUNCIL – JULY 26, 2021 4 Councilmember Holmes commented on July 29, 2021 at 6:00 p.m. there would be a neighborhood meeting at North Heights Church to discuss a potential apartment complex on the North Heights property. Councilmember Holden stated she appreciated the fact the Army and the US Fish and Wildlife Service were addressing the restoration of Round Lake. Councilmember Holden requested the Council discuss City meetings at a future work session. Interim Public Works Director Swearingen reported the City was extremely short on its seasonal workers and noted staff was doing its best to keep up with park and trail maintenance. ADJOURN MOTION: Councilmember Holden moved and Councilmember Holmes seconded a motion to adjourn. A roll call vote was taken. The motion carried (5-0). Mayor Grant adjourned the Regular City Council Meeting at 7:17 p.m. __________________________ __________________________ Julie Hanson David Grant City Clerk Mayor CONSENT ITEM 6A MEMORANDUM DATE: August 23, 2021 TO: Honorable Mayor and City Councilmembers Dave Perrault, City Administrator FROM: Gayle Bauman, Finance Director Pang Silseth, Accounting Analyst SUBJECT: Claims and Payroll Listing Budgeted Amount: Actual Amount: Funding Source: N/A N/A N/A Council Should Consider Motion to approve, table or deny the following:  Claims and Payroll Listing All items need a simple majority for action unless otherwise noted. Background Payroll is processed biweekly and accounts payable is processed weekly. Budget Impact N/A Attachments 2021 Payroll #17 $78,009.07 Total Payroll $78,009.07 Paid Claims - 07/31/21 through 08/13/21 (Check Nos. 50242-50279 and ACH Checks) $1,538,554.32 Total Accounts Payable $1,538,554.32 Total Claims $1,616,563.39 CITY OF ARDEN HILLS PAYROLL # 17 CHECKS DATED: 08/20/21 Biweekly: 07/31/21 - 08/13/21 EMPLOYEE DEDUCTIONS AMT.Payment Method FIT 6,258.81 EFT SIT 2,778.74 EFT FICA Oasdi 4,035.76 EFT FICA Medicare 943.87 EFT TOTAL TAXES 14,017.18 Health Premium 1,528.96 A/P Check* Dental Premium 169.48 A/P Check* FSA Health Care Reimb. 0.00 A/P Check* FSA Dependent Care Reimb. 0.00 A/P Check* TOTAL FLEXIBLE SPENDING 1,698.44 HSA Health Saving 355.00 Health Care Savings Plan-Retirement 0.00 EFT Health Care Savings Plan-2% 430.82 EFT Health Care Savings Plan-4% 521.59 EFT TOTAL HEALTH SAVINGS 1,307.41 PERA 3,883.16 EFT ICMA 2,339.18 EFT Central Pension Fund-Union 614.40 A/P Check* MN State Retirement System 750.00 EFT TOTAL RETIREMENT 7,586.74 IUOE 49 Dues (Union) 140.00 A/P Check* LTD/STD Insurance 0.00 A/P Check* PERA Life Insurance 24.00 A/P Check* Life/Addl/Dep Life 33.74 A/P Check* Life/Addl non-tax 5.40 A/P Check* UNUM 19.51 A/P Check* AFLAC 22.76 EFT TOTAL VOLUNTARY 245.41 Total Employee Deductions 24,855.18 Net Payroll 0.00 Direct Deposit 43,271.96 EFT Gross Payroll Tie-Out 68,127.14 Plus City Paid Benefit 9,881.93 TOTAL PAYROLL COST 78,009.07 FICA TIE-OUT Gross Payroll 68,127.14 Less Total FSA 1,698.44 Less Total H.SA 1,307.41 Less Voluntary Ins 28.16 Net P/R Subject to FICA 65,093.13 FICA Oasdi @ 6.20% 4,035.76 FICA Medicare @ 1.45% 943.87 Note: Federal and State Payroll Tax obligations are satisfied by means of utilizing the US Bank Easy Tax Deposit Service. Transfers are typically made up to two days after the payroll date. * A/P Checks can be found on the ACCOUNTS PAYABLE Check Approval report. Checks may be paid this week or the following week. 0.00 0.00 0.00 4,480.56 421.74 4,902.30 0.00 0.00 4,979.63 0.00 0.00 CITY BENEFIT 4,035.76 943.87 Accounts Payable User: Printed: pang.silseth 8/18/2021 3:27 PM Checks by Date - Detail by Check Date Check No Check DateVendor NameVendor No Check Amount Invoice No ReferenceDescription ACH001 US BANK 07/31/2021ACH BAUMG72021 GFOA-PAFR Award Program 250.00 FRIDJ72021 AMZN MKTP US*294B21SJ0Parks & Rec Supplies 39.99 FRIDJ72021 AMZN MKTP US*2X12C6W62-Thermometer Guns 54.37 HANSJ72021 SurveyMonkey Subscription 06/21-06/22 384.00 HANSJ72021 MCFOA-BEST WESTERN HOTELS ST 234.26 MIKAT72021 ICloud Storage 0.99 MIKAT72021 MENARDS BLAINE MN-Supplies 85.53 MIKAT72021 NORTHERN TOOL EQUIP-Supplies 129.93 MIKAT72021 MENARDS BLAINE MN-Supplies 40.30 VAUGJ72021 MICHAELS STORES 3701-SUPPLIES 28.89 VAUGJ72021 TARGET-SUPPLES 57.18 VAUGJ72021 FUN EXPRESS-CRAFT MATERIALS 183.11 VAUGJ72021 TARGET-SUPPLIES 5.58 VAUGJ72021 TARGET-SUPPLIES 5.77 VAUGJ72021 TARGET-SUPPLIES 113.45 VAUGJ72021 MICHAELS STORES-CRAFT MATERIALS 32.18 WARDR72021 HOLIDAY CAR WASH 0368. 10.74 1,656.27Total for this ACH Check for Vendor ACH001: ACH002 AFLAC 07/31/2021ACH 475179 Insurance Premiums- July 2021 45.52 45.52Total for this ACH Check for Vendor ACH002: ACH003 PITNEY BOWES INC 07/31/2021ACH 6232021 June Postage-Newsletter 793.44 6232021 June Postage - fee 19.99 813.43Total for this ACH Check for Vendor ACH003: ACH005 MINNESOTA REVENUE-SALES & USE TAX07/31/2021ACH 62021 June Sales/Use Tax -0.12 62021 June Sales/Use Tax 33.12 33.00Total for this ACH Check for Vendor ACH005: ACH006 MN DEPT OF LABOR-BUILDING PERMIT SURCHARGE07/31/2021ACH 62021 Q2 Building Surcharge -157.75 62021 Q2 Building Surcharge 3,954.98 3,797.23Total for this ACH Check for Vendor ACH006: 6,345.45Total for 7/31/2021: 0022 THOMAS MIKACEVICH 08/06/2021ACH 8032021 Clothing Allowance Reimbursement 254.65 Page 1AP Checks by Date - Detail by Check Date (8/18/2021 3:27 PM) Check No Check DateVendor NameVendor No Check Amount Invoice No ReferenceDescription 254.65Total for this ACH Check for Vendor 0022: 0192 GRAINGER INC 08/06/2021ACH 9008640592 Marking Paint 76.62 9008640592 Marking Paint 76.62 153.24Total for this ACH Check for Vendor 0192: 0285 XCEL ENERGY 08/06/2021ACH 741658452 6/15/21-7/15/21 1,757.73 741658452 6/15/21-7/15/21 1,576.32 741658452 6/15/21-7/15/21 1,439.32 741658452 6/15/21-7/15/21 53.13 741658452 6/15/21-7/15/21 1,508.16 741658452 6/15/21-7/15/21 247.52 741658452 6/15/21-7/15/21 248.72 6,830.90Total for this ACH Check for Vendor 0285: 0292 OXYGEN SERVICE COMPANY INC 08/06/2021ACH 0003501081 June Rental 27.28 27.28Total for this ACH Check for Vendor 0292: 0319 CITY OF ROSEVILLE 08/06/2021ACH 0230238 Q2 2021 Water 340,023.81 340,023.81Total for this ACH Check for Vendor 0319: 0327 STAPLES INC 08/06/2021ACH 3481996453 Supplies 103.59 3481996453 Supplies 19.96 3482187984 Supplies 24.58 3482187988 Supplies 79.66 227.79Total for this ACH Check for Vendor 0327: 0382 ICMA RETIREMENT TRUST - 106944 08/06/2021ACH PR 21-16 PR Batch 00100.08.2021 ICMA Employer Percent 401PR Batch 00100.08.2021 ICMA Employer Percent 401 421.74 PR 21-16 PR Batch 00100.08.2021 ICMA Employee Percent 401PR Batch 00100.08.2021 ICMA Employee Percent 401 365.51 787.25Total for this ACH Check for Vendor 0382: 0387 ICMA RETIREMENT TRUST #302482 08/06/2021ACH PR 21-16 PR Batch 00100.08.2021 ICMA Employee PercentPR Batch 00100.08.2021 ICMA Employee Percent 231.65 PR 21-16 PR Batch 00100.08.2021 ICMA Employee DeductionPR Batch 00100.08.2021 ICMA Employee Deduction 1,736.54 1,968.19Total for this ACH Check for Vendor 0387: 0453 CONTINENTAL RESEARCH CORP 08/06/2021ACH 0025710 Cleaning Supplies 720.00 0027473 Cleaning Supplies 1,015.00 1,735.00Total for this ACH Check for Vendor 0453: 0549 ABLE HOSE & RUBBER LLC INC 08/06/2021ACH 225111-001 parts/supplies 350.36 350.36Total for this ACH Check for Vendor 0549: 10365 JENNIFER SHULL 08/06/2021ACH Page 2AP Checks by Date - Detail by Check Date (8/18/2021 3:27 PM) Check No Check DateVendor NameVendor No Check Amount Invoice No ReferenceDescription 8022021 Mileage Reimbursement 15.18 15.18Total for this ACH Check for Vendor 10365: 1223 ADAM'S PEST CONTROL - MAIN 08/06/2021ACH 3341617 Pest Control-Fall Invaders 450.00 3344028 Pest Control-August 71.59 521.59Total for this ACH Check for Vendor 1223: 1330 MN CLN SERVICES INC 08/06/2021ACH 0821NN01 Janitorial Services-July 2,005.58 2,005.58Total for this ACH Check for Vendor 1330: 1889 DAVID PERRAULT 08/06/2021ACH 2018-2020 941 2018-2020 941 Correction 1,183.22 1,183.22Total for this ACH Check for Vendor 1889: 4445 PIONEER RIM AND WHEEL CO 08/06/2021ACH 01CG1747 Supplies: Nuts & Bolts 25.32 01CG1748 Supplies: Nuts & Bolts 51.38 76.70Total for this ACH Check for Vendor 4445: 4447 BRAUN INTERTEC CORPORATION 08/06/2021ACH B260692 2021 PMP thru 7/23/21 3,290.50 3,290.50Total for this ACH Check for Vendor 4447: 5173 BADGER METER 08/06/2021ACH 80078997 Service Agreement 8/21-12/21 650.00 650.00Total for this ACH Check for Vendor 5173: 5596 ASDCO CONSTRUCTION SUPPLY 08/06/2021ACH 589906 Landscape Fabric 330.00 330.00Total for this ACH Check for Vendor 5596: 0131 BEISSWENGERS DO IT BEST 08/06/202150242 479513 Cleaning Supplies 102.96 102.96Total for Check Number 50242: 0447 I.U.O.E LOCAL 49 BENEFIT FUND-INSURANCE08/06/202150243 BP3.0921 September Insurance 10,600.00 NB4.0921 September Insurance 1,527.00 12,127.00Total for Check Number 50243: 10406 MINNESOTA UI FUND 08/06/202150244 07981814.0621 2020 Q2-2021 Q2 Unemployment Benefits -11,763.20 07981814.0621 2020 Q2-2021 Q2 Unemployment Benefits 10,278.40 07981814.0621 2020 Q2-2021 Q2 Unemployment Benefits 358.97 07981814.0621 2020 Q2-2021 Q2 Unemployment Benefits 642.40 07981814.0621 2020 Q2-2021 Q2 Unemployment Benefits 44.87 07981814.0621 2020 Q2-2021 Q2 Unemployment Benefits 179.48 07981814.0621 2020 Q2-2021 Q2 Unemployment Benefits 1,927.20 07981814.0621 2020 Q2-2021 Q2 Unemployment Benefits 314.10 Page 3AP Checks by Date - Detail by Check Date (8/18/2021 3:27 PM) Check No Check DateVendor NameVendor No Check Amount Invoice No ReferenceDescription 1,982.22Total for Check Number 50244: 1074 PRECISION LANDSCAPE & TREE INC 08/06/202150245 82533 Tree Removal:3745 McCracken Ln 3,000.00 3,000.00Total for Check Number 50245: 0811 RAMSEY COUNTY 08/06/202150246 PUBW-019265 Emergency Pre-Emption System Jan-Jun 2021 617.15 617.15Total for Check Number 50246: 0282 REPUBLIC SERVICES #899 08/06/202150247 0899-003754078 Recycling-July -944.05 0899-003754078 Recycling-July 8,282.00 0899-003757457 PW Waste-July 1,565.79 8,903.74Total for Check Number 50247: UNST UNITED STATES TREASURY 08/06/202150248 CP220-12/31/19 Form 941; 41-6008992 361.79 CP220-12/31/20 Form 941; 41-6008992 794.57 1,156.36Total for Check Number 50248: 388,320.67Total for 8/6/2021: 0189 GOPHER STATE ONE CALL 08/13/2021ACH 1070185 July Locates 129.60 1070185 July Locates 129.60 1070185 July Locates 129.60 388.80Total for this ACH Check for Vendor 0189: 0319 CITY OF ROSEVILLE 08/13/2021ACH 0230249 IT Support-August 6,803.72 6,803.72Total for this ACH Check for Vendor 0319: 0320 HEALTH PARTNERS INC 08/13/2021ACH 106658119 September Insurance 681.58 681.58Total for this ACH Check for Vendor 0320: 0339 FERGUSON WATERWORKS #2518 08/13/2021ACH 0479740 snakepit acc box 391.14 391.14Total for this ACH Check for Vendor 0339: 0469 PEMBER COMPANIES INC 08/13/2021ACH 12402 2021 Concrete Improv Pay 1 65,064.50 12402 2021 Concrete Improv Pay 1 -3,505.75 12402 2021 Concrete Improv Pay 1 5,050.50 66,609.25Total for this ACH Check for Vendor 0469: 10363 MINUTE MAKER SECRETARIAL 08/13/2021ACH M1313 July CC Meeting Minutes 338.00 Page 4AP Checks by Date - Detail by Check Date (8/18/2021 3:27 PM) Check No Check DateVendor NameVendor No Check Amount Invoice No ReferenceDescription 338.00Total for this ACH Check for Vendor 10363: 10442 SPRINGBROOK HOLDING COMPANY LLC08/13/2021ACH TM INV-004298 Meter Reading Upgrade 626.50 626.50Total for this ACH Check for Vendor 10442: 1115 WSB & ASSOCIATES INC 08/13/2021ACH R-010111-000-24 2018 PMP-June 456.00 R-017451-000-6 ESRI Cloud-EA Migration-June 139.00 R-017880-000-3 2021 GIS-June 1,815.00 2,410.00Total for this ACH Check for Vendor 1115: 1125 BOLTON & MENK INC 08/13/2021ACH 0271217 2021 PMP 3,425.00 0272915 2021 PMP 26,805.30 30,230.30Total for this ACH Check for Vendor 1125: 2279 NORMS TIRE SALES INC 08/13/2021ACH 58276 Tires-Liftgate Generator 409.28 409.28Total for this ACH Check for Vendor 2279: 7064 ROTARY CLUB OF ARDEN HILLS-SHOREVIEW08/13/2021ACH 2111 Q3 2021 Dues 98.50 98.50Total for this ACH Check for Vendor 7064: 7501 KELLY & LEMMONS PA 08/13/2021ACH 56302 July Prosecution 3,953.75 3,953.75Total for this ACH Check for Vendor 7501: ALPI ALLEGRA PRINT & IMAGING INC 08/13/2021ACH 163532 July Newsletter 2,767.67 2,767.67Total for this ACH Check for Vendor ALPI: FPTC FLEXIBLE PIPE TOOL COMPANY INC 08/13/2021ACH 26501 Aries Tractor Repair 549.20 549.20Total for this ACH Check for Vendor FPTC: TOII TOKLE INSPECTIONS INC 08/13/2021ACH 08032021 Electrical Inspections-July 2,580.00 2,580.00Total for this ACH Check for Vendor TOII: ADVS ADVANTAGE SIGNS & GRAPHICS INC 08/13/202150249 00048169 Channel Posts 228.00 228.00Total for Check Number 50249: 10379 LESLIE ASHBACH 08/13/202150250 3192020 Refund: Egg Hunt 8.00 8.00Total for Check Number 50250: ATLA ATLAS FOUNDATION CO 08/13/202150251 2021-00791 Hydrant Rental Refund 1,909.36 Page 5AP Checks by Date - Detail by Check Date (8/18/2021 3:27 PM) Check No Check DateVendor NameVendor No Check Amount Invoice No ReferenceDescription 1,909.36Total for Check Number 50251: 10466 C&L EXCAVATING INC 08/13/202150252 PW-21-0100 Pay2 2021 PMP Pmt 2 871,891.27 PW-21-0100 Pay2 2021 PMP Pmt 2 -43,594.56 828,296.71Total for Check Number 50252: UB*00399 PATIENCE CASO 08/13/202150253 08092021 Refund Check 003155-000, 1225 Ingerson Road 41.78 41.78Total for Check Number 50253: 1033 COMCAST 08/13/202150254 101030.0821 Service-August 108.35 98681.0821 Service-August 109.71 218.06Total for Check Number 50254: 10244 COMCAST BUSINESS INC 08/13/202150255 127925198 Service-August 495.64 495.64Total for Check Number 50255: 0176 FRATTALLONES HARDWARE INC 08/13/202150256 093534/A Supplies 2.99 2.99Total for Check Number 50256: 1193 FURTHER INC 08/13/202150257 15789149 Participant Fee-August 41.25 41.25Total for Check Number 50257: UB*00435 ANGELA HAMES 08/13/202150258 08092021 Refund Check 001065-000, 1812 Venus Avenue 7.06 7.06Total for Check Number 50258: UB*00394 WENDY HAMILTON 08/13/202150259 08092021 Refund Check 000158-000, 4440 Hamline Avenue N 2.88 2.88Total for Check Number 50259: 5701 HIGH TIDE TECHNOLOGIES LLC 08/13/202150260 INV20214436 Annual Communications Renewal 930.00 930.00Total for Check Number 50260: UB*00490 JARRETT & BARBARA HOLBROOK 08/13/202150261 Refund Check 011681-000, 1863 Glenpaul Avenue 179.94 179.94Total for Check Number 50261: 0390 INT'L UNION OPERATING ENGINEERS-UNION DUES08/13/202150262 1200.0821 August Dues 280.00 280.00Total for Check Number 50262: UB*00419 ERICA ISAAC 08/13/202150263 08092021 Refund Check 002221-000, 1556 Arden Place 23.06 Page 6AP Checks by Date - Detail by Check Date (8/18/2021 3:27 PM) Check No Check DateVendor NameVendor No Check Amount Invoice No ReferenceDescription 23.06Total for Check Number 50263: 10448 MARCO TECHNOLOGIES LLC 08/13/202150264 449555580 Copier 7/25-8/25 200.35 449555580 Copier 7/25-8/25 35.36 235.71Total for Check Number 50264: 5696 MAYER ARTS INC 08/13/202150265 3343 Hamilton Camp 1,728.00 1,728.00Total for Check Number 50265: 10236 MINNESOTA PETROLEUM SERVICE 08/13/202150266 0000091493 Mechanics Hoist Repair 4,797.50 4,797.50Total for Check Number 50266: 10271 MN PEIP 08/13/202150267 1110983 September Insurance 7,755.84 7,755.84Total for Check Number 50267: UB*00432 CHRISTIAN MUELLER 08/13/202150268 08092021 Refund Check 011876-000, 4651 Highway 10 2.76 2.76Total for Check Number 50268: 10216 NORTHWEST ASPHALT INC 08/13/202150269 R-010111-000 P1 2018 PMP-Final Pay 11 9,652.64 R-010111-000 P1 2018 PMP-Final Pay 11 7,152.05 R-010111-000 P1 2018 PMP-Final Pay 11 125,453.02 R-010111-000 P1 2018 PMP-Final Pay 11 3,871.77 R-010111-000 P1 2018 PMP-Final Pay 11 23,328.80 169,458.28Total for Check Number 50269: 10250 PEAK STAFFING INC 08/13/202150270 47571 Office Support 7/26-7/30 150.00 47571 Office Support 7/26-7/30 112.50 47571 Office Support 7/26-7/30 825.00 47571 Office Support 7/26-7/30 112.50 47571 Office Support 7/26-7/30 112.50 47571 Office Support 7/26-7/30 150.00 47571 Office Support 7/26-7/30 37.50 1,500.00Total for Check Number 50270: 1208 PREMIUM WATERS INC 08/13/202150271 610207-07-21 September Water 37.98 613317-07-21 September Water 48.48 86.46Total for Check Number 50271: 3100 PROVIDENT LIFE AND ACCIDENT INS CO08/13/202150272 E0471136.0721 July Insurance 39.02 39.02Total for Check Number 50272: 0811 RAMSEY COUNTY 08/13/202150273 EMCOM-009428 Fleet Support-July 24.96 Page 7AP Checks by Date - Detail by Check Date (8/18/2021 3:27 PM) Check No Check DateVendor NameVendor No Check Amount Invoice No ReferenceDescription EMCOM-009464 Dispatch-July 3,978.60 EMCOM-009481 CAD-July 544.99 4,548.55Total for Check Number 50273: UB*00489 DAVID SPEED 08/13/202150274 Refund Check 001777-000, 1975 Jerrold Avenue 7.40 7.40Total for Check Number 50274: SRFC SRF CONSULTING GROUP INC 08/13/202150275 14320.00-6 MVHS Trail Improv-July 319.52 319.52Total for Check Number 50275: 10354 ST. PAUL PIONEER PRESS 08/13/202150276 0721572589 Publication Ord 2021-004 91.80 0721572589 Notice PC 21-018 Shoreland Ord 44.10 0721572589 Notice PC 21-016 #587 36.00 0721572589 Notice PC 21-017 #593 37.80 209.70Total for Check Number 50276: 1557 VAN IWAARDEN ASSOCIATES 08/13/202150277 08042021 GASB 75 Alternative 240.00 08042021 GASB 75 Alternative 240.00 08042021 GASB 75 Alternative 240.00 08042021 GASB 75 Alternative 240.00 08042021 GASB 75 Alternative 240.00 1,200.00Total for Check Number 50277: 9755 VERIZON CONNECT NWF INC 08/13/202150278 OSV000002513494 Service-July 323.80 323.80Total for Check Number 50278: UB*00403 XIANJU ZHENG 08/13/202150279 08092021 Refund Check 011444-000, 1929 County Road E2 W 173.24 173.24Total for Check Number 50279: 1,143,888.20Total for 8/13/2021: Report Total (76 checks): 1,538,554.32 Page 8AP Checks by Date - Detail by Check Date (8/18/2021 3:27 PM) Page 1 of 1 CONSENT ITEM – 6B MEMORANDUM DATE: August 23, 2021 TO: Honorable Mayor and City Councilmembers Dave Perrault, City Administrator FROM: Joe Vaughan, Recreation Programmer SUBJECT: Accepting Donation from the Arden Hills Foundation Budgeted Amount: Actual Amount: Funding Source: N/A $650.00 N/A Council Should Consider Motions to approve, table, or deny the following: • City Council should consider to approve Resolution 2021-045 Accepting a Donation from the Arden Hills Foundation in the amount of $650.00. All items need a simple majority for action unless otherwise noted. Background The Arden Hills Foundation has been established as a 501c3 organization. Pursuant to Minnesota Statutes Section 465.03 for the benefit of its citizens, cities are authorized to accept gifts and bequests for the benefits of recreational services. Discussion The Arden Hills Foundation has donated $650.00 to the City of Arden Hills for a new park bench to be placed in the Crepeau Nature Preserve. This donation was given to the Arden Hills Foundation from John Van Valkenburg, Nancy O’Malley, Joanne Messerly, and from a fundraiser organized by Rich Straumann. To comply with State Statutes, the City needs to acknowledge the donation and issue receipt of the donation to the Arden Hills Foundation. Budget Impact N/A Attachments Attachment A: Resolution 2021-045 To view the final document, access adopted Resolutions via Arden Hills Public Laserfiche Weblink by visiting cityofardenhills.org and clicking on Archived Documents under Helpful Links on our main webpage. CITY OF ARDEN HILLS COUNTY OF RAMSEY STATE OF MINNESOTA RESOLUTION NO. 2021-045 A RESOLUTION ACCEPTING DONATION WHEREAS, Arden Hills (“City”) is generally authorized to accept donations of real and personal property pursuant to Minnesota Statutes Section 465.03 for the benefit of its citizens, and is specifically authorized to accept gifts and bequests for the benefit of recreational services pursuant to Minnesota Statutes Section 471.17; and WHEREAS, The following entity has offered to contribute the cash amount set forth below to the city: Name of Donor Amount Arden Hills Foundation $650.00 WHEREAS, All such donations have been contributed to assist the City in the establishment and operation of recreational facilities and programs either alone or in cooperation with others, as allowed by law; and WHEREAS, The City Council finds that it is appropriate to accept the donations offered. NOW, THEREFORE, BE IT RESOLVED BY THE CITY COUNCIL OF THE CITY OF ARDEN HILLS, MINNESOTA, THAT: 1. The donation described above is accepted and shall be used to establish recreational facilities either alone or in cooperation with others, as allowed by law. 2. The city clerk is hereby directed to issue receipts to each donor acknowledging the City’s receipt of the donor’s donation. 3. The finance department is hereby authorized to complete any budget adjustments necessary to reflect this donation and corresponding expenditures. PASSED AND ADOPTED BY THE CITY COUNCIL OF THE CITY OF ARDEN HILLS THIS 23rd DAY OF AUGUST, 2021. _______________________________ David Grant, Mayor ATTEST: ______________________________________ Julie Hanson, City Clerk Page 1 DATE: August 23, 2021 TO: Honorable Mayor and City Councilmembers FROM: Dave Perrault, City Administrator SUBJECT: Appointment of Brandon Patterson to the Building Inspector/Code Enforcement Officer Position Budgeted Amount: Actual Amount: Funding Source: N/A N/A N/A Council Should Consider Motions to approve, table, or deny the following: •Appointment of Brandon Patterson to the position of Building Inspector/Code Enforcement Officer at Grade 12 Step 1 on the City’s pay scale, and at Year Zero on the PTO scale. All items need a simple majority for action unless otherwise noted. Discussion Brandon Patterson is the finalist for the Building Inspector/Code Enforcement Officer position, he recently obtained his Building Inspection Technology Certificate from North Hennepin Community College. Following many years in the HVAC industry Mr. Patterson is making the shift into the Building Official field. Mr. Patterson has already gained some valuable experience working with a contract Building Inspection company. Budget Impact This position is a previously budgeted position and will not adversely affect the 2021 budget. Attachment N/A CONSENT ITEM – 6C MEMORANDUM Page 1 DATE: August 23, 2021 TO: Honorable Mayor and City Councilmembers FROM: Dave Perrault, City Administrator SUBJECT: Accept Resignation of the Communications Coordinator Budgeted Amount: Actual Amount: Funding Source: N/A N/A N/A Council Should Consider Motions to approve, table, or deny the following: •Accept the resignation of the Communications Coordinator, Gretchen Needham. All items need a simple majority for action unless otherwise noted. Discussion The Communications Coordinator, Gretchen Needham, has submitted her resignation and had a last day of August 19, 2021. Budget Impact N/A Attachment N/A CONSENT ITEM – 6D MEMORANDUM Page 1 of 2 DATE: August 23, 2021 TO: Honorable Mayor and City Councilmembers FROM: Dave Perrault, City Administrator SUBJECT: Authorization to Begin Recruitment Process for a Communications Coordinator Budgeted Amount: Estimated Amount: Funding Source: N/A N/A N/A Council Should Consider Motions to approve, table, or deny the following: •Authorizing staff to begin the recruitment process for a Communications Coordinator. All items need a simple majority for action unless otherwise noted. Background The City currently has a vacancy for a Communications Coordinator. The City Council is asked to allow staff to being the recruitment process for the position, the attached job description is what would be used for the posting. Anticipated process: -Council approves authorization to begin the recruitment process -Staff posts for the position and reviews candidates -Staff reviews applications and selects interview candidates -Staff will conduct a first round of interviews and select final round candidates -Staff will conduct a final interview. -Staff will bring forward a finalist for official Council approval Councilmembers have previously expressed an interest in being part of the interview panel for certain positions at City Hall, currently no Councilmembers are slated to be on the interview panel for this position; should Council want to designate Councilmembers to attend they should do so with this authorization (it would need to be pulled from consent and approved). CONSENT – 6E MEMORANDUM Page 2 of 2 Budget Impact This position will not adversely affect the 2021 budget as it is replacing a previously budgeted position. Attachments Attachment A: Communications Coordinator Job Description 1 CITY OF ARDEN HILLS POSITION DESCRIPTION Position Title: Communications Coordinator Department: Administration Accountable to: City Clerk Positions Supervised: None Status: Part-time 20 – 25 hours per week August 2020 PRIMARY OBJECTIVES The Communications Coordinator is responsible for writing and coordinating day-to-day communications activities on behalf of the City of Arden Hills to City Departments, other governmental organizations, media outlets, community groups and citizens. The position will apply professional principles and judgment to assist with planning, leadership, and communications for the City of Arden Hills. QUALIFICATION REQUIREMENTS To perform this job successfully, an individual must be able to perform each essential function satisfactorily. The requirements listed below are representative of the knowledge, skill, and/or ability required. Reasonable accommodations may be made to enable individuals with disabilities to perform the essential functions. ESSENTIAL FUNCTIONS OF THE POSITION Coordinate the City’s print, digital, cable, and web services to meet the goals, objectives, and timelines of the City Council and departments. Create and write original content and maintain consistent/uniform communications for the City’s news outlets, including the City’s newsletters press releases, and official mailings, which includes information gathering and interviewing internal staff and external organizations to develop newsletter articles, press releases, website postings, social media updates, etc. Note: this position will be expected to write the content of the City’s messaging, including, but not limited to, the City’s newsletter. Design, compile, and finalize the City’s newsletter and work with the City’s printing company to finalize and distribute the newsletter throughout the City. Stay up to date with City activities to include reviewing past and future meetings of the City Council and the City’s other commissions and committees, daily communication with other departments regarding newsworthy items, and monitoring outside news outlets and social media mediums for trending issues related to the City. Write, copy, coordinate, and update the City’s website as needed to ensure up-to-date information is being distributed as required. Ensure the City is compliant with Federal, State, and Local laws relating to the City’s communication to include website accessibility for individuals with disabilities (Section 508). Assist in the development and implementation of the City’s communication plan to include routine and ad hoc communications. Respond to media inquiries at the direction of the City Administrator or responsible Department Head. 2 Assist the Community Development Department in creating, writing, and distributing information regarding the State of the City, open houses, and other informational events put on by the City. Assist in coordinating the communications effort surrounding large projects, specifically, the TCAAP redevelopment project while working with outside parties (other government agencies, real estate development firms, etc.) to ensure a clear and consistent message is presented by the City. Manage the City’s social media presence to include Facebook, Twitter, and YouTube etc. Other duties as assigned. EDUCATION and/or EXPERIENCE Bachelor's degree with coursework in communications, journalism, public relations, business administration or equivalent combination of education and experience. Master’s degree preferred. Minimum of three to five years experience in a communications role. KNOWLEDGE, SKILLS AND ABILITIES Knowledge of the modern principles, practices, and methods involved in planning and implementing a communications program. Practical knowledge of information dissemination, graphic design, and media creation, such as, press releases, internal memos, and content layout. Skilled in desktop publishing, modern office equipment, web maintenance, and related software. Excellent writing skills. The ability to collaborate with other departments and take the lead on special projects. PHYSICAL DEMANDS This work requires the occasional exertion of up to 10 pounds of force; work regularly requires sitting, using hands to finger, handle or feel and repetitive motions, frequently requires speaking or hearing and occasionally requires standing, walking, reaching with hands and arms, pushing or pulling and lifting; work has standard vision requirements; vocal communication is required for expressing or exchanging ideas by means of the spoken word; hearing is required to perceive information at normal spoken word levels; work requires preparing and analyzing written or computer data, operating machines and observing general surroundings and activities; work has no exposure to environmental conditions; work is generally in a moderately noisy location (e.g. business office, light traffic). SPECIAL REQUIREMENTS Valid driver's license. SELECTION GUIDELINES Formal application, rating of education and experience; oral interview and reference check; job related tests may be required. The duties listed above are intended only as illustrations of the various types of work that may be performed. The omission of specific statements of duties does not exclude them from the position if the work is similar, related or a logical assignment to the position. CITY OF ARDEN HILLS IS AN EQUAL OPPORTUNITY EMPLOYER ___________________________________________________________________ NON-DISCRIMINATION POLICY The City of Arden Hills does not discriminate on the basis of handicapped status in the admission or access to or treatment or employment in its programs and activities. __________________________________________________________________ Page 1 of 3 DATE: August 23, 2021 TO: Honorable Mayor and City Councilmembers Dave Perrault, City Administrator FROM: Larry Poppler, TKDA - Municipal Engineer David Swearingen, Interim Public Works Director SUBJECT: Arden Oaks Street Improvements – Accept Feasibility Report & Order Improvement Public Hearing Budgeted Amount: Actual Amount: Funding Source: $827,000 $583,000 PIR, Surface Water, Sanitary, (Estimated) Water, Special Assessments Council Should Consider Motions to approve, table, or deny the following: • Conducting Improvement public hearing for the proposed Arden Oaks Street Improvements project in accordance with City Council Resolution 2021-042. The City Council will be requested to make a formal decision regarding ordering the specific improvements and ordering project plans and specifications under Agenda Item 9A. All items need a simple majority for action unless otherwise noted. Background/Discussion On July 26, 2021, the City Council adopted Resolution 2021-042 receiving the feasibility report and calling for a public hearing to consider proposed improvements for the Arden Oaks Street Improvements Project. A complete copy of the feasibility report is provided on the City project webpage https://www.cityofardenhills.org/1035/Arden-Oaks-Street-Improvements (scroll down to Project Feasibility Report). Projects involving special assessments generally require two public hearings commonly known as an improvement hearing and an assessment hearing. The subject hearing for August 23 is the improvement hearing. The purpose of the improvement hearing is for the City Council to discuss a specific local improvement before ordering it done. The second public hearing is the assessment hearing which is scheduled after the project has received contractor bids to provide property owners an opportunity to express concerns about the actual special assessments. PUBLIC HEARINGS – 8A MEMORANDUM Page 2 of 3 At the improvement hearing, interested persons may voice their opinion regarding the proposed project improvements and whether or not they are in the proposed assessment area. A reasonable estimate of the total amount to be assessed and the description of the methodology used to calculate individual assessments for affected parcels is contained within the feasibility report, a copy of which is available for review on the City’s website. Pursuant to Minnesota Statutes, Chapter 429, notices of the public hearing were published in the Pioneer Press on August 4, 2021 and August 11, 2021. A notice was also mailed to each property within the draft assessment roll area on August 4, 2021. Prior to opening the hearing, the City’s engineering consultant TKDA, will present general information regarding the scope of the proposed improvements, the overall cost and funding for the project, and assessments that apply for this project. The proposed improvements are generally summarized below and described in greater detail within the feasibility study report provided in Attachment B. Street Improvements: The following streets are proposed for improvements: • Arden Oaks Drive between (between Snelling Avenue North and County Road E West) • Arden Oaks Court (from Arden Oaks Drive to the end of the Cul-de-sac) Considering the existing condition, deterioration factors, and geotechnical investigation, a full depth pavement reclamation is proposed for the streets. Full depth reclamation will provide a new structural aggregate base and disrupt the existing frost heaving that has breached the existing aggregate base and bituminous surface. This improvement will provide a new paving surface that should last 30 to 40 years (with future maintenance and mill and overlay improvements). Curb and Gutter: Existing curb and gutter will remain in place except for curb that is damaged, settled, or not draining properly. The existing curb will be inspected and marked for removal prior to construction. It is typical to see between 20% to 30% curb replacement for residential roadways of this age due to settlement or cracking. Utilities: It is recommended that all the manhole and catch basin rings be replaced as a part of the pavement rehabilitation project. It is typical to reset all manhole and catch basin grades to match the new grades of the roadway to improve drivability and drainage. In addition to the adjustment rings, outdated and damaged manhole and catch basin casting assemblies will be replaced with modern castings. Storm sewer manholes and catch basins and sanitary manholes will be adjusted with all new concrete rings. Sanitary sewer manholes will be recast with all new concrete rings and infiltration prevention products to limit inflow and infiltration into the sanitary system. Page 3 of 3 Preliminary Project Schedule: Budget Impact Proposed project funding sources are a combination of the City’s Permanent Improvement Revolving (PIR) fund, utility funds, and special assessments for street improvements summarized in the following table: The total estimated cost of the recommended improvements is $583,000. A portion of this project is proposed to be assessed to the benefiting property owners and the remainder through other funding sources. In accordance with the City’s Assessment policy, the preliminary assessment for the recommended improvement is calculated at $6,560 per unit. As the project is competitively bid by contractors, the calculated assessment amount will be updated leading up to the adoption of the assessment roll. The project funding is further described on pages 10 through 12 of the feasibility report. Attachments Attachment A: Presentation Slides for Public Hearing Attachment B: Feasibility Report Arden Oaks Street ImprovementsAugust, 2021 Attachment A Introductions• Larry Poppler, TKDA Project Managerlarry.poppler@tkda.com952-292-1098• David Swearingen, Interim Public Works Directordswearingen@cityofardenhills.org651-792-7847 Presentation Agenda• Existing Conditions• Proposed Improvements• Public Input• Project Funding• Assessments• Project Schedule• Recommendations• Next Steps Existing Conditions• Street improvement length 0.52 Miles• Originally constructed in the mid to late 1980s• Mill and overlay occurred in 1996• Pavement rating in the low 30s out of 100 • Concrete curb and gutter in good condition• Existing pavement depth 5-6 1/2 inches• Gravel Base 5-13 inches• Clay with sand beneath roadway Proposed Improvements• Street surface bituminous rehabilitation – considerations (Mill and Overlay, Full reconstruction, Reclamation)• Pavement Reclamation recommended option• Watermain valve adjustments • Sanitary sewer manhole ring replacement• Storm sewer manhole ring replacement• Curb and gutter replacement as necessary Pavement Reclamation ProcessReclamationRemoval of Excess Material Pavement Reclamation ProcessCurb RepairShaping and Compacting Road Base Pavement Reclamation ProcessFinal GradingPaving Construction Details Construction Details Public Input• Questionnaire sent to 40 properties• 70% Questionnaire Return Rate!• Identified Topics of Interest– Localized Drainage Issues– Pedestrian Safety – Crossings for Old Snelling Avenue and County Road E – County Decision– Truck Access and cut through traffic Estimated CostsFull Depth Reclamation Estimated CostsStreet Improvements $ 413,197.50Indirect Costs for Street Improvements (27%)* $ 111,563.33Total Costs for Street Improvements $ 524,760.83Storm Sewer Improvements $ 33,150.00Indirect Costs for Storm Sewer Improvements (27%)* $ 8,950.50Total Costs for Storm Sewer Improvements $ 42,100.50Sanitary Sewer Improvements $ 9,750.00Indirect Costs for Sanitary Sewer Improvements (27%)* $ 2,632.50Total Cost for Sanitary Sewer Improvements $ 12,382.50Water Improvements $ 2,450.00Indirect Costs for Water Improvements (27%)* $ 661.50Total Cost for Water Improvements $ 3,111.50Total Improvement Cost $ 458,547.50Total Indirect Costs for City (27%)* $ 123,807.83Total Project Cost $ 582,355.33Total project cost (rounded) $ 583,000.00 Assessment Policy• Residential zoned R-1 property assessed on a Unit basis (properties with Arden Oaks Drive/Court street address)• Assessment rate of 50% of street costs including all overhead costs. • Utility work not assessed Assessment SummaryAssessment Term - 10 years Interest Rate – Undetermined (2020 Rate 3.15%) Full Depth ReclamationTotal Project Cost $ 583,000 Assessable Amount $ 524,800 Assessment (50% of Assessable Amount) $ 262,400 Single Family Dwelling Units 40 UnitsUnit Assessment (Assessable amount/ 40 Units)$ 6,560 /Unit Assessment Area Amortization Schedules Full Depth ReclamationPrincipal: $6,560.00Interest Rate: 3.15%Payment Interval: AnnuallyNumber of Payments: 10Schedule of PaymentsPlease allow for slight rounding differences.*Payment 1 includes 21 months of interest.Pmt # Date Principal Interest Payment Balance2022 $ 6,560.00 1 2023 $ 656.00 $ 361.62* $ 1,017.62 $ 5,904.00 2 2024 $ 656.00 $ 185.98 $ 841.98 $ 5,248.00 3 2025 $ 656.00 $ 165.31 $ 821.31 $ 4,592.00 4 2026 $ 656.00 $ 144.65 $ 800.65 $ 3,936.00 5 2027 $ 656.00 $ 123.98 $ 779.98 $ 3,280.00 6 2028 $ 656.00 $ 103.32 $ 759.32 $ 2,624.00 7 2029 $ 656.00 $ 82.66 $ 738.66 $ 1,968.00 8 2030 $ 656.00 $ 61.99 $ 717.99 $ 1,312.00 9 2031 $ 656.00 $ 41.33 $ 697.33 $ 656.00 10 2032 $ 656.00 $ 20.66 $ 676.66 $ -Grand Total$ 6,560.00 $ 1,291.50 $ 7,851.50 $ - Project FundingFunding Breakdown Full Depth Reclamation AmountPermanent Improvement Revolving Fund (PIR) $263,007Special Assessments $262,400Utility Fund – Storm Sewer Fund $ 42,100Utility Fund – Sanitary Sewer Fund $ 12,382Utility Fund – Water Fund $ 3,111TOTAL $583,000 Project Process• Questionnaires Æcomplete• Feasibility Report Æcomplete• Power Point Presentation • Public Hearing / Order Project• Prepare Plans• Approval of Plans / Authorize Bidding• Assessment Hearing• Award of Construction Contract• Construction• Certification of Assessment ScheduleActivity DateAuthorize Preparation of Feasibility Report April 26, 2021City Council Work Session July, 19, 2021Accept Feasibility Report July 26, 2021Public Hearing / Order Improvements August 23, 2021Accept Plans and Specifications and Authorize Bidding January, 2022Bid Opening February, 2022Accept Bids and Authorize Assessment Hearing March, 2022Assessment Hearing / Adopt Assessment Roll / Award Contract April, 2022Commencement of Construction May, 2022Substantial Completion of Construction September, 2022Certify Assessments to County November, 2022Warranty Inspection June, 2023 Communications• City Website:https://www.cityofardenhills.org/216/Road-Construction-Projects• Letters & Questionnaires• Project Newsletters & Special Notices• Mass E-mail or Individual Meetings or Communication Recommendation / Next Steps• Full Reclamation Recommended• Public Hearing – August 23, 2021• Ordering the Project – August 23, 2021• Preparation of Plans – Fall 2021• Bidding – Winter 2022• Construction – Spring of 2022 Contact Information• Larry Poppler, TKDA Project Managerlarry.poppler@tkda.com952-292-1098• David Swearingen, Interim Public Works Directordswearingen@cityofardenhills.org651-792-7847 Thank You! Feasibility Report TKDA Project No. 18196.000 City of Arden Hills Page 1 Feasibility Report Arden Oaks Neighborhood Improvements City of Arden Hills, Minnesota City Project No. PW-21-0109 TKDA Project No. 18196.000 July 20, 2021 $WWDFKPHQW% 3$*(,17(17,21$//</()7%/$1. Feasibility Report TKDA Project No. 18196.000 City of Arden Hills Page 2 Arden Oaks Neighborhood Improvements Feasibility Report City of Arden Hills, Minnesota City Project No. PW-21-0109 TKDA No. 18196.000 July 20, 2021 I hereby certify that this report was prepared by me or under my direct supervision, and I am a duly Licensed Professional Engineer under the laws of the State of Minnesota. Larry Poppler Professional Engineer Date: July 20, 2021 Lic. No.: 41005 TKDA 444 Cedar Street – Suite 1500 Saint Paul, MN 55101 3$*(,17(17,21$//</()7%/$1. Feasibility Report TKDA Project No. 18196.000 City of Arden Hills Page 3 Summary Arden Oaks Neighborhood Improvements: Pavement rehabilitation, concrete curb and gutter repair, casting replacement and adjustment, and appurtenant work on the following areas: x Arden Oaks Drive between (between Snelling Avenue North and County Road E West) x Arden Oaks Court (from Arden Oaks Drive to the end of the Cul-de-sac) 3$*(,17(17,21$//</()7%/$1. Feasibility Report TKDA Project No. 18196.000 City of Arden Hills Page 4 Table of Contents Certification Page .................................................................................................................................. 2 Summary ............................................................................................................................................... 3 Table of Contents .................................................................................................................................. 4 Introduction .......................................................................................................................................... 5 Background .......................................................................................................................................... 5 Arden Oaks Neighborhood Existing Conditions .............................................................................. 6 Arden Oaks Neighborhood Proposed Improvements ..................................................................... 8 Resident Input ...................................................................................................................................... 9 Project Funding .................................................................................................................................10 Estimated Costs ....................................................................................................................... 10 Assessment Policy ................................................................................................................... 11 Assessment Calculation and Estimation .................................................................................. 11 Funding Sources ...................................................................................................................... 11 Preliminary Project Schedule ...........................................................................................................12 Conclusion and Recommendation ..................................................................................................12 List of Tables Table 1 Coring Log ................................................................................................................................ 8 Table 2 Project Cost ............................................................................................................................10 Table 3 Assessment Calculation .........................................................................................................11 Table 4 Project Funding ......................................................................................................................11 Table 5 Project Schedule ....................................................................................................................12 List of Exhibits Forensic Pavement Report ........................................................................................................ Exhibit 1 Resident Input ............................................................................................................................ Exhibit 2 Typical Cross Sections .............................................................................................................. Exhibit 3 Engineer's Estimate ................................................................................................................... Exhibit 4 Preliminary Assessment Rolls ................................................................................................... Exhibit 5 Assessment Map ....................................................................................................................... Exhibit 6 Geotechnical Report .................................................................................................................. Exhibit 7 15% Street Improvement Plans ................................................................................................. Exhibit 8 3$*(,17(17,21$//</()7%/$1. Feasibility Report TKDA Project No. 18196.000 City of Arden Hills Page 5 Feasibility Report Arden Oaks Neighborhood Improvements Prepared for City of Arden Hills, Minnesota Introduction: On April 26, 2021, the Arden Hills Council adopted Resolution 2021-23 which ordered the preparation of a Feasibility Report for improvements to the project areas listed below. Arden Oaks Neighborhood: Bituminous paving, storm water improvements, concrete curb and gutter repair, and appurtenant work on the following areas: x Arden Oaks Drive (Snelling Avenue North and County Road E West) x Arden Oaks Court (from Arden Oaks Drive to the end of the Cul-de-sac) Located within Section 27-SW, Township 30N, Range 23W, as described on 2 plats: Arden Oaks and Shady Oaks Addition. This report evaluates the feasible street improvements for Arden Oaks neighborhood. All existing infrastructure elements were evaluated, improvements recommended, cost estimates of the proposed improvements prepared and funding strategies developed in this report. Based on the analysis of the existing conditions, a full depth street reclamation is recommended. Background: The City of Arden Hills currently utilizes pavement rating data, pavement forensic data, soil boring information, and the Capital Improvement Plan (CIP) to prioritize the infrastructure improvement needs within the city. As reported in the Arden Hills pavement forensic report and the CIP both Arden Oaks Drive and Arden Oaks Court are recommended for street improvements in 2022. The Arden Oaks neighborhood is a single-family residential neighborhood and is proposed for improvement from Snelling Avenue South to County Road E West. Improvements would include pavement rehabilitation, curb repair, and storm water infrastructure improvements as needed. The forensic pavement report showing the Arden Oaks Neighborhood rehabilitation plan can be found on Exhibit 1 in the appendix. Feasibility Report TKDA Project No. 18196.000 City of Arden Hills Page 6 Arden Oaks Existing Conditions: Streets Conditions: The majority of properties located within the Arden Oaks residential neighborhood were platted in the mid to late 1980s. According to the City’s CIP and city records, the last major maintenance task was a mill and overlay in 1996. Since then it appears the street section has been treated with chip seals, crack seals, hot patching, and partial overlays several times in the years since. The most recent maintenance appears to be a street overlay in select areas coating the outside edges of the roadway with a 1” to 1.5” lift of bituminous. According to the CIP, the Arden Oaks neighborhood is scheduled for major maintenance in 2022. Many factors have accounted for roadway deterioration including the following: x Time and weather (freeze/thaw cycle) x Underlying soil conditions x Traffic volumes x Roadway pavement section x Heavy vehicle loading x Surface and subsurface water drainage The City completes pavement ratings for local streets and has noted the ratings for the streets in this neighborhood were in the low 30s out of a 100-scale rating. During the field inspection of the neighborhood, many roadway deficiencies were noted including large frost cracks (through both curb and street sections), fatigue cracks, pot holes, and minor drainage issues. The rideability is also very poor. It was also noted many defects have been patched or filled recently. Additionally, it has been observed seasonal ground water is discharged from sump pumps or is seeping from the ground behind the curb. Although the geotechnical report did not explicitly note high ground water in the area, there are signs of it from field observations. The geotechnical report completed by WSB found that the pavement section in the Arden Oaks neighborhood ranged from 5 to 6-1/2 inches in depth. Additionally, suitable aggregate base material was found over the entire area of the Arden Oaks neighborhood ranging in depth from 5 to 13 inches. Underlain soils were typically sandy lean clay with gravel. The geotechnical report is located in the appendix in Exhibit 7; additionally the typical cross sections for the Arden Oaks neighborhood can be found under Exhibit 3. Figure 1. Recent Bituminous Overlay on Arden Oaks Drive Figure 2. Bituminous Patching, May 2019 Arden Oaks Drive Feasibility Report TKDA Project No. 18196.000 City of Arden Hills Page 7 Curb and Gutter: The condition of the curb and gutter along Arden Oaks is in acceptable condition with the exception of a few areas of settling, large cracks, and drainage issues. In general, the curb on Arden Oaks Drive appears to be functional in a drainage perspective and aesthetically in good condition. A large majority of the curb that was in functional condition had vegetation growing in the expansion joints. The vegetation traps sediment and other debris causing water to spill out of the gutter onto the roadway. An existing concrete apron is located on the south end of Arden Oaks Drive but it has been overlaid with bituminous pavement which is blocking water from traveling from west to east. The buildup of material from various maintenance operations has caused localized drainage issues. Utilities: Storm sewer ranges in size from 12” to 18” of reinforced concrete pipe. All utilities in the neighborhood were constructed with the original roadway around 1983. From field inspection, most castings in the neighborhood appear to be acceptable in both function and aesthetic. It was noted that some structures looked to be covered in debris and beginning to collect sediment in the gutters around them. Additionally, some of the curb and gutter around the catch basins has begun to crack and sag causing drainage issues and sedimentation. The drainage issues could potentially lead to pavement damage by allowing water into the pavement section. It was noted that some of the catch basin rings are beginning to deteriorate and break off into the structures. Some sedimentation was noted in the structures. Watermain within the neighborhood consists of 6” ductile iron pipe which was installed in 1983. The watermain functions well and is not proposed for improvement. Maintenance does not note deficiencies in the watermain systems in this neighborhood. Valve casting adjustments would be needed with street improvements. Sanitary sewer pipe includes 8” PVC pipe which was also installed in 1983. The pipe and structures are in good condition and do not require improvement. The rings and casting adjustments would be completed with street improvements. Drainage and Detention Ponds: Two stormwater detention ponds have been identified in the project area. The first is located northeast of 1399 Arden Oaks Drive, and the second is located west of 1469 Arden Oaks Drive. These two ponds have collected some sediment and have partially lost their full ability to treat storm water before discharging to natural bodies of water. At this time, it does not appear a full cleanout would be necessary, but the ponds may benefit from cleanup around the inlets and outlets. Further investigation and survey may be required to investigate and evaluate the benefits and cost of the maintenance; these costs were not factored into the cost estimates in this report. Figure 3. Deteriorated Curb Arden Oaks Drive Figure 4. Failing Rings in Catch Basin Arden Oaks Drive. Feasibility Report TKDA Project No. 18196.000 City of Arden Hills Page 8 The cul-de-sac east of Snelling Avenue appears to have consistent ground water along the south curb line. Upon the field inspection, several drain tile and sump pump discharges were noted in the cul-de-sac area extending down the street towards Snelling Avenue. Several residents explained the drainage issues they had in this area as well. It was noted that water comes from the back yards in between the houses to the street on the south side of Arden Oaks Drive. Arden Oaks Neighborhood Proposed Improvements: Streets: Considering the existing condition, deterioration factors, and geotechnical investigation, a full depth pavement reclamation is proposed for the streets within the project area. Other improvement options were investigated, but with pavement ratings below 45 out of 100, a mill and overlay only provides limited benefit. Seeing that the underlying base and pavement materials have deteriorated, cracking would reflect to the new bituminous overlay almost immediately. Full reconstruction was also evaluated, but because the majority of utilities and concrete curb is in fair condition this option is not economically feasible. A full depth reclamation emerged as the recommended street improvement to provide the neighborhood with a uniform street section and longer lasting results than superficial improvements with a lower cost than full reconstruction. Full depth reclamation will provide a new structural aggregate base and disrupt the existing frost heaving that has breached the existing aggregate base and bituminous surface. This improvement will provide a new paving surface that should last 30 to 40 years (with future maintenance and mill and overlay improvements). Table 1 provides the coring information gathered from the geotechnical report coring log (Exhibit 7) and forensic pavement report (Exhibit 1). Table 1: Coring Logs Core Bituminous (in) Aggregate Base (in) Total (in) Subgrade Soil Type Mill & Overlay Depth (in) Reclaim Depth (in) A 5 12 17 Sandy lean clay *NR 12 B 5.5 8 13.5 Sandy lean clay *NR 12 C 6 6 12 Sandy lean clay 2 12 D 5 8 13 Fill: Sandy lean clay 2** 12 E 6 5 11 Sandy lean clay 2 12 F 6.5 7 13.5 Sandy lean clay 2 12 G 5.5 5 10.5 Fill: Sandy lean clay 2 12 H 6 13 19 Fill: Sandy lean clay 2 12 *NR – Not recommended by report ** Potential area subject to raveling after milling To make room for the new bituminous section, the reclaimed material will be graded and compacted to a depth of 5” below finish grade after reclamation and excess material removed. A leveling layer of 1” of class 5 will be added under a 4” bituminous pavement section placed over the new roadway base in two lifts across the width to provide a smooth new surface. A proposed typical section for Arden Oaks Drive and Arden Oaks Court is shown in Exhibit 3. Figure 5. Ground Water from May 2019 Arden Oaks Drive Figure 6. 2020 Street Reclamation Project from White Bear Township Street Project Feasibility Report TKDA Project No. 18196.000 City of Arden Hills Page 9 Curb and Gutter: Existing curb and gutter will remain in place except for curb that is damaged, settled, or not draining properly. The existing curb will be inspected and marked for removal prior to construction. It is typical to see between 20% to 30% curb replacement for residential roadways of this age due to settlement or cracking. From examination of the curb in the field, it was found that approximately 30% +/- 5% of the curb would need to be replaced due to cracking and settlement. For the purposes of this report and estimates, 30% was used for calculation of project costs and scope. One portion of curb, approximately 300 feet in length around the Arden Oaks Drive cul-de-sac extending down the south curb line approximately 100 feet, was noted during field inspection as being in poor condition. It is recommended the curb in that stretch be replaced in its entirety. In addition to the curb being replaced, it is recommended that drain tile be installed around the radius of the cul- de-sac to the catch basin located on the south side curb of the Snelling Avenue Arden Oaks intersection. A valley gutter is also recommended at the Arden Oaks Drive County Road E intersection to better facilitate drainage through the intersection. In addition to curb and gutter replacement, driveways impacted by replaced curb and gutter will be patched with similar materials. Turf disturbed as a part of the curb replacement process will be restored with 6” topsoil and residential grade seed. Utilities: It is recommended that all the manhole and catch basin rings be replaced as a part of the pavement rehabilitation project. It is typical to reset all manhole and catch basin grades to match the new grades of the roadway to improve drivability and drainage. In addition to the adjustment rings, outdated and damaged manhole and catch basin casting assemblies will be replaced with modern castings. Storm sewer manholes and catch basins and sanitary manholes will be adjusted with all new concrete rings. Sanitary sewer manholes will be recast with all new concrete rings and infiltration prevention products to limit inflow and infiltration into the sanitary system. Resident Input: On May 7, 2021, an informational letter including a questionnaire was sent to the 40 property owners adjacent to the Arden Oaks project to inform them of upcoming street improvements and give basic project information. The questionnaires asked several questions including drainage and erosion issues, pet fences and other private utilities, traffic and pedestrian issues, and other resident concerns. Twenty-eight (28) of the Arden Oaks neighborhood questionnaires were returned, for a 70.0% return rate. The letters, questionnaires, and responses are shown in Exhibit 2. Primary concerns from the questionnaire were localized drainage issues, truck turnarounds, through traffic during congested times, and pedestrian safety while crossing Snelling Ave and County Road E. Several residents requested cross walks to be installed across the Ramsey County collector roads (Snelling Avenue and County Road E) in efforts to make crossing safer and easier. Any crosswalks proposed must follow the Ramsey County procedures and evaluation for consideration. Funding Figure 7. Curb and Gutter from 2020 Mendota Heights Street Project Feasibility Report TKDA Project No. 18196.000 City of Arden Hills Page 10 for these improvements would also be a County expenditure. This report recommends the assessment of pedestrian improvements, in coordination with Ramsey County, at the intersections of Arden Oaks Drive and Snelling Avenue and Arden Oaks Drive and County Road E. There are currently no pedestrian ramps on either side of the street and no sidewalks on Arden Oaks Drive. Americans with Disabilities Act (ADA) would require the installation of pedestrian ramps on both sides of the intersections. Additionally, pedestrian safety and ease of crossing would benefit from a flashing beacon sign. An additional issue noted by residents in the questionnaire was semi-truck traffic turning around within the neighborhood, specifically the cul-de-sac off Snelling Avenue. The neighborhood streets are not designed for, or expected to have truck traffic. The cul-de-sac could be reduced in size to discourage this activity; however, this would lengthen residential driveways and bring them closer to one another. Another solution may be to add a center island in the cul-de-sac containing a rain garden to discourage turnaround traffic. This issue will be reviewed as a part of the final considerations and design process. A power point presentation will be prepared with audio to be placed on the City’s website. This power point will provide information from the feasibility study in preparation for the upcoming public hearing. A link to the website will be sent with the notice for the public hearing along with contact information for any questions. Project Funding: Estimated costs: The following costs were prepared for the recommended full depth reclamation. An Engineer’s Estimates (Exhibit 4) was prepared and is subject to change depending on the final design of the project, required easements and/or right of way, soil conditions, bids received, and actual work performed. The cost estimate includes indirect cost for City administration, design engineering, construction engineering, legal support, fiscal support, interest during construction, assessment roll preparation, and contingencies encountered during design and construction. Table 2 provides a summary of the estimated project construction and indirect costs. Table 2: Project Cost Full Depth Reclamation Estimated Costs Street Improvements $ 413,197.50 Indirect Costs for Street Improvements (27%)* $ 111,563.33 Total Costs for Street Improvements $ 524,760.83 Storm Sewer Improvements $ 33,150.00 Indirect Costs for Storm Sewer Improvements (27%)* $ 8,950.50 Total Costs for Storm Sewer Improvements $ 42,100.50 Sanitary Sewer Improvements $ 9,750.00 Indirect Costs for Sanitary Sewer Improvements (27%)* $ 2,632.50 Total Cost for Sanitary Sewer Improvements $ 12,382.50 Water Improvements $ 2,450.00 Indirect Costs for Water Improvements (27%)* $ 661.50 Total Cost for Water Improvements $ 3,111.50 Total Improvement Cost $ 458,547.50 Total Indirect Costs for City (27%)* $ 123,807.83 Total Project Cost $ 582,355.33 Total project cost (rounded) $ 583,000.00 Feasibility Report TKDA Project No. 18196.000 City of Arden Hills Page 11 Assessment Policy: Per the City’s Assessment Policy, benefiting properties shall be assessed 50% of the street improvement costs. The remaining 50% shall be paid through the Pavement Improvement Revolving Fund. The term of the assessment is proposed to be 10 years. The interest rate for the term has not yet been set and will be provided as the process moves forward. The interest rate was assumed to be 3.15% for the purpose of this report. The area proposed to be assessed is every lot, piece, and parcel within the City limits benefiting from the Arden Oaks Neighborhood improvements, with addresses on the Arden Oaks roadways, within the following described areas located within Section 27-SW, Township 30N, Range 23W, as described on 2 plats: Arden Oaks and Shady Oaks Addition. Per paragraph I in the Definitions Section of the assessment policy (page 8), we do not recommend placing an assessment on the park within the Arden Oaks neighborhood. The intended use of the park appears to be for the local residents of the neighborhood and is not intended for regional use. The improvement cost is assessed on a unit basis to the benefiting properties as per the Assessment Policy adopted by the Arden Hills task force in 2004, and as amended. Due to the lower density of homes within the neighborhood and the parks centralized location, the assessments for the improvements are above average compared to other recent assessments for similar work in the city. See Exhibit 5 for the preliminary assessment roll and Exhibit 6 for the preliminary assessment map. Assessment Calculation and Estimation: The assessable amount is divided by the number of units within the project area; each lot shall count for 1 unit. The preliminary assessment calculation is derived from taking the overall assessable project costs, multiplying by 50%, and then dividing by the number of units within the project area. The units are shown in the Arden Oaks Neighborhood preliminary assessment roll and include a total number of 40 units. Below is the calculation for the assessments for both project options. Table 3 displays the assessment calculation and estimation. Table 3: Assessment Calculation Full Depth Reclamation Total Project Cost $ 583,000 Assessable Amount $ 524,800 Assessment (50% of Assessable Amount) $ 262,400 Single Family Dwelling Units 40 Units Unit Assessment (Assessable amount/ 40 Units) $ 6,560 /Unit Funding Sources: Funding sources for this project are proposed to come from municipal levy, assessments, and utility funds. Table 4 summarizes the funding sources for the two project options. Table 4: Project Funding Funding Breakdown - Full Depth Reclamation Amount Permanent Improvement Revolving Fund (PIR) $263,007 Special Assessments $262,400 Utility Fund – Storm Sewer Fund $ 42,100 Utility Fund – Sanitary Sewer Fund $ 12,382 Utility Fund – Water Fund $ 3,111 TOTAL $583,000 Feasibility Report TKDA Project No. 18196.000 City of Arden Hills Page 12 With a total estimated bond issue of $525,407, the assessed amount of $262,400 would be equivalent to 50% of the total bond issue. Minnesota Statutes Chapter 429 Special Assessment Bond Issue requires that a minimum of 20% of the total bond issue amount be recovered through special assessments. Preliminary Project Schedule: Table 5 outlines a project schedule to substantially complete the assessable project in 2022. Table 5: Preliminary Project Schedule Activity Date Authorize Preparation of Feasibility Report April 26, 2021 City Council Work Session July, 19, 2021 Accept Feasibility Report July 26, 2021 Public Hearing / Order Improvements August 23, 2021 Accept Plans and Specifications and Authorize Bidding January, 2022 Bid Opening February, 2022 Accept Bids and Authorize Assessment Hearing March, 2022 Assessment Hearing / Adopt Assessment Roll / Award Contract April, 2022 Commencement of Construction May, 2022 Substantial Completion of Construction September, 2022 Certify Assessments to County November, 2022 Warranty Inspection June, 2024 Conclusion and Recommendation: It is recommended that a full depth reclamation project for the Arden Oaks neighborhood be completed. Full Depth Reclamation will produce a uniform stable long lasting roadway for the residents of Arden Oaks as well as reduce short-term maintenance. The total estimated cost of the recommended improvements is $583,000. A portion of this project is proposed to be assessed to the benefiting property owners and the remainder through other funding sources. In accordance with the City’s Assessment policy, the preliminary assessment for the recommended improvement is calculated at $6,560 per unit. As the project is designed and competitively bid, the calculated assessment amount will be updated leading up to the adoption of the assessment roll. A 15% Street Improvement Plan is located in Exhibit 8. The improvements are necessary to allow for safe and reliable street and utility services within the Arden Oaks neighborhood. The project will be competitively bid to allow for a cost effective improvement. The feasibility study has provided an overall analysis of the feasible improvements for consideration within this neighborhood. Therefore, the proposed improvements within the Arden Oaks neighborhood as outlined in this report are necessary, cost effective, and feasible from an engineering standpoint.  Exhibit 1 )RUHQVLF3DYHPHQW5HSRUW 3$*(,17(17,21$//</()7%/$1. 701 XENIA AVENUE S | SUITE 300 | MINNEAPOLIS, MN | 55416 | 763.541.4800 | WSBENG.COM Memorandum To: Todd A. Blomstrom, PE From: Andrea Blanchette, PE Tom Wood Sheue Torng Lee Date: May 6, 2020 Re: Arden Oaks Area Forensic Report City of Arden Hills WSB Project No. 016063-000 WSB is pleased to submit this pavement forensics report detailing the results of the pavement coring which was completed on May 4, 2020 in the City of Arden Hills. The various characteristics of the pavement cores were summarized to provide information to the City to assist in determining the appropriate pavement maintenance or rehabilitation method. A total of 8 pavement cores were obtained within the Arden Oaks neighborhood. The locations of the pavement cores are summarized in Figure 1. A summary of the pavement depths and conditions for the streets are shown in Table 1. Pictures of the cores obtained can be found in the Appendix. Attachment C Todd Blomstrom, PE May 6, 2020 Page 2 Figure 1. Pavement core locations within the Arden Oaks area.Core 1 Core 2 Core 3 Core 4 Core 5 Core 6 Core 7 Core 8 Core 9 Todd Blomstrom, PE May 6, 2020 Page 3 Table 1. Pavement core location and information. Core ID Bituminous Depth (inches) Aggregate Depth ᵠ (inches) Recommended Maintenance Activity Notes 1 6.25 9 Full depth reclamation (FDR) Core was in good condition. The top lift was 2.5 inches. All layers were bonded together well. Subgrade material was found to be clay. 2 6.25 3 Core was in fair condition and there was debonding between pavement lifts. The top lift was 2 inches. Subgrade material was found to be sand. 3 6 8 Mill and Overlay Core was in fair condition and it was starting to show signs of deterioration, losing fines and binder. The top lift was 2 inches. Subgrade material was found to be sand. 4 6.5 8 Core was in poor condition exhibiting raveling between pavement lifts. The top lift was 2 inches. Subgrade material was found to be clay. 5 6 11 Core was in good condition. The top lift was 2 inches. All layers were bonded together well. Subgrade material was found to be clay. 6 6 8 Core was in fair condition and it was starting to show signs of deterioration, losing fines and binder. The top lift was 2 inches. Subgrade material was found to be clay. 7 5.75 7 Core was in good condition. The top lift was 1.5 inches. Subgrade material was found to be clay. 8 N/A N/A Core was not obtained due to the uniformity of the roads observed. 9 7 10 There was delamination between pavement lifts. The top lift was 2 inches. Subgrade material was found to be sand. ᵠ Aggregate material was observed to be limestone at all core locations. Todd Blomstrom, PE May 6, 2020 Page 4 Summary and Recommendations The cores obtained within the Arden Oaks area had bituminous depths ranging from 5.75 inches to 7 inches, with at least 3 inches of underlying aggregate base. Three of the cores were in good condition, while the others exhibit distresses such as delamination or deterioration. The cores had a top lift of 1.5 inches, 2 inches, or 2.5 inches. The surface of the streets (excluding the segment where Core 9 was obtained) was observed to be in poor condition covered in extensive amount of cracking and patching. Based on the findings from pavement coring, it would be feasible to perform a partial depth mill and overlay on Arden Oaks Drive (excluding the segment where Core 1 and Core 2 were taken). It would be recommended to extend the milling depth beyond the depth of the top lift of the existing bituminous pavement to ensure proper bonding between the new overlay and the underlying existing asphalt. Core 4 showed raveling between pavement lifts, thus, we would recommend the City to account for spots that may need additional patching. It is important to note that a partial depth mill and overlay will not eliminate all the crack patterns within the pavement. Cracks will reflect through the new overlay within a few years. That said, in order to extend the service life of this preservation method, we would recommend the City to conduct routine crack sealing. Crack sealing is a cost-effective method to prevent infiltration of water and incompressible material into the cracks. Along the segment where Core 1 and Core were taken, it would be recommended to perform a full depth reclamation (FDR). It is our understanding that there were base issues along this segment where water is seeping out through the bituminous pavement. An FDR would be able to help address the base issues. This rehabilitation method would also remove all the existing distresses, and re-blend the bituminous and a portion of the aggregate as a base to re-pave over, essentially creating a new roadway section. Todd Blomstrom, PE May 6, 2020 Page 5 Appendix Arden Oaks Area Coring Pictures Todd Blomstrom, PE May 6, 2020 Page 6 Core 1 Core 2 Todd Blomstrom, PE May 6, 2020 Page 7 Core 3 Core 4 Todd Blomstrom, PE May 6, 2020 Page 8 Core 5 Core 6 Todd Blomstrom, PE May 6, 2020 Page 9 Core 7 Core 8 Todd Blomstrom, PE May 6, 2020 Page 10 Core 9  Exhibit 2 5HVLGHQW,QSXW 3$*(,17(17,21$//</()7%/$1. Draintile Sump Pump None Standing Water Duration Location Property Damage Other Issues Sketch Included Irrigation Pet Fence Wiring/Pipes1370 Arden Oaks DriveY Y N N N N N Catch basin is collapsing N Y Y N N1401- The house and yard are filled with everything - "you name it" including cars, used building materials, etc. Inhabitable and just gets worse and worse. The cars in the backyard have been there since the owner bought the property.1376 Arden Oaks DriveYYNN N N N N N YN NAt the corner of Arden Oaks Dr and County Road E would like to see a crosswalk marking.We have comcast cable that has wire running underground in the right of way and a mail box.1377 Arden Oaks DriveYYNN N N NI believe the catch basin need rebuilding most are over 35 years old in our neighborhood roads are in bad shape for sure.NNNNExcessive speed everyday between CO. Rd. E and north to the tee. It is a complete black out when the moon is not out. VERY DARKGoodwill looks awful - I wont support them. 1401 Co Rd E - Condemn this dumping ground. Trim trees on our "parkway". Shoreview keeps 96 looking great, as you can see everyday. Co. Rd. E is a big disappointment - trees LOOK BAD. When they do road repair we would like to retain our current type of curbing. Thank you1388 Arden Oaks DriveYYNN N N NNN Y N Y (Irrigation)NN1392 Arden Oaks DriveN Y N Y Unsure Unsure Nuisance N Y Y N NNAre we always going to be able to drive in and out of our garage? How much will it cost? I am 92 and have to save for the improvement. 1397 Arden Oaks DriveYYNN N N N N N NN NCrossing County Road E to trail at Arden Oaks Dr entrance. Crossing Old Snelling to trail at Arden Oaks Dr entrance.N1399 Arden Oaks DriveYYNNNNNNNNNNNN1415 Arden Oaks DriveYYNNNNNNNYNNNN1416 Arden Oaks CourtYYNN N N N N N YN YA openings to the neighborhood it is unsafe to cross at Arden Oaks Drive across County Road E to access the bike path and at Old Snelling at the other end of Arden Oaks Drive. Both sides are very dangerous for pedestrians to cross the street to reach the sidealk this creates a dangerous situation for people to access the park when crossing with young children and strollers from the sidewalk/bikepath on the main roads.N1428 Arden Oaks CourtYYNN N N N N N YN NNN1429 Arden Oaks CourtYYNN N N N N N YN Y NI have irrigation system water heads about 10' from Road.1434 Arden Oaks DriveYYNNNNNNNYNNNN1437 Arden Oaks CourtYYNNNNNNNYNNNN1438 Arden Oaks CourtYYNNNNNNNNNNNN1443 Arden Oaks CourtY Y N Y 1-2 Days 30' East Nuisance N N Y N N NStanding water in front of our driveway after rain in the street.1450 Arden Oaks DriveNYNNNNNNNNNNNN1452 Arden Oaks DriveNYNN N N N N N YN NCrossing from 1499 Arden Oaks Drive across Snelling Ave North to trail needs a crosswalk, could use one to cross county Road E out of Arden Oaks Drive as wellSee notes on attached map. Otherwise needs general resurfacing1453 Arden Oaks DriveY N N N N N N N N Y N N N Broken curbing in front of our house1462 Arden Oaks DriveYYNYThe ice and slush is there until evaporatesNDamage to the street; no mail delivery due to drainageTwo houses behind our house drain into our yard (1444 and 1438 Arden Oaks Court). We have drain lines that flow into the street.YYNYWe get lots of traffic just turning around in the culdesacWe want to talk to someone about the drainage issues. Please call Colleen Paulus 651-894-44951469 Arden Oaks DriveNYNN N N NThe sewer in front of our house takes all the water coming down the hill. In the winter we often have a "lake" in front of our driveway. In summer this can happen during heavy rain. When water freezes in the winter its very slippery.NNNN NUnsure of the scope of work - is just repaving the street and raising manholes (they need it)… or will include curb and gutter? Rasing the grates (they need it)?1473 Arden Oaks DriveNNYNNNNNNNYNNN1476 Arden Oaks DriveYYNY 1-2 WeeksNext to house to street backyard to front yard, South/east side to front north sideCreating damage (basement and Driveway), front yard landscaping had to be removed due to water damageConstant standing water on lawn curb and street. After rain water comes our of ground for several days to a week. Ice on street all winter from standing water YYNNTraffic uses culdesac as turn around. So dark on street I have had my car broken into several times. Because the street is a cut through between old snelling and county road E cars speed through during rush hour.Due to the nature of the street being easy in/out at least once a year there are car and home break-ins. It would be nice to have street lights or other safety features. There are currently no street lights.1483 Arden Oaks DriveYYNN N N NCuldesac across street - Major problem with water off (cant read word) elevations.NYNNConstant "speeders" going through neighborhood! Cut-through when Linden's sop sign becomes conjestedMail box relocation security! There have been recent mail thefts!1486 Arden Oaks DriveYYNN N N Nwater comes down between 1466 and 1462 and turns culdesac in front of these houses into ice rink in the winter. Water from 1486 and 1476 runs down into street, turns into ice in winter in the streetNYNY NProperty has heated driveway with colored concrete top and colored concrete steps going down to the street. Property has cable junction box and telephone junction box in the citys right of way1499 Arden Oaks DriveYYNN N N N N N YYYCrossing over Snelling Ave North Oaks Dr as a pedestrian is dangerous. I would like to see a combination of slower speed limit and a pedestrian crosswalk. (metered/signed) put in a place making it easier and safer for families to access the sidewalk and trails off Snelling.NNo address (1) Y Y N N N N N N Y Y N N N NNo address (2) Y Y N N N N N N N N N N Excessive Speed NNo address (3) Y Y N N N N N N N N N N N NPrivate Underground UtilitiesDrainage & Erosion IssuesQuestionaire Tabulation - Arden Oaks Street ImprovementsTraffic Issues Other IssuesAddress June 25, 2021 RE: Arden Oaks Street Improvements – Property Owners Questionnaire City Project Number PW-21-0109 Dear Resident of Arden Oaks: The City of Arden Hills has initiated the process of roadway rehabilitation and utility improvements for the summer of 2022 which includes your neighborhood. Over the next couple months, the City will be collecting data and studying your neighborhood street. A feasibility report will be prepared that includes information about the recommended improvements and associated costs. The Arden Hills City Council ordered the preparation of a feasibility report for the Arden Oaks Neighborhood Improvements at the April 26th, 2021, city council meeting. Things to know and consider as the project moves forward: x Surveyors will be working on your street very soon to collect topographic data for the street improvement project. The surveyors take ground shot data to locate key features within the project area. They may take shots into your yard and driveway to locate certain features and ground slopes. x Residents pay a portion of the overall project cost in the form of a special assessment. You will not be billed for the special assessment until 2022. x Estimated special assessments for your neighborhood will not be determined until after information has been gathered from the questionnaires and a feasibility report is completed. x An informational virtual presentation detailing the project will be available for viewing on the cities website in the coming weeks after all information has been collected and considered. x Components of a project vary and are based on questionnaire responses. Special assessments typically include the cost of the new roadway. Other utility upgrades such as water main, sanitary sewer, and storm sewer are funded through utility funds and are not assessed. x Construction typically starts in spring/early summer and ends in late fall of the same year. Another important step is to collect feedback from you regarding your street. The information you share with us is essential in determining certain aspects of the project that may be constructed. The following information explains the questionnaire that is enclosed. A map showing the boundaries of the area to be reconstructed is also enclosed. After reading this letter completely, please complete the questionnaire and return by June 10th, 2021, in the self-addressed stamped envelope. Drainage and Erosion Issues The City would like to know about any local drainage problems that you may have. Does storm water run-off stand in the street or in front of your house? Do you have a sump pump that directs water towards the street? Is your lawn wet from ground water coming through the ground? As part of the storm sewer design process, we would like to know if these or similar situations are occurring in your yard or around your neighborhood. If so, please describe it in the drainage and erosion section of the questionnaire. We will review them for possible corrective action if applicable to the project. Private Underground Utilities Some residents install private underground utilities near the street in the City owned right-of- way. Typically the right-of-way is 15' to 20' behind the roadway. These utilities are usually lawn irrigation or electric pet fences. Utility and roadway improvements can damage these utilities and other property in the right of way. The contractor is responsible for protecting marked irrigation systems. If marked irrigation is damaged it will be replaced by the contractor to its original or improved condition. However, if the contractor knows the location of these private utilities, they can attempt to avoid damaging them. Please mark your irrigation system before construction begins to avoid damage. Due to the difficulty of locating and protecting electric pet fences, it is problematic to require the contractor to protect and repair them during construction. If possible during construction, please accurately mark the pet fences to avoid damage. The contractor will not be required to fix the wires marked or unmarked, but damage may be avoidable if the fence is properly marked. If you have any private underground utilities, please tell us in the private underground utilities section of the questionnaire. Traffic/Pedestrian Issues The City of Arden Hills typically reviews traffic or pedestrian issues on local streets. We would like to know if you feel that your roadway has any traffic or pedestrian issues. If you feel that the streets in Arden Oaks neighborhood are overcrowded or are subject to speeding vehicles, please make a comment on the traffic/pedestrian issues section of the questionnaire. Questions During the next few weeks you may see engineering staff or land surveyors gathering information near or around your house. Feel free to ask them any questions about the street project. If you have questions after reading this letter or talking to staff, please call me or the engineering staff at 651-788-0269 (mobile) or 651-792-7847 (office). Sincerely, David Swearingen Public Works Director DSwearingen@cityofardenhills.com Enclosed: Property Owners Questionnaire Reconstruction Map Self-Addressed Stamped Envelope Project No. PW-21-0109 Arden Oaks Neighborhood Improvements 1 PROPERTY OWNERS QUESTIONAIRE ARDEN OAKS NEIGHBORHOOD STREET IMPROVEMENTS, CITY OF ARDEN HILLS Please do NOT answer these questions before you have read the attached letter. Please complete and return this survey by June 10th, 2021, using the self-addressed stamped-envelope. Address __________________________________________________________________________ Drainage and Erosion Issues: 1. Do you have any of the following? (check all that apply) Basement drain tile Sump pump None 2. Does water stand in your front yard after heavy rain? Yes No If yes, A. How long is it there? ______________________________________________________ B. How far away is it from your house? __________________________________________ C. Where is it in relation to the house (direction and feet)? _________________________ D. Is the standing water creating damage to the property or is it just a nuisance? ________________________________________________________________________ E. Please sketch in the space below: your house, garage, driveway, and where drainage problem is occurring: 3. Please list specific surface water drainage or erosion problems in your neighborhood: ___________________________________________________________________________ ___________________________________________________________________________ ___________________________________________________________________________ NOTE: Most private drainage problems (which are usually attributed to grades at or near the foundation) will likely NOT be solved by this street project. However, with this information we may be able to take a look at the whole picture and possibly address some occurrences. Private Underground Utilities 4. Do you have an underground lawn irrigation system in the City right-of-way? (Typically the right-of-way is 15' to 20' behind the roadway.) Yes No 5. Do you have an underground electric pet containment system in the City's right-of-way? Yes No Project No. PW-21-0109 Arden Oaks Neighborhood Improvements 2 6. Do you have any private wiring, private pipes, etc in the City's right-of-way? Yes No Traffic/Pedestrian Issues 7. Do you feel your neighborhood or roadway has any pedestrian or traffic issues (e.g. crossing adjacent to busy roadways, parking, excessive speed, traffic volumes, etc.)? Yes No If yes, where? ___________________________________________________________________________ ___________________________________________________________________________ Other Issues 8. Additional Comments/Questions: ___________________________________________________________________________ ___________________________________________________________________________ ___________________________________________________________________________ ___________________________________________________________________________ ___________________________________________________________________________ ___________________________________________________________________________ Thank you for your cooperation. Please return this questionnaire in the enclosed self-addressed, stamped-envelope. Please complete all questions and return to the City of Arden Hills by June 10th, 2021. 3$*(,17(17,21$//</()7%/$1.  Exhibit 3 7\SLFDO6HFWLRQV 3$*(,17(17,21$//</()7%/$1. ROW VARIES 30'-35'ROW VARIES 30'-35'BACK OF CURB TO CENTERLINE 18' +/-0.5'BACK OF CURB TO CENTERLINE 18' +/-0.5'BACK OF CURB TO BACK OF CURB 36' +/-0.5'ROW VARIES 60'-70'EXISITING SLOPE VARIES 1.2% TO 4.0%, 2% PROPOSEDEXISTING SLOPE VARIES 1.2% TO 4.0%, 2% PROPOSEDB418 CURB AND GUTTER - SPOT REPLACEMENTAPPROVED GRANULAR BACKFILL6" TOPSOIL WITH SEED120.33'0.5'10.5' MAX2.0' MIN0.5'0.5' MINB418 CURB AND GUTTER - SPOT REPLACEMENTAPPROVED GRANULARBACKFILL6" TOPSOILWITH SEED4" PERFORATED PVC DRAIN TILEFREE DRAINING AGGREGATEGEOTEXTILE FABRIC TYPE 1GEOTEXTILE FABRIC TYPE 5K:\a-f\ArdenHills\18196000\04_Production\01_CAD\01_Xrefs\C001 TYPICAL SECTIONS.dwg Jul 20, 2021 - 4:46pm444 Cedar Street, Suite 1500Saint Paul, MN 55101651.292.4400tkda.comDESCRIPTION OF REVISIONSNO. DATE BYDESIGNEDDRAWNCHECKEDDRAWING NO.PROJ. NO.FILENAME:PLOT DATE:NAME:SIGNATURE:LIC. NO.:DATE:C001TYPICAL SECTIONLPPSPBMOBLARRY POPPLER 410056/23/2021--- --- --- ------ --- --- ------ --- --- ------ --- --- ------ --- --- ---I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION, ORREPORT WAS PREPARED BY ME OR UNDER MY DIRECTSUPERVISION AND THAT I AM A DULY LICENSED PROFESSIONALENGINEER UNDER THE LAWS OF THE STATE OF MINNESOTA.ARDEN OAKS STREETIMPROVEMENTS18196.0006" CONCRETE DRIVEWAY PAVEMENT6" AGGREGATE BASE CLASS 5SUBGRADE3" TYPE 9.5 WEARING COURSEMIXTURE (2,B) (SPWEA230B) (2 LIFTS)6" AGGREGATE BASE CLASS 5SUBGRADEPROPOSED CONCRETE DRIVEWAYPROPOSED BITUMINOUS DRIVEWAY2.0" TYPE 9.5 WEARING COURSE MIXTURE (2,B) (SPWEA230B)TACK COAT AS DIRECTED BY THE ENGINEER2.0" TYPE 9.5 WEARING COURSE MIXTURE (2,B) (SPWEA230B)+/- 12" FULL DEPTH RECLAMATION5" COMMON EXCAVATION1" OF CLASS 5 AGGREGATE BASEDEPTH OF BASE VARIES 7" TO 15"FULL DEPTH RECLAMATIONSUBGRADESALVAGED PAVERS6" CLASS 5 AGGREGATE BASESUBGRADE1" SAND LEVELING COURSESWEEP CRACKS WITH SELECT GRANULAR BORROWPAVER DRIVEWAYFULL DEPTH RECLAMATIONDRAINTILE   3$*(,17(17,21$//</()7%/$1.  Exhibit 4 (QJLQHHU¶V(VWLPDWH 3$*(,17(17,21$//</()7%/$1. (67,0$7('4 (67,0$7(' (67,0$7('727$/675((7   02%,/,=$7,21 /803680   675((7   6$:,1*%,73$9(0(17 )8//'(37+ /,1)7   675((7   6$:,1*&21&5(7(3$9(0(17 )8//'(37+ /,1)7   675((7   5(029(&85%$1'*877(5 /,1)7   675((7   5(029(%,780,1286'5,9(:$<3$9(0(17 64<'   675((7   5(029(&21&5(7('5,9(:$<3$9(0(17 64<'   675((7   6$/9$*($1'5(,167$//%5,&.3$9(56 64<'   675((7   *(27(;7,/()$%5,&7<3( 64<'   675((7   *(27(;7,/()$%5,&7<3(64<'   675((7   &20021(;&$9$7,21 &8<'   675((7   68%*5$'((;&$9$7,21 &8<'   675((7   '(:$7(5,1* /803680   675((7   6(/(&7*5$18/$5%2552: &8<'   675((7   &586+('52&. 0,186 721   675((7   7(6752//,1* 52$'67$  675((7   68%*5$'(35(3$5$7,21 52$'67$  675((7   675((76:((3(5 :,7+3,&.83%5220 +285   675((7   :$7(5 0*$//21   675((7  $**5(*$7(%$6( &9 &/$66 721   675((7   )8//'(37+5(&/$0$7,21 64<'   675((7   0,//%,780,1286685)$&(  64<'   675((7   7<3(63:($5,1*&2856(0,;785( & 721   675((7   7<3(63121:($5,1*&2856(0,;785( % 721   67250   3(5)733,3('5$,1 /,1)7   67250   &211(&7,172(;,67,1*'5$,1$*(6758&785( ($&+   :$7(5  $'-8679$/9(%2;($&+   :$7(5   5(3/$&(9$/9(%2;($&+   672506$1  $'-867)5$0($1'5,1*&$67,1* ($&+   675((7   &21&5(7(&85% *877(5'(6,*1' /,1)7   675((7   &21&5(7(&85% *877(5'(6,*163(&,$/ /,1)7   675((7   &21&5(7('5,9(:$<3$9(0(17 64<'   675((7   75$)),&&21752/ /803680   675((7   67$%,/,=('&216758&7,21(;,7/803680   675((7   67250'5$,1,1/(73527(&7,21 ($&+   675((7   6(',0(17&21752//2*7<3(&203267/,1)7   675((7   &2002172362,/%2552: &8<'   675((7   )(57,/,=(57<3(3281'   675((7   &$7(*25<675$: 64<'   675((7   6((',1*$&5(   675((7   6(('0,;785( 3281'   (67,0$7('48$1,7,7(6$5'(12$.61(,*+%25+22'675((7,03529(0(176,7(0180%(5727$/)8//'(37+5(&/$0$7,2163(&180%(5 '(6&5,37,21237,21)8//'(37+5(&/$0$7,2181,76,1',5(&7&26765281'(' PAGE ,17(17,21$//<LEFT BLANK  Exhibit 5 3UHOLPLQDU\$VVHVVPHQW5ROOV  3$*(,17(17,21$//</()7%/$1. Description: Arden Oaks Street ImprovementsAssessment Unit Rate (50%): $6,560.00Interest Rate: 3.15%Term: 10Initial Year: 2022Total Units: 40NUMBER PARCEL ADDRESS PARCEL NUMBER LEGAL DESCRIPTION PROPERTY OWNER JOINT OWNER OWNER ADDRESS CITY AND ZIPASSESSIBLE UNITSSTREET ASSESSMENTTOTAL ASSESSMENTAMOUNTNOTES11486 ARDEN OAKS DR 273023330008Lot 2 Block 3 of ARDEN OAKSBarbara Muller1486 Arden Oaks DrArden Hills MN 55112-695516,560.00$ 6,560.00$ 21499 ARDEN OAKS DR273023330002Lot 1 Block 1 of ARDEN OAKSMatthew R JergensonSarah E Jergenson1499 Arden Oaks DrArden Hills MN 55112-695616,560.00$ 6,560.00$ 3 1483 ARDEN OAKS DR 273023330003 Lot 2 Block 1 of ARDEN OAKSThomas C HouseElizabeth R House1483 Arden Oaks DrArden Hills MN 55112-695616,560.00$ 6,560.00$ 41496 ARDEN OAKS DR273023330007Lot 1 Block 3 of ARDEN OAKSJeffrey T TraiforosJessica M Traiforos1496 Arden Oakes DrArden Hills MN 55112-695516,560.00$ 6,560.00$ 5 1476 ARDEN OAKS DR 273023330009Lot 3 Block 3 of ARDEN OAKSAlex SchiermanAnnie Schierman1476 Arden Oaks DrArden Hills MN 55112-695516,560.00$ 6,560.00$ 6 1469 ARDEN OAKS DR 273023330005Lot 2 Block 2 of ARDEN OAKSMark E NagelColleen C Nagel1469 Arden Oaks DrArden Hills MN 55112-695616,560.00$ 6,560.00$ 71473 ARDEN OAKS DR273023330039Lot 12 Block 3 of SHADY OAKS ADDITIONAaron J NielsenKirsten M Nielsen1473 Arden Oaks DrNew Brighton MN 55112-695616,560.00$ 6,560.00$ 8 1452 ARDEN OAKS DR 273023330013 Lot 7 Block 3 of ARDEN OAKSAmy L Valentine1452 Arden Oaks DrArden Hills MN 55112-695516,560.00$ 6,560.00$ 9 1460 ARDEN OAKS DR273023330012 Lot 6 Block 3 of ARDEN OAKSTimothy WagenknechtAlison R Wagenknecht 1460 Arden Oaks DrArden Hills MN 55112-695516,560.00$ 6,560.00$ 10 1462 ARDEN OAKS DR273023330011Lot 5 Block 3 of ARDEN OAKSTerry L PaulusColleen J Paulus1462 Arden Oaks DrArden Hills MN 55112-695516,560.00$ 6,560.00$ 111466 ARDEN OAKS DR273023330010Lot 4 Block 3 of ARDEN OAKSAnne T AlwellTullio J Alessi1466 Arden Oaks DrArden Hills MN 55112-695516,560.00$ 6,560.00$ 12 1442 ARDEN OAKS DR 273023340016 Lot 9 Block 3 of ARDEN OAKS Nancy Stevens Evertz Trustee 1442 Arden Oaks DrSaint Paul MN 55112-695516,560.00$ 6,560.00$ 131434 ARDEN OAKS DR273023340017Lot 10 Block 3 of ARDEN OAKSMichael BohanMaureen Obrien Bohan 1434 Arden Oaks DrNew Brighton MN 55112-695516,560.00$ 6,560.00$ 14 1424 ARDEN OAKS DR273023340018Lot 11 Block 3 of ARDEN OAKSGrant J WishartChristine A Wishart1424 Arden Oaks DrNew Brighton MN 55112-695516,560.00$ 6,560.00$ 151414 ARDEN OAKS DR273023340019Lot 12 Block 3 of ARDEN OAKSTodd K LundeenCindy L Lundeen1414 Arden Oaks DrArden Hills MN 55112-695516,560.00$ 6,560.00$ 161415 ARDEN OAKS DR273023340005Lot 8 Block 2 of ARDEN OAKSDennis A Foster TrusteePatricia L Foster Trustee1415 Arden Oaks DrArden Hills MN 55112-695616,560.00$ 6,560.00$ 171425 ARDEN OAKS DR273023340004Lot 7 Block 2 of ARDEN OAKSClaude R BragstadRuth C Bragstad1425 Arden Oaks DrArden Hills MN 55112-695616,560.00$ 6,560.00$ 181435 ARDEN OAKS DR273023340003Lot 6 Block 2 of ARDEN OAKSFrank R DolinarKathleen J Dolinar 1435 Arden Oaks DrSt Paul MN 55112-695616,560.00$ 6,560.00$ 19 1445 ARDEN OAKS DR 273023340002Lot 5 Block 2 of ARDEN OAKSKevin P KeenanNancy M Keenan 1445 Arden Oaks DrArden Hills MN 55112-695616,560.00$ 6,560.00$ 201453 ARDEN OAKS DR273023340001Lot 4 Block 2 of ARDEN OAKSPaul D SmythDorothy Smyth1453 Arden Oaks DrArden Hills MN 55112-695616,560.00$ 6,560.00$ 211450 ARDEN OAKS DR273023340015Lot 8 Block 3 of ARDEN OAKSMark W MccloskeyDawnelle J Mccloskey1450 Arden Oaks DrArden Hills MN 55112-695516,560.00$ 6,560.00$ 221463 ARDEN OAKS DR273023330006Lot 3 Block 2 of ARDEN OAKSDavid W DvorakDonna B Dvorak1463 Arden Oaks DrArden Hills MN 55112-695616,560.00$ 6,560.00$ 23 1413 ARDEN OAKS DR 273023340028-City Of Arden Hills1245 Highway 96 WArden Hills MN 55112-540006,560.00$ -$ ARDEN OAKS Park24 1388 ARDEN OAKS DR 273023340013 Lot 16 Block 2 of ARDEN OAKS Matthew J Goggin Grace J Goggin 1388 Arden Oaks Dr Arden Hills MN 55112-6957 1 6,560.00$ 6,560.00$ 251390 ARDEN OAKS DR273023340012Lot 15 Block 2 of ARDEN OAKSTravis A JohnsonMelanie Johnson1390 Arden Oaks DrSaint Paul MN 55112-695716,560.00$ 6,560.00$ 261392 ARDEN OAKS DR273023340011Lot 14 Block 2 of ARDEN OAKSJanet M Kuhl1392 Arden Oaks DrArden Hills MN 55112-695716,560.00$ 6,560.00$ 271395 ARDEN OAKS DR273023340010Lot 13 Block 2 of ARDEN OAKSJoshua A BodieSamantha J Brown1395 Arden Oaks DrArden Hills MN 55112-696416,560.00$ 6,560.00$ 281397 ARDEN OAKS DR273023340009Lot 12 Block 2 of ARDEN OAKSSteven J JohnsonSusan J Iverson1397 Arden Oaks DrSt Paul MN 55112-696416,560.00$ 6,560.00$ 29 1399 ARDEN OAKS DR 273023340008 Lot 11 Block 2 of ARDEN OAKSCarl J Nelson1399 Arden Oaks DrArden Hills MN 55112-696416,560.00$ 6,560.00$ 301401 ARDEN OAKS DR273023340007Lot 10 Block 2 of ARDEN OAKSCourtney J CarlsonJenna A Carlson1401 Arden Oaks DrArden Hills MN 55112-695616,560.00$ 6,560.00$ SUBJ TO ESMTS; LOT 10 BLK 231 1407 ARDEN OAKS DR273023340006Lot 9 Block 2 of ARDEN OAKSAlexandra WelleZachary J Muehlenbein1407 Arden Oaks DrArden Hills MN 55112-695616,560.00$ 6,560.00$ 32 1401 COUNTY ROAD E W 273023340055 Lot 1 Block 1 of SHADY OAKS ADDITION Korhan Yesil 1401 County Road E W Saint Paul MN 55112-365206,560.00$ -$ DRIVEWAY ON COUNRT ROAD E 33 1415 COUNTY ROAD E W 273023340059Lot 3 Block 2 of SHADY OAKS ADDITIONJoshua Golden1415 County Road E WArden Hills MN 55112-365206,560.00$ -$ DRIVEWAY ON COUNRT ROAD E 34 1376 ARDEN OAKS DR273023340052 Lot 19 Block 1 of SHADY OAKS ADDITIONDavid R Swenson TrusteeCheryl L Swenson Trustee 1376 Arden Oaks DrArden Hills MN 55112-695716,560.00$ 6,560.00$ EX W 25 FT OF S 210 FT AND EX N 30 FT LOT 3 BLK 2351377 ARDEN OAKS DR273023340060Lot 20 Block 3 of ARDEN OAKSDavid L BeamishNancy J Beamish1377 Arden Oaks DrArden Hills MN 55112-695816,560.00$ 6,560.00$ N 30 FT LOT 3 BLK 2 SHADY OAKS ADDITION AND IN SD ARDEN OAKS LOT 20 BLK 3361416 ARDEN OAKS CT273023340026Lot 19 Block 3 of ARDEN OAKSMatthew R NelsonCara Nelson1416 Arden Oaks CTArden Hills MN 55112-696116,560.00$ 6,560.00$ 37 1428 ARDEN OAKS CT273023340025Lot 18 Block 3 of ARDEN OAKSNicholas BrokkeErin Brokke1428 Arden Oaks CTArden Hills MN 55112-696116,560.00$ 6,560.00$ 381438 ARDEN OAKS CT273023340049Lot 17 Block 3 of ARDEN OAKSDavid M KempHoda S Kemp1438 Arden Oaks CTArden Hills MN 55112-696116,560.00$ 6,560.00$ 391444 ARDEN OAKS CT273023340023Lot 16 Block 3 of ARDEN OAKSCollin PittierRachel Jones-Pittier1444 Arden Oaks CTArden Hills MN 55112-696116,560.00$ 6,560.00$ 401443 ARDEN OAKS CT273023340022Lot 15 Block 3 of ARDEN OAKSDavid W AngellMary K Angell1443 Arden Oaks CTSt Paul MN 55112-696116,560.00$ 6,560.00$ 41 1437 ARDEN OAKS CT 273023340021Lot 14 Block 3 of ARDEN OAKSGeraldine L Kremer1437 Arden Oaks CTSt Paul MN 55112-696116,560.00$ 6,560.00$ 42 1370 ARDEN OAKS DR 273023340054 Lot 1 Block 1 of SHADY OAKS ADDITIONDonald F Palme 2158 64th StSaint Paul MN 55110-103316,560.00$ 6,560.00$ N 100 FT OF LOTS 1,2 & LOT 3 & THE S 15 FT OF THE N 115 FT OF LOTS 1 & 2 & THE W 10 FT OF LOT 3 BLK 143 1429 ARDEN OAKS CT 273023340020 Lot 13 Block 3 of ARDEN OAKSTodd Michael Hertog1429 Arden Oaks CTArden Hills MN 55112-696116,560.00$ 6,560.00$ 40 262,400.00$ TotalsArden Oaks Preliminary Assessment Roll PAGE ,17(17,21$//<LEFT BLANK  Exhibit 6 $VVHVVPHQW0DSV  3$*(,17(17,21$//</()7%/$1. 14991483147314691463145314451435142514151407140113991397139513921390138813761377141614281438144414431437142914131414142414341442145014521460146214661476148614963638362836103609362336313632362014351427142314151401137013871377367236821367365736413635152535901434142614201412140414001392137036283611362536373645365536633673368135803574356839003900COUNTY ROAD E WESTSOO LINE RAILROAD COMPANYBETHEL UNIVERSITYSNELLING A V E N U E N O R T H SNELLI N G A V E N U E N O R T HPASCAL AVENUE NORTHARDEN OAKS DRIVEARDEN OAKS COURTARDEN OAKS DRIVEARDEN OAKS DRIVELAKE JOHANNA BOULEVARDTH 51 (SNELLING AVENUE)HAMLINE AVENUE NRIDGEWOOD COURTK:\a-f\ArdenHills\18196000\04_Production\01_CAD\01_Xrefs\V-BASE.dwg May 05, 2021 - 6:24pm444 Cedar Street, Suite 1500Saint Paul, MN 55101651.292.4400tkda.comDESCRIPTION OF REVISIONSNO. DATE BYDESIGNEDDRAWNCHECKEDDRAWING NO.PROJ. NO.BAR IS ONE INCH ON ORIGINAL DRAWING. IF NOT ONE INCHON THIS DRAWING ADJUST SCALES ACCORDINGLY.ALL CONTRACTORS AND SUBCONTRACTORSSHALL VERIFY ALL DIMENSIONS BYMEASUREMENT AT THE BUILDING AND/OR SITEFILENAME:PLOT DATE:ARDEN OAKS STREETIMPROVEMENTSASSESSMENT MAPPW-21-01091 OF 1SCALE IN FEET0 50 100 200ASSESSABLE UNITPROJECT AREA   3$*(,17(17,21$//</()7%/$1.  Exhibit 7 *HRWHFKQLFDO5HSRUW  3$*(,17(17,21$//</()7%/$1. GEOTECHNICAL REPORT ARDEN OAKS STREET IMPROVEMENTS ARDEN HILLS MN September 19, 2019 Prepared for: City of Arden Hills 1245 West Highway 96 Arden Hills, MN 55112 WSB PROJECT NO. 014297-000 GEOTECHNICAL REPORT Geotechnical Report Arden Oaks Street Improvements Arden Hills, Minnesota WSB Project No. 014297-000 ARDEN OAKS STREET IMPROVEMENTS ARDEN HILLS, MINNESOTA FOR CITY OF ARDEN HILLS, MINNESOTA September 19, 2019 CERTIFICATION Geotechnical Report Arden Oaks Street Improvements Arden Hills, Minnesota WSB Project No. 014297-000 I hereby certify that this plan, specification, or report was prepared by me or under my direct supervision and that I am a duly Licensed Professional Engineer under the laws of the State of Minnesota. Darin E. Hyatt, PE Date: September 19, 2019 Lic. No. 41316 540 GATEWAY BLVD | BURNSVILLE, MN | 55337 | 952.737.4660 | WSBENG.COM September 19, 2019 Mr. Todd Blomstrom, PE Interim Public Works Director/City Engineer City of Arden Hills 1245 West Highway 96 Arden Hills, MN 55112 Re: Geotechnical Report Arden Oaks Street Improvements Arden Hills, Minnesota WSB Project No.: 014297-000 Dear Mr. Blomstrom: We have conducted a geotechnical subsurface exploration program for the above referenced project. This report contains our soil boring logs, an evaluation of the conditions encountered in the borings and our recommendations for subgrade preparation, underground utility installation, and other geotechnical related design and construction considerations. If you have any questions concerning this report or our recommendations, or for construction material testing for this project, please call us at (952) 737-4660. Sincerely, WSB Darin Hyatt, PE Mark Osborn, PE Senior Geotechnical Engineer Geotechnical Project Engineer Attachment Geotechnical Report DEH/tw TABLE OF CONTENTS Geotechnical Report Arden Oaks Street Improvements Arden Hills, Minnesota WSB Project No. 014297-000 Page 1 TITLE SHEET CERTIFICATION SHEET LETTER OF TRANSMITTAL TABLE OF CONTENTS 1. INTRODUCTION ................................................................................................................................... 1 Project Location ......................................................................................................................... 1 Project Description .................................................................................................................... 1 Purpose and Project Scope of Services .................................................................................... 1 2. PROCEDURES ..................................................................................................................................... 2 2.1 Boring Layout and Soil Sampling Procedures ........................................................................... 2 2.2 Groundwater Measurements and Borehole Abandonment ....................................................... 2 2.3 Boring Log Procedures and Qualifications ................................................................................ 2 3. EXPLORATION RESULTS .................................................................................................................. 3 3.1 Site and Geology ....................................................................................................................... 3 3.2 Subsurface Soil and Groundwater Conditions .......................................................................... 3 3.3 Strength Characteristics ............................................................................................................ 3 3.4 Groundwater Conditions ............................................................................................................ 3 4. ENGINEERING ANALYSIS AND RECOMMENDATIONS .................................................................. 5 4.1 Discussion ................................................................................................................................. 5 4.2 Watermain Utilities ..................................................................................................................... 5 4.3 Backfill and Fill Selection and Compaction ............................................................................... 5 4.4 Dewatering................................................................................................................................. 5 4.5 Pavement Areas ........................................................................................................................ 5 4.6 Optional Frost Free Pavement Design ...................................................................................... 7 4.7 Construction Considerations ..................................................................................................... 7 4.8 Construction Safety ................................................................................................................... 7 4.9 Cold Weather Construction ....................................................................................................... 7 4.10 Field Observation and Testing................................................................................................... 7 4.11 Plan Review and Remarks ........................................................................................................ 8 5. STANDARD OF CARE ......................................................................................................................... 9 Appendix A Soil Boring Exhibit Logs of Test Borings Symbols and Terminology on Test Boring Log Notice to Report Users Boring Log Information Unified Soil Classification System (USCS) Geotechnical Report Arden Oaks Street Improvements Arden Hills, Minnesota WSB Project No. 014297-000 Page 1 1. INTRODUCTION Project Location The proposed roadway improvements will be in the Arden Oaks Neighborhood in Arden Hills, Minnesota. Specific roadway areas include Arden Oaks Drive, Arden Oaks Court and Arden Oaks Drive. Borings were completed through the existing pavement sections. The approximate boring locations can be found on the Soil Boring Exhibit in Appendix A. Project Description It is proposed to reconstruct the existing surface along these alignments and complete curb and gutter repairs/installation and place a new watermain. After backfilling the utilities, new roadways will be constructed. The new roadways will be two lane bituminous roads, reconstructed to about the same horizontal and vertical alignments as the existing ones. Underground utilities will consist of watermain. This utility is expected to be placed within 8 feet of final grades. WSB has developed recommendations for this project in consideration of the proposed layout, loadings, and configurations as understood at this time. WSB must be made aware of the revised or additional information in order to evaluate the recommendations for continued applicability. Purpose and Project Scope of Services Our proposal was authorized by Sue Polka, Interim City Engineer with the City of Arden Hills. In order to assist the design team in preparing plans and specifications, we have developed recommendations for pavement and utility subgrade preparation and pavement thicknesses. As such, we have completed a subsurface exploration program and prepared a geotechnical report for the referenced site. This stated purpose was a significant factor in determining the scope and level of service provided. Should the purpose of the report change the report immediately ceases to be valid and use of it without WSB’s prior review and written authorization shall be at the user’s sole risk. Our authorized scope of work has been limited to: 1. Mobilization / Demobilization of a Truck Mounted Drill Rig. 2. Clearing underground utilities utilizing the Gopher State One Call. 3. Drilling 8 standard penetration test borings to a depth of about 10 feet each. 4. Sealing the borings per Minnesota Department of Health procedures. 5. Perform soil classification and analysis. 6. Review of readily available project information and geologic data. 7. Providing this geotechnical report containing: a. Summary of our findings. b. Discussion of subsurface soil and groundwater conditions and how they may affect the proposed pavements and utilities. c. Estimated R-value of the soils. d. A discussion of soils for use as structural fill and site fill. Geotechnical Report Arden Oaks Street Improvements Arden Hills, Minnesota WSB Project No. 014297-000 Page 2 2. PROCEDURES 2.1 Boring Layout and Soil Sampling Procedures WSB recommended the boring depths and selected the desired locations. Our field crew staked the boring locations using existing site features as guides. The approximate boring locations are shown on the Soil Boring Exhibit in Appendix A which is an aerial photo. We drilled the borings on June 19, 2019, with a truck-mounted CME-55 drill rig operated by a two-person crew. The drill crew advanced the borings using continuous hollow stem augers. Drilling methods, crew chief, depths, sampling interval, casing usage, groundwater observations, test data, and other drilling information are indicated on the boring logs. Generally, the drill crew sampled at 2 ½ foot intervals to the borings termination depths. The materials encountered were described on field logs and representative samples were containerized, and transported to our laboratory for further examination and testing. The samples were visually examined to estimate the distribution of grain sizes, plasticity, consistency, moisture condition, color, presence of lenses and seams, and apparent geologic origin. We classified the soils according to type using the Unified Soil Classification System (USCS). A chart describing the Unified Soil Classification System is included in Appendix A. 2.2 Groundwater Measurements and Borehole Abandonment The drill crew observed the borings for free groundwater while drilling and after completion. These observations and measurements are noted on the boring logs. The crew then backfilled the borings with soil cuttings to comply with Minnesota Department of Health regulations. 2.3 Boring Log Procedures and Qualifications The subsurface conditions encountered by the test borings are illustrated on the Logs of Test Borings in Appendix A. Similar soils were grouped into the strata shown on the boring logs, and the appropriate estimated USCS classification symbols were also added. The depths and thickness of the subsurface strata indicated on the boring logs were estimated from the drilling results. The transition between materials (horizontal and vertical) is approximate and is usually far more gradual than shown. Information on actual subsurface conditions exists only at the specific locations indicated and is relevant only to the time exploration was performed. Subsurface conditions and groundwater levels at other locations may differ from conditions found at the indicated locations. The nature and extent of these conditions would not become evident until exposed by construction excavation. These stratification lines were used for our analytical purposes and, due to the aforementioned limitations, should not be used as a basis of design or construction cost estimates. Geotechnical Report Arden Oaks Street Improvements Arden Hills, Minnesota WSB Project No. 014297-000 Page 3 3. EXPLORATION RESULTS 3.1 Site and Geology The borings were performed on existing roadway alignments within the Arden Oaks neighborhood. The Ramsey County Geologic Atlas indicated the surficial geology in the area of our borings are glacial deposits. These deposits consist primarily of till consisting of silty and clayey sands to clay. 3.2 Subsurface Soil and Groundwater Conditions The boring profile generally consisted of a pavement section overlying fill and/or naturally deposited glacial till. Pavement Section The bituminous thickness ranged from about 5 to 6 ½ inches and averaged over 5 ½ inches. The underlying aggregate base ranged from about 5 to 13 inches and averaged about 7 ¾ inches. Fill Borings PB-E, PB-G and PB-H encountered fill beneath the aggregate base. The fill consisted mainly of sandy lean clay that was dark brown to brown and gray in color and moist. Naturally Deposited Soils Below the pavement section or fill, our borings encountered and terminated in glacially deposited soils. The glacial till consisted of sandy lean clay that contained gravel, was brown and moist. Glacial outwash consisting of sand was encountered beneath the till at a depth of about 10 feet in Boring PB-E. The fine- to coarse-grained sand contained gravel, was brown and considered moist. 3.3 Strength Characteristics The penetration resistance N-values of the materials encountered were recorded during drilling and are indicated as blows per foot (BPF). Those values provide an indication of soil strength characteristics and are located on the boring log sheets. Also, visual-manual classification techniques and apparent moisture contents were also utilized to make an engineering judgment of the consistency of the materials. Table 1 presents a summary of the penetration resistances in the soils for the standard penetration test borings completed and remarks regarding the material strengths of the soils. Table 1: Penetration Resistances Soil Type Classification Penetration Resistances Remarks Fill CL 5 to 7 BPF Variable compaction Till CL 4 to 20 BPF Very soft to hard Outwash SP 23 BPF Medium dense The preceding is a generalized description of soil conditions at this site. Variations from the generalized profile exist and should be assessed from the boring logs, the normal geologic character of the deposits, and the soils uncovered during site excavation. 3.4 Groundwater Conditions WSB took groundwater level readings in the exploratory borings, reviewed the data obtained, and discussed its interpretation of the data in the text of the report. Groundwater was not observed during or shortly after drilling and sampling. It should be noted that our borings were not left open long enough to allow for groundwater stabilization. In clay soils, it may take a long time (longer than what was available with our time on site) for water to enter a bore hole and rise to Geotechnical Report Arden Oaks Street Improvements Arden Hills, Minnesota WSB Project No. 014297-000 Page 4 its hydrostatic level. Based on our observations and the apparent moisture content in the penetration test samples it is our opinion that a static groundwater level is below the depth explored by our borings. Note that groundwater levels may fluctuate due to seasonal variations (e.g. precipitation, snowmelt and rainfall) and/or other factors not evident at the time of measurement. Geotechnical Report Arden Oaks Street Improvements Arden Hills, Minnesota WSB Project No. 014297-000 Page 5 4. ENGINEERING ANALYSIS AND RECOMMENDATIONS 4.1 Discussion Based on our borings it is our opinion that the proposed watermain and pavement can generally be supported on the soils encountered in the borings. However, soft sandy lean clay soils should be anticipated during construction and a partial removal and replacement maybe necessary. Also, the soils within the pavement subgrade consist mainly of lean clay soils, which are frost susceptible. Consideration should be given to partially subcutting these soils and replacing with a non-frost susceptible granular fill to reduce the potential frost heave below the pavement section. 4.2 Watermain Utilities Invert elevations are anticipated to be within 8 feet of existing grades and we anticipate the subgrade soils for the utilities will consist chiefly of sandy lean clay. If the clayey soils are soft or become soft it may be necessary to perform a partial subcut and replacement. Where soft unstable soils are encountered at invert grade, subexcavation of these materials to a depth of 1 to 2 feet and replacement with a coarse sand or gravel is recommended. Underground utilities are expected to be installed by backhoes completing the excavations and placing pipe and backfills. Soil compactors should be used to compact the fill in thin even lifts to the specified densities. 4.3 Backfill and Fill Selection and Compaction It is our opinion the onsite non-organic soils may be reused as backfill and fill provided they are moisture conditioned and can be compacted to their specified densities. Any wet soils excavated would need to be dried before reuse as an engineered fill. Backfills with cobbles larger than six inches (6”) should not come in contact with utilities. We recommend that soils be moisture conditioned to meet compaction specifications as determined from their standard Proctor tests (ASTM D-698). The fill should be spread in thin lifts (8 to 10 inches depending on compaction equipment) to allow for full depth compaction. Table 2 indicates the recommended compaction levels. Table 2: Recommended Level of Compaction for Backfill and Fill Area Percent of Standard Proctor Maximum Dry Density Pavement: Within 3 feet of top of subgrade Within 3 foot perimeter of structures such as manholes 100 Pavement: Greater than 3 feet below top of subgrade 95 Utility Trench (unless within 3 feet of pavement subgrade) 95 Landscaping (non-structural) 90 4.4 Dewatering Based on the results of our soil borings and the proposed construction, dewatering is not anticipated. 4.5 Pavement Areas After removing the existing pavement sections and backfilling the utilities, the final subgrade should have proper stability within three vertical feet of grading grade (grade which contacts the bottom of the aggregate base). This will generally be achieved in fill areas with proper compaction of embankment materials and in cut areas through proper subgrade preparation. The stability of the pavement subgrade should be evaluated using the test roll procedure (MnDOT 2111), except a fully loaded tandem axle dump truck or a full water truck should be utilized for the proof roll. If unstable soils are found under the test roll, Geotechnical Report Arden Oaks Street Improvements Arden Hills, Minnesota WSB Project No. 014297-000 Page 6 these soils should be improved by means of scarification, moisture conditioning, and re-compaction, or by subcutting and replacement. If the on-site soils cannot be moisture conditioned and compacted as recommended, we recommend removing these unsuitable materials and replacing them with Select Grading Material (MnDOT 2105.1.A.6). We also recommend a proof-roll be performed again on the aggregate base just prior to placement of the bituminous pavement. Table 3 below presents the approximate pavement section thickness and subgrade soils that were encountered within the borings. Table 3: Roadway Soil Boring Profiles Boring No. Bituminous Thickness (inches) Aggregate Base Thickness (inches) Subgrade Soils (Upper 4 feet) PB-A 5 12 Sandy lean clay PB-B 5 ½ 8 Sandy lean clay PB-C 6 6 Sandy lean clay PB-D 5 8 Sandy lean clay PB-E 6 5 Fill: Sandy lean clay PB-F 6 ½ 7 Sandy lean clay PB-G 5 ½ 5 Fill: Sandy lean clay PB-H 6 13 Fill: Sandy lean clay Once the site has been prepared as recommended, we anticipate the subgrade will consist predominately of sandy lean clay. The MnDOT Flexible Pavement Design Guidance Memo from January 2017, indicates soils such as those anticipated have an estimated R-value of 12. Being traffic counts were not provided to us, we have assumed that the volume and distribution of vehicles using these roadways will have 20-year flexible Equivalent Single Axle Loads (ESAL’s) less than 75,000. Based on MnDOT’s FlexPave excel design utilizing granular equivalent charts, we recommend the pavement sections indicated below in Table 4. Table 4: Recommended Flexible Pavement Section Section Thickness (inches) Granular Equivalent Bituminous Course, MnDOT 2360 2 4.5 Bituminous Course, MnDOT 2360 2 4.5 Aggregate Base, MnDOT 3138 (Class 5, 5Q, or 6) 8 8 Subgrade Preparation, MnDOT 2111 Yes - TOTAL 12 17.0 Geotechnical Report Arden Oaks Street Improvements Arden Hills, Minnesota WSB Project No. 014297-000 Page 7 Within several years after initial paving, some thermal shrinkage cracks will develop. We recommend routine maintenance be performed to improve pavement performance and increase pavement life. Pavement should be sealed with a liquid bitumen sealer to retard water intrusion into the base course and subgrade. Localized patch failures may also develop where trucks or buses turn on the pavement. When these occur, they should be cut out and patch repaired. 4.6 Optional Frost Free Pavement Design Optionally, the use of a non-frost susceptible sand cushion will help reduce the effects of frost heave. In our opinion, placement of 18 inches of select granular fill below the Class 5 Aggregate Base should generally provide for a non-frost susceptible subgrade. It should be noted that any sand cushion placed below the pavement section will provide positive benefits for reduced potential frost heave. The owner and/or design team should evaluate the costs and benefit of this option to determine if it should be incorporated into the pavement design. Drainage of the sand cushion is recommended. Drainage of the sand cushion may be accomplished by daylighting to adjacent ditches or the use of drain tile. Drain tile wrapped in a sock should be placed at the base of the sand cushion and tied into catch basins. We recommend the sand cushion contain a select granular sand with less than 12% passing the #200 sieve. Alternately, a 3 inch minus rock fill could be placed instead of a select granular sand and drain tile. For transitioning the thickness of the sand subbase along the profile of the roadway, we recommend the thickness have a longitudinal taper of no steeper than 10H:1V. A taper of 4H:1V can be used perpendicular to the centerline for cross street/driveway connections. The placement of the sand subbase should extend slightly beyond the outer edge of the curbs to maintain subgrade uniformity for frost movement. 4.7 Construction Considerations Good surface drainage should be maintained throughout the work. Under no circumstances should fill be placed into standing water. Soil corrections at this site for pavement subgrades may not be continuous in all areas. We recommend tapering the fills back to native soils at a ten to one (10:1) slope. 4.8 Construction Safety All excavations must comply with the requirements of OSHA 29 CFR, Part 1926, Subpart P “Excavations and Trenches”. This document states that excavation safety is the responsibility of the contractor. Reference to this OSHA requirement should be included in the job specifications. The responsibility to provide safe working conditions on this site, for earthwork, building construction, or any associated operations is solely that of the contractor. This responsibility is not borne in any manner by WSB. 4.9 Cold Weather Construction It is our understanding that construction is unlikely to occur during the winter months. However, if the construction does continue into the winter months we recommend the following guidelines. Only unfrozen fill should be used. Placement of fill must not be permitted on frozen soil. 4.10 Field Observation and Testing The soil conditions illustrated on the Logs of Test Borings in Appendix A are indicative of the conditions only at the boring locations. For this reason, we recommend that all excavations at this site be observed by a geotechnical engineer or technician prior to fill or backfill placement or construction of any foundation elements to determine if the soils are capable of supporting the fill backfill and/or foundation loads. These Geotechnical Report Arden Oaks Street Improvements Arden Hills, Minnesota WSB Project No. 014297-000 Page 8 observations are necessary to judge if all unsuitable materials have been removed from within the planned construction area and an appropriate degree of lateral oversize has been provided. WSB also recommends a representative number of field density tests be taken in all engineered fill and backfill placed to aid in judging its suitability. Fill placement and compaction should be monitored and tested to determine that the resulting fill and backfill conforms to specified density, strength or compressibility requirements. Prior to use, any proposed fill and backfill material should be submitted to the WSB laboratory for testing to verify compliance with recommendations and project specifications. Dynamic Cone Penetrometer (DCP) tests can be completed in the aggregate base in lieu of density testing. We recommend following MnDOT Specification 2211.3.D.2.c. WSB would be pleased to provide the necessary field observation, monitoring and testing services during construction. 4.11 Plan Review and Remarks The observations, recommendations and conclusions described in this report are based primarily on information provided to WSB, obtained from our subsurface exploration, our experience, several necessary assumptions and the scope of service developed for this project and are for the sole use of our client. We recommend that WSB be retained to perform a review of final design drawing and specifications to evaluate that the geotechnical engineering report has not been misinterpreted. Should there be any changes in the design or location of the structures related to this project or if there are any uncertainties in the report we should be notified. We would be pleased to review any project changes and modify the recommendations in this report (if necessary) or provide any clarification in writing. The entire report should be kept together; for example, boring logs should not be removed and placed in the specifications separately. The boring logs and related information included in this report are indicators of the subsurface conditions only at the specific locations indicated on the Soil Boring Exhibit and times noted on the Logs of Test Boring sheets in Appendix A. The subsurface conditions, including groundwater levels, at other locations on the site may differ significantly from conditions that existed at the time of sampling and at the boring locations. The test borings were put down by WSB solely to obtain indications of subsurface conditions as part of a geotechnical exploration program. No services were performed to evaluate subsurface environmental conditions. WSB has not performed any observations, investigations, studies or testing that is not specifically listed in the scope of service. WSB shall not be liable for failing to discover any condition whose discovery required the performance of services not authorized by the Agreement. Geotechnical Report Arden Oaks Street Improvements Arden Hills, Minnesota WSB Project No. 014297-000 Page 9 5. STANDARD OF CARE The recommendations and opinions contained in this report are based on our professional judgment. The soil testing and geotechnical engineering services performed for this project have been performed with the level of skill and diligence ordinarily exercised by reputable members of the same profession under similar circumstances, at the same time and in the same or a similar locale. No warranty, either express or implied, is made. Geotechnical Report Appendix A Arden Oaks Street Improvements Arden Hills, Minnesota WSB Project No. 014297-000 APPENDIX A Soil Boring Exhibit Log of Test Borings Symbols and Terminology on Test Boring Log Notice to Report Users Boring Log Information Unified Soil Classification Sheet (USCS) !( !( !( !( !(!( !( !( PB-A PB-B PB-C PB-D PB-E PB-F PB-G PB-H ARDEN OAKS DR COUNTY ROAD ESNELLING AVE NPASCAL AVE NARDEN OAKS CT SNELLING AVE N!(Soil Boring Location 0175 Feet¯ Soil Boring Exhibit Geotechnical Report | Arden Oaks Street and Utility Improvements Arden Hills, MN WSB Project: 014297-000 Document Path: K:\014297-000\GIS\Maps\SoilBoringExhibit\ArdenOaksSoilBoring.mxd Date Saved: 9/3/2019 8:02:06 AM1 inch = 175 feet                     !   # $%"$&'%( )* * *  &,+!* & ! +-$) .*!/3(4/1/ 5(2(0 0!7(5 *05(6 5 & .8   $"* $& ,* .* $& ,* - *) ,* - *) *!*. $'& - *)!*.*!"* %)*"*&  "!*, ,*, * 9   "*',  );9   *&,;9   !6607; ,*)<8(2 &1; (4 25; & )'=* & "*;  " (0'>1.(81!    )'=* !' $'&; (01/"&')$&&%"*)  *' !$*&-?;  #  "!*" @&+*   *'!'$ ')$$&% ,* A5B      9 # :  -!@1&  !"# %"&$ '($$$&)&&&'$'$)*+%*,+-.,* )$$'&'" *)$ !                         ! # 9  9 $%"$&'%(: )* * *  &,+!* & ! +-$) .*!/3(4/1/ 152(0 !$"*'&*)' <  *05(6 5 & .8   $"* $& ,* .* $& ,* - *) ,* - *) *!*. $'& - *)!*.*!"* %)*"*&  "!*, ,*, *  #9   "*',  );9   *&,;9   !6607; ,*)<8(2 &1; (4 25; & )'=* & "*;  " (0'>1.(81!    )'=* !' $'&; (01/"&')$&&%"*)   *' !$*&-?;  #  "!*" @&+*   *'!'$ ')$$&% ,* A5B      9 # :  -!@1&  !"# %"&$ '($$$&)&&&'$'$)*+%*,+-.,* )$$'&'" *)$ !                        ! 9 :   9$%"$&'%(9 )* * *  &,+!* & ! +-$) .*!/3(4/1/ 155( *05(6 5 & .8 : $"* $& ,* .* $& ,* - *) ,* - *) *!*. $'& - *)!*.*!"* %)*"*&  "!*, ,*, *  #9   "*',  );9   *&,;9   !6607; ,*)<8(2 &1; (4 25; & )'=* & "*;  " (0'>1.(81!    )'=* !' $'&; (01/"&')$&&%"*)  *' !$*&-?;  #  "!*" @&+*   *'!'$ ')$$&% ,* A5B      9 # :  -!@1&  !"# %"&$ '($$$&)&&&'$'$)*+%*,+-.,* )$$'&'" *)$ !                         ! #  #  $%"$&'%(: )* * *  &,+!* & ! +-$) .*!/3(4/1/ 152(0 *05(6 5 & .8    $"* $& ,* .* $& ,* - *) ,* - *) *!*. $'& - *)!*.*!"* %)*"*&  "!*, ,*, *  #9   "*',  );9   *&,;9   !6607; ,*)<8(2 &1; (4 25; & )'=* & "*;  " (0'>1.(81!    )'=* !' $'&; (01/"&')$&&%"*) ,  *' !$*&-?;  #  "!*" @&+*   *'!'$ ')$$&% ,* A5B      9 # :  -!@1&  !"# %"&$ '($$$&)&&&'$'$)*+%*,+-.,* )$$'&'" *)$ !                         '8412 ! !   9   9$%"$&'%( )* * *  &,+!* & ! +-$) .*!/0(>3(4/ 1  &,+!* & ! +-$) .*!/(00123(4/ 1/155(  &,-$) .*!/56(0/3(4/1/ 0801 *05(6 5 & .8  # $"* $& ,* .* $& ,* - *) ,* - *) *!*. $'& - *)!*.*!"* %)*"*&  "!*, ,*, *  #9   "*',  );9   *&,;9   !6607; ,*)<8(2 &1; (4 25; & )'=* & "*;  " (0'>1.(81!    )'=* !' $'&; (01/"&')$&&%"*) *  *' !$*&-?;  #  "!*" @&+*   *'!'$ ')$$&% ,* A5B      9 # :  -!@1&  !"# %"&$ '($$$&)&&&'$'$)*+%*,+-.,* )$$'&'" *)$ !                         ! 9  9$%"$&'%(# )* * *  &,+!* & ! +-$) .*!/3(4/1/ (7155( *05(6 5 & .8 9  $"* $& ,* .* $& ,* - *) ,* - *) *!*. $'& - *)!*.*!"* %)*"*&  "!*, ,*, *  #9   "*',  );9   *&,;9   !6607; ,*)<8(2 &1; (4 25; & )'=* & "*;  " (0'>1.(81!    )'=* !' $'&; (01/"&')$&&%"*)   *' !$*&-?;  #  "!*" @&+*   *'!'$ ')$$&% ,* A5B      9 # :  -!@1&  !"# %"&$ '($$$&)&&&'$'$)*+%*,+-.,* )$$'&'" *)$ !                          ! ! #    $%"$&'%( )* * *  &,+!* & ! +-$) .*!/6(7/1  &,+!* & ! +-$) .*!/3(4/1/ 5( *05(6 5 & .8   $"* $& ,* .* $& ,* - *) ,* - *) *!*. $'& - *)!*.*!"* %)*"*&  "!*, ,*, *  #9   "*',  );9   *&,;9   !6607; ,*)<8(2 &1; (4 25; & )'=* & "*;  " (0'>1.(81!    )'=* !' $'&; (01/"&')$&&%"*)   *' !$*&-?;  #  "!*" @&+*   *'!'$ ')$$&% ,* A5B      9 # :  -!@1&  !"# %"&$ '($$$&)&&&'$'$)*+%*,+-.,* )$$'&'" *)$ !                         ! ! 9   9$%"$&'%( )* * *  &,+!* & ! +-$) .*!/6(70 3(4/1  &,+!* & ! +-$) .*!/3(4/1/ 5( *05(6 5 & .8 : 9 $"* $& ,* .* $& ,* - *) ,* - *) *!*. $'& - *)!*.*!"* %)*"*&  "!*, ,*, *  99   "*',  );9   *&,;9   !6607; ,*)<8(2 &1; (4 25; & )'=* & "*;  " (0'>1.(81!    )'=* !' $'&; (01/"&')$&&%"*)   *' !$*&-?;  #  "!*" @&+*   *'!'$ ')$$&% ,* A5B      9 # :  -!@1&  !"# %"&$ '($$$&)&&&'$'$)*+%*,+-.,* )$$'&'" *)$ !     6\PERO 'HVFULSWLRQ 6\PERO 'HVFULSWLRQ +6$ /'+ROORZ6WHP$XJHU 0& 0RLVWXUHFRQWHQW $670' )$ )OLJKW$XJHU '' 'U\'HQVLW\SFI +$ +DQG$XJHU // /LTXLG/LPLW $670' 5& 6L]H$%RU1URWDU\FDVLQJ 3/ 3ODVWLF/LPLW $670' &6 &RQWLQXRXVVSOLWEDUUHOVDPSOLQJ '0 'ULOOLQJ0XG ,QVHUWVLQODVWFROXPQ -: -HWWLQJ:DWHU 6% 2'VSOLWEDUUHOVDPSOLQJ 4X 8QFRQILQHGFRPSUHVVLYHVWUHQJWKSVI $670' B/ RU2'VSOLWEDUUHOOLQHUVDPSOHU 3T 3HQHWURPHWHU5HDGLQJWVI $670' B7 RUWKLQZDOOHGWXEHVDPSOH 7V 7RUYDQH5HDGLQJWV : :DVKVDPSOH * 6SHFLILF*UDYLW\ $670' % %DJVDPSOH 6/ 6KULQNDJHOLPLWV $670' 3 7HVW3LWVDPSOH 2& 2UJDQLF&RQWHQFW $670' B4 %414RU34ZLUHOLQHV\VWHP 63 6ZHOO3UHVVXUHWVI $670' B; $;%;RU1;GRXEOHWXEHEDUUHO 36 3HUFHQWVZHOOXQGHUSUHVVXUH $670' 1 6WDQGDUGSHQHWUDWLRQWHVWEORZSHUIRRW )6 )UHHVZHOO $670' &5 &RUHUHFRYHU\SHUFHQW 66 6KULQNVZHOO $670' :/ :DWHUOHYHO S+ QD QRPHDVXUHPHQWUHFRUGHG 6& 6XOIDWHFRQWHQWSDUWVPLOOLRQRUPJO && &KORULGHFRQWHQWSDUWVPLOOLRQRUPJO & 2QHGLPHQVLRQDOFRQVROLGDWLRQ $670' 4F 7ULD[LDOFRPSUHVVLRQ $670'DQG' '6 'LUHFW6KHDU $670' . &RHIILFLHQWRISHUPHDELOLW\FPVHF $670' 3 3LQKROH7HVW $670' '+ 'RXEOHK\GURPHWHU $670' 0$ 3DUWLFOHVL]HDQDO\VLV $670' 5 /DERUDWRU\HOHFWUHLFDOUHVLVWLYLW\RKPFP $670* 96 )LHOGYDQHVKHDU $670' 54' 5RFNTXDOLW\GHVLJQDWLRQSHUFHQW ,5 ,QILOWUDWLRQ7HVW $670' 7\SH 6L]H5DQJH 7HUP 9LVXDO2EVHUYDWLRQ %RXOGHUV ! /HQVHV 6PDOOSRFNHWVRIGLIIHUHQWVRLOV &REEOHV  /DPLQDWLRQ WKLFNVWUDWXP &RDUVHJUDYHO  /D\HU WKLFNVWUDWXP )LQHJUDYHO VLHYH 6WUDWLILHG $OWHULQJOHQVHVRIYDU\LQJPDWHULDOVRUFRORUV &RDUVHVDQG VLHYHVLHYH 9DUYHG $OWHULQJODPLQDWLRQVRIFOD\VLOWILQHVDQGRUFRORUV 0HGLXPVDQG VLHYHVLHYH 'U\ 3RZGHU\QRQRWLFHDEOHZDWHU )LQHVDQG VLHYHVLHYH 0RLVW 'DPSEHORZVDWXUDWLRQ 6LOW SDVVLQJVLHYHDQG!PP :HW 0&DERYHSODVWLFOLPLW &OD\ SDVVLQJVLHYHDQGPP :DWHUEHDULQJ 3HUYLRXVVRLOEHORZZDWHUWDEOH 6DWXUDWHG &RKHVLYHVRLOZLWK0&DERYHOLTXLWOLPLW *UDYHO 'HVFULSWLRQ *UDYHO 19DOXH 5HODWLYH'HQVLW\  $OLWWOHJUDYHO   9HU\ORRVH  :LWKJUDYHO   /RRVH  *UDYHOO\   0HGLXPGHQVH   'HQVH ! 9HU\GHQVH 3DUWLFOH6L]HV 6RLO/D\HULQJDQG0RLVWXUH 6<0%2/6 6<0%2/6$1'7(50,12/2*<217(67%25,1*/2* 'ULOOLQJDQG6DPSOLQJ /DERUDWRU\7HVWLQJ 7(50,12/2*< *UDYHO&RQWHQW 6WDQGDUG3HQWUDWLRQ5HVLVWDQFH 1YDOXH &RDUVH*UDLQHG6RLOV )LQH*UDLQHG6RLOV &RKHVLRQOHVV6RLOV &RKHVLYH6RLOV 'HVFULSWLRQ 7UDFHRIJUDYHO DOLWWOHJUDYHO ZLWKJUDYHO *UDYHOO\ 9HU\KDUG 19DOXH     ! &RQVLVWHQF\ 9HU\VRIW 6RIW )LUP +DUG 127,&(725(325786(56%25,1*/2*,1)250$7,21   6XEVXUIDFH3URILOHV  7KHVXEVXUIDFHVWUDWLILFDWLRQOLQHVRQWKHJUDSKLFUHSUHVHQWDWLRQRIWKHWHVWERULQJVVKRZDQ DSSUR[LPDWHERXQGDU\EHWZHHQVRLOW\SHVRUURFN7KHWUDQVLWLRQEHWZHHQPDWHULDOVLVDSSUR[LPDWH DQGLVXVXDOO\IDUPRUHJUDGXDOWKDQVKRZQ(VWLPDWLQJH[FDYDWLRQGHSWKVVRLOYROXPHVDQGRWKHU FRPSXWDWLRQVUHO\LQJRQWKHVXEVXUIDFHVWUDWDPD\QRWEHSRVVLEOHWRDQ\GHJUHHRIDFFXUDF\  :DWHU/HYHO  :6% $VVRFLDWHV,QFWRRNJURXQGZDWHUOHYHOUHDGLQJVLQWKHH[SORUDWRU\ERULQJVUHYLHZHGWKHGDWD REWDLQHGDQGGLVFXVVHGLWVLQWHUSUHWDWLRQRIWKHGDWDLQWKHWH[WRIWKLVUHSRUW7KHJURXQGZDWHUOHYHO PD\IOXFWXDWHGXHWRVHDVRQDOYDULDWLRQVFDXVHGE\SUHFLSLWDWLRQVQRZPHOWUDLQIDOOVFRQVWUXFWLRQRU UHPHGLDWLRQDFWLYLWLHVDQGRURWKHUIDFWRUVQRWHYLGHQWDWWKHWLPHRIPHDVXUHPHQW  7KHDFWXDOGHWHUPLQDWLRQRIWKHVXEVXUIDFHZDWHUOHYHOLVDQLQWHUSUHWLYHSURFHVV6XEVXUIDFHZDWHU OHYHOPD\QRWEHDFFXUDWHO\GHSLFWHGE\WKHOHYHOVLQGLFDWHGRQWKHERULQJORJV1RUPDOO\D VXEVXUIDFHH[SORUDWLRQREWDLQVJHQHUDOLQIRUPDWLRQUHJDUGLQJVXEVXUIDFHIHDWXUHVIRUGHVLJQSXUSRVHV $QDFFXUDWHGHWHUPLQDWLRQRIVXEVXUIDFHZDWHUOHYHOVLVQRWSRVVLEOHZLWKDW\SLFDOVFRSHRIZRUN 7KHXVHRIWKHVXEVXUIDFHZDWHUOHYHOLQIRUPDWLRQSURYLGHGIRUHVWLPDWLQJSXUSRVHVRURWKHUVLWH UHYLHZFDQSUHVHQWDPRGHUDWHWRKLJKULVNRIHUURU  7KHIROORZLQJLQIRUPDWLRQLVREWDLQHGLQWKHILHOGDQGQRWHGXQGHU:DWHU/HYHO0HDVXUHPHQWVDWWKH ERWWRPRIWKHORJ   6DPSOH'HSWK  7KHORZHVWGHSWKRIVRLOVDPSOLQJDWWKHWLPHDZDWHUOHYHO PHDVXUHPHQWLVWDNHQ   &DVLQJ'HSWK  7KHGHSWKWRWKHERWWRPRIWKHFDVLQJRUKROORZVWHPDXJHU DWWKHWLPHRIZDWHUOHYHOPHDVXUHPHQW   &DYHLQ'HSWK  7KHGHSWKDWZKLFKDPHDVXULQJWDSHVWRSVLQWKHERUHKROH   :DWHU/HYHO  7KHSRLQWLQWKHERUHKROHDWZKLFKIUHHVWDQGLQJZDWHULV  HQFRXQWHUHGE\DPHDVXUHGHYLFHIURPWKHVXUIDFH  2EVWUXFWLRQ'HSWKV  2EVWUXFWLRQVDQGRUREVWUXFWLRQGHSWKVPD\EHQRWHGRQWKHERULQJORJV2EVWUXFWLRQLQGLFDWHVWKH VDPSOLQJHTXLSPHQWHQFRXQWHUHGUHVLVWDQFHWRSHQHWUDWLRQ,WPXVWEHUHDOL]HGWKDWFRQWLQXDWLRQRI GULOOLQJWKHXVHRIRWKHUGULOOLQJHTXLSPHQWRUIXUWKHUH[SORUDWLRQPD\SURYLGHLQIRUPDWLRQRWKHUWKDQ WKDWGHSLFWHGRQWKHORJV7KHFRUUHODWLRQRIREVWUXFWLRQGHSWKVRQWKHORJZLWKFRQVWUXFWLRQIHDWXUHV VXFKDVURFNH[FDYDWLRQIRXQGDWLRQGHSWKVRUEXULHGGHEULVFDQQRWQRUPDOO\EHGHWHUPLQHGZLWKDQ\ GHJUHHRIDFFXUDF\)RUH[DPSOHSHQHWUDWLRQRIZHDWKHUHGURFNE\VRLOVDPSOLQJHTXLSPHQWPD\QRW FRUUHODWHZLWKUHPRYDOE\FHUWDLQW\SHVRIFRQVWUXFWLRQHTXLSPHQW8VLQJWKLVLQIRUPDWLRQIRU HVWLPDWLQJSXUSRVHVRIWHQUHVXOWVLQDKLJKGHJUHHRIPLVLQWHUSUHWDWLRQ  $FFXUDWHO\LGHQWLI\LQJWKHREVWUXFWLRQRUHVWLPDWLQJGHSWKVZKHUHKDUGURFNLVSUHVHQWRYHUWKHVLWH UHTXLUHVDVFRSHRIVHUYLFHEH\RQGWKHQRUPDOJHRWHFKQLFDOH[SORUDWLRQSURJUDP7KHULVNRIXVLQJWKH LQIRUPDWLRQQRWHGRQWKHERULQJORJVIRUHVWLPDWLQJSXUSRVHVPXVWEHXQGHUVWRRG 3$*(,17(17,21$//</()7%/$1.  Exhibit 8 3ODQV  3$*(,17(17,21$//</()7%/$1. ROW VARIES 30'-35'ROW VARIES 30'-35'BACK OF CURB TO CENTERLINE 18' +/-0.5'BACK OF CURB TO CENTERLINE 18' +/-0.5'BACK OF CURB TO BACK OF CURB 36' +/-0.5'ROW VARIES 60'-70'ROW VARIES 30'-35'ROW VARIES 30'-35'BACK OF CURB TO CENTERLINE 18' +/-0.5'BACK OF CURB TO CENTERLINE 18' +/-0.5'BACK OF CURB TO BACK OF CURB 36' +/-0.5'ROW VARIES 60'-70'EXISITING SLOPE VARIES 1.2% TO 4.0%, 2% PROPOSEDEXISTING SLOPE VARIES 1.2% TO 4.0%, 2% PROPOSEDB418 CURB AND GUTTER - SPOT REPLACEMENTAPPROVED GRANULAR BACKFILL6" TOPSOIL WITH SEEDEXISITING SLOPE VARIES 1.2% TO 4.0%, 2% PROPOSEDEXISTING SLOPE VARIES 1.2% TO 4.0%, 2% PROPOSEDB418 CURB AND GUTTER - SPOT REPLACEMENTAPPROVED GRANULAR BACKFILL6" TOPSOIL WITH SEED120.33'0.5'10.5' MAX2.0' MIN0.5'0.5' MINB418 CURB AND GUTTER - SPOT REPLACEMENTAPPROVED GRANULARBACKFILL6" TOPSOILWITH SEED4" PERFORATED PVC DRAIN TILEFREE DRAINING AGGREGATEGEOTEXTILE FABRIC TYPE 1GEOTEXTILE FABRIC TYPE 5K:\a-f\ArdenHills\18196000\04_Production\01_CAD\01_Xrefs\C001 TYPICAL SECTIONS.dwg Jul 07, 2021 - 2:07pm444 Cedar Street, Suite 1500Saint Paul, MN 55101651.292.4400tkda.comDESCRIPTION OF REVISIONSNO. DATE BYDESIGNEDDRAWNCHECKEDDRAWING NO.PROJ. NO.FILENAME:PLOT DATE:NAME:SIGNATURE:LIC. NO.:DATE:C001TYPICAL SECTIONSLPPSPBMOBLARRY POPPLER 410056/23/2021--- --- --- ------ --- --- ------ --- --- ------ --- --- ------ --- --- ---I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION, ORREPORT WAS PREPARED BY ME OR UNDER MY DIRECTSUPERVISION AND THAT I AM A DULY LICENSED PROFESSIONALENGINEER UNDER THE LAWS OF THE STATE OF MINNESOTA.ARDEN OAKS STREETIMPROVEMENTS18196.0006" CONCRETE DRIVEWAY PAVEMENT6" AGGREGATE BASE CLASS 5SUBGRADE3" TYPE 9.5 WEARING COURSEMIXTURE (2,B) (SPWEA230B) (2 LIFTS)6" AGGREGATE BASE CLASS 5SUBGRADEPROPOSED CONCRETE DRIVEWAYPROPOSED BITUMINOUS DRIVEWAY2.0" MILL BITUMINOUS SURFACE2.0" OVERLAY TYPE 9.5 WEARING COURSE MIXTURE (2,B) (SPWEA230B)TACK COAT AS DIRECTED BY THE ENGINEEREXISTING BITUMINOUS DEPTH VARIES 3" TO 4.5"EXISTING BASE MATERIAL DEPTH VARIES 5" TO 13"MILL & OVERLAY - OPTION 22.0" TYPE 9.5 WEARING COURSE MIXTURE (2,B) (SPWEA230B)TACK COAT AS DIRECTED BY THE ENGINEER2.0" TYPE 9.5 WEARING COURSE MIXTURE (2,B) (SPWEA230B)+/- 12" FULL DEPTH RECLAMATION5" COMMON EXCAVATION1" OF CLASS 5 AGGREGATE BASEDEPTH OF BASE VARIES 7" TO 15"FULL DEPTH RECLAMATION - OPTION 1SUBGRADESUBGRADESALVAGED PAVERS6" CLASS 5 AGGREGATE BASESUBGRADE1" SAND LEVELING COURSESWEEP CRACKS WITH SELECT GRANULAR BORROWPAVER DRIVEWAYFULL DEPTH RECLAMATION - OPTION 1MILL & OVERLAY - OPTION 2DRAINTILE >>WAT WATWATWATWATWAT>>>>>>>>>>>>WAT1499148314731469145145214601462146614761486149636723682>>>> >>>>>>>>>>>>>>>0+001+002+003+004+005+006+007+008+00PI: 4+47.81PC: 5+62.81PC: 0+82.9 9 PC: 2+06.07 PT: 1+70.49 PT: 2+82.60>>WAT>>WAT>>WAT >>>>WAT>>>>WATWAT >>>>WAT>>>>WATWAT WATWATWATWATWATWATWATWATWAT146314531445143514251434144214501452WWWATT AWATATWWWAWATATWWAWATATTWWWATWATT>WWAWATAT>>WW WWWAA AAWAWATT ATATWWWAWTTATAT>T>>WWAWWATAWT>WWWATT WWAATWWWWWAWWWAATAATTTTWWWWWATWAAATATTTTTTATT WWWWWAWWAATAATTTWWWWWWWAATWAWAATTTTT>>>WWWWAWWWAATAATTTWWWAWWWATAWAAATTTWWTTT WW>>WAWATAAAT WAA>>TATWAW>>WWA ATTTWW>W WWWAWWWWAATAAATTTTWWWAWAATATTTTTTATWAAT>WA>WWWAWW 7+008+009+0010+0011+00PT: 8+76.91 9009059109159209259309359409459509559009059109159209259309359409459509550+50 1+00 1+50 2+00 2+50 3+00 3+50 4+00 4+50 5+00 5+50 6+00 6+50 7+00 7+50 8+00 8+50 9+00 9+50 10+00 10+50 11+00 11+502.21%4.84%2.10%5.28%0+41.00906.690PVI STA: 1+16.23PVI ELEV: 905.11LENGTH: 150.00LOW PT. STA: 0+83.86LOW PT ELEV: 906.24PVI STA: 7+57.94PVI ELEV: 917.15LENGTH: 275.00LOW PT. STA: 7+06.69LOW PT ELEV: 919.23PVI STA: 4+66.16PVI ELEV: 923.60LENGTH: 179.10HIGH PT. STA: 5+02.88HIGH PT ELEV: 922.20PVI STA: 11+00.44PVI ELEV: 933.72LENGTH: 355.672.21%4.84%2.10%5.28%0+41.00906.690PVI STA: 1+16.23PVI ELEV: 905.11LENGTH: 150.00LOW PT. STA: 0+83.86LOW PT ELEV: 906.24PVI STA: 7+57.94PVI ELEV: 917.15LENGTH: 275.00LOW PT. STA: 7+06.69LOW PT ELEV: 919.23PVI STA: 4+66.16PVI ELEV: 923.60LENGTH: 179.10HIGH PT. STA: 5+02.88HIGH PT ELEV: 922.20PVI STA: 11+00.44PVI ELEV: 933.72LENGTH: 355.67906.5906.52906.4906.30907.8907.31909.7909.54912.0912.18914.8914.82917.7917.46920.2919.99921.6921.62922.0922.20921.6921.74920.7920.64919.8919.65919.3919.24919.4919.47920.5920.35922.1921.87924.1924.02926.2926.39928.3928.51930.4930.33932.1931.87FILENAME:PLOT DATE:NAME:SIGNATURE:LIC. NO.:DATE:C002STREET IMPROVEMENTSLPPSPBMOBLARRY POPPLER 410056/23/2021--- --- --- ------ --- --- ------ --- --- ------ --- --- ------ --- --- ---I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION, ORREPORT WAS PREPARED BY ME OR UNDER MY DIRECTSUPERVISION AND THAT I AM A DULY LICENSED PROFESSIONALENGINEER UNDER THE LAWS OF THE STATE OF MINNESOTA.ARDEN OAKS STREETIMPROVEMENTS18196.000MATC HLI N E - ST A. 7+50 MATCHLINE - STA. 7+50MATCHLINE - STA. 11+50ARDEN OAKS DRIVEARDEN OAKS DRIVEARDEN OAKS DRIVESCALE IN FEET02040 80SCALE IN FEET02040 80 SNELLING A V E N U ELEGENDPOTENTIAL PAVER DRIVEWAY IMPACTPOTENTIAL BITUMINOUS DRIVEWAY IMPACTPOTENTIAL CONCRETE DRIVEWAY IMPACTSTREET REHABILITATION AREA100% CURB REPLACEMENTLEGENDPOTENTIAL PAVER DRIVEWAY IMPACTPOTENTIAL BITUMINOUS DRIVEWAY IMPACTPOTENTIAL CONCRETE DRIVEWAY IMPACTSTREET REHABILITATION AREA100% CURB REPLACEMENTCURB REPLACEMENTCURB REPLACEMENTDRAINTILEDRAINTILEDRAINTILEK:\a-f\ArdenHills\18196000\04_Production\01_CAD\02_Sheets\C001 STREET IMPROVEMENTS.dwg Jul 07, 2021 - 2:08pm444 Cedar Street, Suite 1500Saint Paul, MN 55101651.292.4400tkda.comDESCRIPTION OF REVISIONSNO. DATE BYDESIGNEDDRAWNCHECKEDDRAWING NO.PROJ. NO. >>>>WAT>>>>WATWAT>>>>WAT >>>>>>WATWATWATWATWATWATWATWAT1415140714011399139713951392PARK1414142412+0013+0014+0015+0016+007+00PC: 12+94.74 P C : 1 4 + 7 2 . 2 9 PC: 16+67.74P T : 1 4 + 7 1 . 0 8 PT: 16+66.6892092593093594094595095592092593093594094595095513+00 13+50 14+00 14+50 15+00 15+50 16+00 16+50 17+00 17+50 18+00 18+50 19+00 19+50 20+00 20+50 21+00 21+50 22+00 22+5022+630.71%0.76%0.70%1.47%0.17%935.1935.13935.5935.49935.8935.85936.2936.23936.6936.61937.0936.99937.4937.37937.8937.75938.1938.13938.5938.52938.9938.90939.3939.28939.7939.66940.0940.01940.4940.36940.7940.70941.1941.06941.8941.79942.3942.32>>>>>>WATWAT>>>>WAT WAT13951392 13901388137613771416142814381444144314371429PARK16+0017+0018+0019+0020+0021+0022+0022+62.76PC: 16+67.74PC: 19+38.61PT: 16+66.68PT: 18+36.29PT: 20+48.380+001+00K:\a-f\ArdenHills\18196000\04_Production\01_CAD\02_Sheets\C001 STREET IMPROVEMENTS.dwg Jul 07, 2021 - 2:08pm444 Cedar Street, Suite 1500Saint Paul, MN 55101651.292.4400tkda.comDESCRIPTION OF REVISIONSNO. DATE BYDESIGNEDDRAWNCHECKEDDRAWING NO.PROJ. NO.FILENAME:PLOT DATE:NAME:SIGNATURE:LIC. NO.:DATE:C003STREET IMPROVEMENTSLPPSPBMOBLARRY POPPLER 410056/23/2021--- --- --- ------ --- --- ------ --- --- ------ --- --- ------ --- --- ---I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION, ORREPORT WAS PREPARED BY ME OR UNDER MY DIRECTSUPERVISION AND THAT I AM A DULY LICENSED PROFESSIONALENGINEER UNDER THE LAWS OF THE STATE OF MINNESOTA.ARDEN OAKS STREETIMPROVEMENTS18196.000MATCHLINE - STA. 16+50MATCHLINE - STA. 11+50MATCHLINE - STA. 16+50ARDEN OAKS COURTARDEN OAKS COURTARDEN OAKS DRIVEARDEN OAKS DRIVEARDEN OAKS DRIVEARDE N O A K S D RI V ESCALE IN FEET02040 80SCALE IN FEET02040 80LEGENDPOTENTIAL PAVER DRIVEWAY IMPACTPOTENTIAL BITUMINOUS DRIVEWAY IMPACTPOTENTIAL CONCRETE DRIVEWAY IMPACTSTREET REHABILITATION AREA100% CURB REPLACEMENTLEGENDPOTENTIAL PAVER DRIVEWAY IMPACTPOTENTIAL BITUMINOUS DRIVEWAY IMPACTPOTENTIAL CONCRETE DRIVEWAY IMPACTSTREET REHABILITATION AREA100% CURB REPLACEMENT 9309359409459509559309359409459509550+50 1+00 1+50 2+00 2+50 3+00 3+50 4+00 4+50 5+00 5+50 6+00 6+330.68%0.65%1.18%1.89%0+00.00939.7335+57.84940.414PVI STA: 2+79.29PVI ELEV: 940.99LENGTH: 168.16LOW PT. STA: 2+81.28LOW PT ELEV: 941.27PVI STA: 1+22.77PVI ELEV: 942.05LENGTH: 101.73HIGH PT. STA: 1+46.75HIGH PT ELEV: 941.79PVI STA: 4+27.96PVI ELEV: 941.95LENGTH: 120.32HIGH PT. STA: 4+10.34HIGH PT ELEV: 941.700.68%0.65%1.18%1.89%0+00.00939.7335+57.84940.414PVI STA: 2+79.29PVI ELEV: 940.99LENGTH: 168.16LOW PT. STA: 2+81.28LOW PT ELEV: 941.27PVI STA: 1+22.77PVI ELEV: 942.05LENGTH: 101.73HIGH PT. STA: 1+46.75HIGH PT ELEV: 941.79PVI STA: 4+27.96PVI ELEV: 941.95LENGTH: 120.32HIGH PT. STA: 4+10.34HIGH PT ELEV: 941.70K:\a-f\ArdenHills\18196000\04_Production\01_CAD\02_Sheets\C001 STREET IMPROVEMENTS.dwg Jul 07, 2021 - 2:08pm444 Cedar Street, Suite 1500Saint Paul, MN 55101651.292.4400tkda.comDESCRIPTION OF REVISIONSNO. DATE BYDESIGNEDDRAWNCHECKEDDRAWING NO.PROJ. NO.FILENAME:PLOT DATE:NAME:SIGNATURE:LIC. NO.:DATE:C004STREET IMPROVEMENTSLPPSPBMOBLARRY POPPLER 410056/23/2021--- --- --- ------ --- --- ------ --- --- ------ --- --- ------ --- --- ---I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION, ORREPORT WAS PREPARED BY ME OR UNDER MY DIRECTSUPERVISION AND THAT I AM A DULY LICENSED PROFESSIONALENGINEER UNDER THE LAWS OF THE STATE OF MINNESOTA.ARDEN OAKS STREETIMPROVEMENTS18196.000SCALE IN FEET02040 80LEGENDPOTENTIAL PAVER DRIVEWAY IMPACTPOTENTIAL BITUMINOUS DRIVEWAY IMPACTPOTENTIAL CONCRETE DRIVEWAY IMPACTSTREET REHABILITATION AREA100% CURB REPLACEMENTARDEN OAKS DRIVEARDEN OAKS COURTARDEN OAKS DRIVEARDEN OAKS DRIVECOUNTY ROAD EVALLEY GUTTER Page 1 of 2 PUBLIC HEARING – 8B MEMORANDUM DATE: August 23, 2021 TO: Honorable Mayor and City Councilmembers Dave Perrault, City Administrator FROM: David Swearingen, Interim Public Works Director SUBJECT: Improvement Public Hearing for the Lexington Avenue and Target Rd Traffic Signal System Budgeted Amount: Actual Amount: Funding Source: $323,000 $198,916.75 Special Assessments Per current CIP estimate Street light portion Council Should Consider Motions to approve, table, or deny the following: • Conducting Improvement Public Hearing for the proposed Lexington Avenue and Target Rd Traffic Signal System project in accordance with City Council Resolution 2021-044. The City Council will be requested to make a formal decision regarding ordering the specific improvements and ordering project plans and specifications under Agenda Item 9B. All items need a simple majority for action unless otherwise noted. Background/Discussion On August 9, 2021, City Council approved Resolution 2021-044 receiving the feasibility report for the potential traffic signal system as part of the Lexington Avenue Reconstruction Project and ordering the Improvement Public Hearing. The feasibility report was prepared for the Cities of Shoreview and Arden Hills to document proposed improvements, project costs, funding, and assessments for a new traffic signal system installed as part of the Ramsey County Lexington Avenue Reconstruction Project. The full feasibility report has been revised per the Council comments during the August 9, 2021 City Council meeting and can be reviewed in Attachment B. Projects involving special assessments generally require two public hearings commonly known as an improvement hearing and an assessment hearing. The subject hearing for August 23 is the Page 2 of 2 improvement hearing. The purpose of the improvement hearing is for the City Council to discuss a specific local improvement before ordering it done. The second public hearing is the assessment hearing which will be scheduled after the project has been completed and the actual costs to construct the improvements have been determined. This provides property owners an opportunity to express concerns about the actual special assessments. At the improvement hearing, interested persons may voice their opinion regarding the proposed project improvements and whether or not they are in the proposed assessment area. A reasonable estimate of the total amount to be assessed and the description of the methodology used to calculate individual assessments for affected parcels is contained within the feasibility report. Pursuant to Minnesota Statutes, Chapter 429, notices of the public hearing were published in the Pioneer Press on August 10, 2021 and August 17, 2021. A notice was also mailed to each property within the draft assessment roll area on August 10, 2021. Prior to opening the hearing, City staff will present general information regarding the scope of the proposed improvements, the overall cost and funding for the project, and assessments that apply for this project. The proposed improvements are generally summarized below and described in greater detail within the feasibility study report provided in Attachment B. The 2013 Master Planned Unit Development (PUD) agreement, Attachment C, for the Lexington Station commercial site includes access and cost participation requirements related to the proposed Target Road traffic signal. The master PUD agreement states that full development of the Lexington Station commercial property will include a new access driveway aligned with Target Road to replace the current access point along Lexington Avenue. The new access is required to include the proposed traffic signal at Target Road based on a completed traffic study. The master PUD agreement further requires the developer of the Lexington Station site to pay for or accept an assessment against the project property for the cost of the access improvements, including the traffic signal. Budget Impact The total fee for the feasibility report is $5,570.00. The City of Shoreview has agreed to split the cost, therefore, the City of Arden Hills fee total is $2,785.00 From the feasibility report, the total estimated improvements costs for the traffic signal is $191,385.00. To date the City has also incurred some other legal and engineering costs attributed to this project in the amount of $4,746.75. This brings the total estimated costs to $198,916.75. All costs for this improvement are assessed to the benefitting properties as outlined on pages 5 through 7 of the feasibility report. Attachments Attachment A – Presentation Slides Attachment B – Feasibility Report – Alliant Attachment C – Master PUD Agreement Page 2 of 3 Improvement HearingLexington Ave and Target Rd Traffic Signal System Improvement__________________________Public HearingAugust 23, 20211 Attachment A Outline1. 2013 Master PUD Agreement2. Feasibility Study3. Project Improvements4. Project Costs and Funding5. Draft Assessment Rates6. Next Steps2 2013 Master Planned Unit Development Agreement – Lexington Station•Access and participation requirements•States that full development of Lexington Station Commercial property will include a new access driveway at Target Rd•Traffic signal is required•Requires the developer of the site to pay for and accept assessment from the improvements3 Feasibility Study•Completed by Alliant Engineering•Describes the proposed traffic signal improvements•Estimated project costs, funding and assessments•Received by Council on August 9, 2021•Language added for synchronization of the signal with the other signals along Lexington Avenue4 Project Improvements5 Project Cost and Funding6•Properties with direct access to Lexington Avenue via the new Target Road intersection and which are therefore benefitting from the proposed improvements will be assessed Draft Assessment Rates7Scenario 1 Scenario 23757 Lexington Ave N $7,098.25 $0.003751 Lexington Ave N $51,004.10 $0.003845 Lexington Ave N $44,427.55 $63,795.003833 Lexington Ave N $44,427.55 $63,795.003787 Lexington Ave N $44,427.55 $63,795.00Assessment AmountParcel AddressTotal estimated cost: $191,385.00 Next Steps•Improvement Public Hearing – August 23, 2021•Adopt Resolution ordering the Improvement – August 23, 2021•Council approves plans and specs – September 2021•Bids opened (Ramsey County) – November 2021•County Board awards the Bid – December 2021•Ramsey County begins construction – April 2022•Construction substantially complete – November 2022•City Council sets date for Assessment Hearing – September 2022•City Council holds Assessment Hearing – October 20228 QUESTIONS9    >ĞdžŝŶŐƚŽŶ ǀĞŶƵĞ ZĞĐŽŶƐƚƌƵĐƚŝŽŶ WƌŽũĞĐƚ  WƌĞƉĂƌĞĚ&Žƌ͗  ŝƚLJŽĨƌĚĞŶ,ŝůůƐ ŝƚLJŽĨ^ŚŽƌĞǀŝĞǁ   ŝƚLJŽĨƌĚĞŶ,ŝůůƐWƌŽũĞĐƚEŽ͘ϭϴͲϬϭϬϰ ŝƚLJŽĨ^ŚŽƌĞǀŝĞǁWƌŽũĞĐƚEŽ͘ϮϭͲϬϭ   WƌĞƉĂƌĞĚLJ͗     ϳϯϯDĂƌƋƵĞƚƚĞǀĞŶƵĞ^ŽƵƚŚ͕^ƵŝƚĞϳϬϬ DŝŶŶĞĂƉŽůŝƐ͕DEϱϱϰϬϮ  &ĞĂƐŝďŝůŝƚLJZĞƉŽƌƚ ƵŐƵƐƚϭϮ͕ϮϬϮϭ $WWDFKPHQW%    ddĂďůĞŽĨŽŶƚĞŶƚƐ  ,,QWURGXFWLRQ ,,3URMHFW6FRSH ,,,([LVWLQJ&RQGLWLRQV ,93URSRVHG,PSURYHPHQWV 93XEOLF,QIRUPDWLRQ0HHWLQJV 9,7UDIILF$QDO\VLV 9,,(VWLPDWHG3URMHFW&RVWV 9,,,)LQDQFLQJDQG$VVHVVPHQWV ,;3URMHFW6FKHGXOH ;)HDVLELOLW\1HFHVVLW\DQG&RVW(IIHFWLYHQHVV ;,&RQFOXVLRQ      (;+,%,76 ([KLELW± 3URMHFW/RFDWLRQ0DS VHHSDJH  ([KLELW /H[LQJWRQ$YHQXH/D\RXW  $33(1',&(6 $SSHQGL[$±$UGHQ+LOOV&LW\&RXQFLO5HVROXWLRQ1R$SSURYLQJ3URMHFW $SSHQGL[%±6KRUHYLHZ&LW\&RXQFLO5HVROXWLRQ1R$SSURYLQJ3URMHFW $SSHQGL[&±6XSSRUWLQJ7UDIILF$QDO\VLV)LJXUHV $SSHQGL['±/H[LQJWRQ$YHQXH5HFRQVWUXFWLRQ ,WR&5( 7UDIILF6WXG\±$SULO $SSHQGL[(±/H[LQJWRQ6WDWLRQ3KDVH&RQFHSW3ODQ±)HEUXDU\ $SSHQGL[)±(QJLQHHUV(VWLPDWHIRU5DPVH\&RXQW\/H[LQJWRQ$YHQXH3URMHFW $SSHQGL[*±5DPVH\&RXQW\3XEOLF:RUNV&RVW3DUWLFLSDWLRQ3ROLF\ $SSHQGL[+±%HQHILWLQJ3URSHUWLHV0DS $SSHQGL[,±3UHOLPLQDU\$VVHVVPHQW5ROOV 3HQGLQJ  $SSHQGL[-±&LW\RI$UGHQ+LOOV$VVHVVPHQW3ROLF\      ,,QWURGXFWLRQ 5DPVH\&RXQW\LQFRRSHUDWLRQZLWKWKH&LW\RI $UGHQ+LOOVDQGWKH&LW\RI6KRUHYLHZKDV SURJUDPPHGD\HDUUHFRQVWUXFWLRQRI /H[LQJWRQ$YHQXH &6$+ EHWZHHQ, DQG&RXQW\5RDG(/H[LQJWRQ$YHQXHIRUPV WKHERUGHUEHWZHHQWKH&LW\RI$UGHQ+LOOVDQG WKH&LW\RI6KRUHYLHZ7KHSURMHFWORFDWLRQLV VKRZQLQ([KLELW)LQDOGHVLJQKDVEHHQ FRPSOHWHGIRUWKHSURMHFWDQGFRQVWUXFWLRQLV DQWLFLSDWHGWREHJLQLQWKHVSULQJRI.H\ LPSURYHPHQWVFRQVLVWRISDYHPHQW UHFRQVWUXFWLRQJHRPHWULFVSHGHVWULDQDQG ELF\FOHIDFLOLWLHVSXEOLFXWLOLWLHVDQGWUDIILF VLJQDOV\VWHPVLQFOXGLQJFRQVWUXFWLRQRIDQHZ VLJQDOL]HGLQWHUVHFWLRQDWWKHH[LVWLQJ7DUJHW 5RDGLQWHUVHFWLRQ 7KHSURSHUWLHVDGMDFHQWWR/H[LQJWRQ$YHQXHLQWKH SURMHFWDUHDFRQVLVWSULPDULO\RIUHWDLODQGVHUYLFHUHODWHGODQGXVHV/H[LQJWRQ$YHQXHSURYLGHVDFFHVVWR DVPDOOUHVLGHQWLDOQHLJKERUKRRGRQ,VODQG/DNH$YHQXHWRWKHHDVWRIWKHFRUULGRUYLD*UH\)R[5RDG 7KHSURSHUW\DORQJ/H[LQJWRQ$YHQXHZLWKLQWKHSURMHFWOLPLWVLVGHYHORSHGZLWKWKHH[FHSWLRQRI&RXQW\ SDUNODQGORFDWHGRQWKHHDVWVLGHRI/H[LQJWRQ$YHQXHEHWZHHQWKH&DQDGLDQ3DFLILF5DLOURDGWUDFNVDQG ,VODQG/DNH$YHQXH /H[LQJWRQ6WDWLRQLVDQH[LVWLQJPXOWLXVHGHYHORSPHQWORFDWHGLQWKHVRXWKZHVWFRUQHURIWKH/H[LQJWRQ $YHQXHDQG5HG)R[5RDGLQWHUVHFWLRQ7KHH[LVWLQJEXLOGLQJORFDWHGDW/H[LQJWRQ$YHQXH1RUWK LVSODQQHGIRUGHPROLWLRQZLWKDSURSRVHG3KDVHH[SDQVLRQRIWKH/H[LQJWRQ6WDWLRQGHYHORSPHQW7KH GHYHORSHUKDVFRRUGLQDWHGDFFHVVWRWKH/H[LQJWRQ6WDWLRQ3KDVHSURSHUW\ZLWK5DPVH\&RXQW\DQGWKH &LW\RI$UGHQ+LOOV$VSDUWRIWKHDJUHHPHQWEHWZHHQDOOSDUWLHVWKHH[LVWLQJDFFHVVSRLQWWR/H[LQJWRQ 6WDWLRQEHWZHHQ7DUJHW5RDGDQG5HG)R[5RDGZLOODOVREHUHPRYHG 7KHSURSRVHGQHZDFFHVVWR/H[LQJWRQ6WDWLRQZLOOIRUPDIRXUWKOHJDWWKHH[LVWLQJ7DUJHW5RDG LQWHUVHFWLRQ$QHZVLJQDOV\VWHPZLOOEHFRQVWUXFWHGE\5DPVH\&RXQW\ZLWKWKH/H[LQJWRQ$YHQXH 5HFRQVWUXFWLRQ3URMHFW7KHLQWHUVHFWLRQLVFXUUHQWO\XQVLJQDOL]HGZLWKVLGHVWUHHWVWRSFRQWURORQ7DUJHW 5RDG&RRUGLQDWLRQEHWZHHQWKH/H[LQJWRQ6WDWLRQGHYHORSHUDQGWKHRZQHUVRI/H[LQJWRQ$YHQXH DQG/H[LQJWRQ$YHQXHFRQFOXGHGWKDWWKHSURSHUW\RZQHUVPD\EHDPHQDEOHWRFRRUGLQDWLQJFURVV DFFHVVDJUHHPHQWVWRSURYLGHVKDUHGDFFHVVWRWKHVLJQDOL]HGLQWHUVHFWLRQDW7DUJHW5RDG7KHUHLVDQ H[LVWLQJFURVVDFFHVVDJUHHPHQWLQSODFHEHWZHHQWKHRZQHUVRIDQG/H[LQJWRQ$YHQXHWR VKDUHDFRPPRQGULYHZD\7KHSURSRVHG&RXQW\5RDGLPSURYHPHQWVZLOOFRQVWUXFWDFRQWLQXRXVPHGLDQ DORQJ/H[LQJWRQ$YHQXHHIIHFWLYHO\FRQYHUWLQJWKHH[LVWLQJDFFHVVWR/H[LQJWRQ$YHQXHDQG /H[LQJWRQ$YHQXHWRDULJKWLQULJKWRXWDFFHVV7KH&RXQW\LVQRWSDUW\WRFURVVDFFHVVDJUHHPHQWVDQG FRRUGLQDWLRQZLOOUHTXLUHZLOOLQJSDUWLFLSDWLRQRIDOODIIHFWHGSURSHUWLHV7KH&RXQW\¶V/H[LQJWRQ$YHQXH SURMHFWGRHVQRWLQFOXGHFRQVWUXFWLRQRIDSK\VLFDOGULYHZD\FRQQHFWLRQIURP/H[LQJWRQ6WDWLRQWRVHUYH WKHSURSHUWLHVWRWKHVRXWK,PSURYHPHQWVZRXOGKDYHWREHFRQVWUXFWHGE\WKHSULYDWHSDUWLHVWRSURYLGH VKDUHGDFFHVV ([KLELW±3URMHFW/RFDWLRQ0DS   $WUDIILFVWXG\ZDVSUHSDUHGLQIRUWKH5DPVH\&RXQW\UHFRQVWUXFWLRQSURMHFW7KHWUDIILFVWXG\LV LQFOXGHGLQWKH$SSHQGL['/HIWWXUQPRYHPHQWVRXWRI/H[LQJWRQ6WDWLRQDQG7DUJHW VRXWKHQWUDQFHRQ 7DUJHW5RDG H[SHULHQFHVLJQLILFDQWGHOD\XQGHUPLGGD\DQGSPSHDNKRXUYROXPHVFXUUHQWO\7KH UHGHYHORSPHQWRIWKH/H[LQJWRQ6WDWLRQVLWHZLOOIXUWKHUH[DFHUEDWHWUDIILFRSHUDWLRQVRQ/H[LQJWRQ $YHQXH5DPVH\&RXQW\DJUHHGWRFRQVLGHUDWUDIILFVLJQDOV\VWHPDW7DUJHW5RDGLQWHUVHFWLRQWR LPSURYHDFFHVVDQGVDIHW\7KHUHDUHH[LVWLQJVLJQDOL]HGLQWHUVHFWLRQVLQFORVHSUR[LPLW\DW*UH\)R[ 5RDGDQG5HG)R[5RDG7KHFRQYHUVLRQRI7DUJHW5RDGWRDIXOOVLJQDOL]HGLQWHUVHFWLRQGRHVQRWPHHW WKH&RXQW\¶VDFFHVVVSDFLQJJXLGHOLQHV:LWKRXWSULYDWHDFFHVVQHHGVDQGGHYHORSPHQWGHPDQGIRUD WUDIILFVLJQDODW7DUJHW5RDGWKH&RXQW\ZRXOGQRWQRUPDOO\LQVWDOODWUDIILFVLJQDOV\VWHPDWWKDWORFDWLRQ )RUWKLVUHDVRQWKH&RXQW\GHHPVWKHFRVWRIWKHVLJQDOV\VWHPWREHDORFDOFRVW3HUWKH&RXQW\¶V DGRSWHGFRVWVKDULQJSROLF\IRUURDGZD\LPSURYHPHQWSURMHFWVLQFOXGHGLQ$SSHQGL[*ORFDODJHQFLHV DUHUHVSRQVLEOHIRUIXQGLQJWUDIILFVLJQDOVFRUUHVSRQGLQJWRORFDOURDGOHJVRIWKHLQWHUVHFWLRQ 7KHLPSURYHPHQWVLQFOXGHGLQWKLVSURMHFWKDYHEHHQLGHQWLILHGWKURXJKWKHUHVXOWRIDWUDIILFVWXG\DQG FRRUGLQDWLRQZLWK5DPVH\&RXQW\ZKRPDLQWDLQVDQGRSHUDWHVWKHURDGZD\7KHLPSURYHPHQWVDUH FRQVLVWHQWZLWKWKH&LW\RI$UGHQ+LOOVDQG&LW\RI6KRUHYLHZ&RPSUHKHQVLYH3ODQVIRUWKHDUHD7KURXJK HYDOXDWLRQRIWKHVHLQIUDVWUXFWXUHFRPSRQHQWVDQGLQSXWIURPSURSHUW\RZQHUVWKH(QJLQHHULQJ 'HSDUWPHQWVDUHUHFRPPHQGLQJWKHVHLPSURYHPHQWVWRWKH&LW\&RXQFLOV ,IWKH&RXQFLOVGHFLGHWRSURFHHGZLWKWKHVHLPSURYHPHQWVWKHQH[WVWHSLQWKHSXEOLFLPSURYHPHQW SURFHVVZRXOGEHWRFRQGXFWIRUPDOSXEOLFLPSURYHPHQWKHDULQJV$GGLWLRQDOLQIRUPDWLRQUHJDUGLQJ SRWHQWLDOSXEOLFKHDULQJGDWHVFDQEHIRXQGLQWKH6FKHGXOHVHFWLRQEHORZ ,,3URMHFW6FRSH 7KHVFRSHRIWKLVUHSRUWLVWRDQDO\]HWKHWUDIILFVLJQDOV\VWHPDQGDVVRFLDWHGJHRPHWULFLPSURYHPHQWVDW 7DUJHW5RDGWRGHWHUPLQHWKHHQJLQHHULQJDQGILVFDOIHDVLELOLW\RISURYLGLQJWKHQHFHVVDU\LPSURYHPHQWV 7KHVWXG\ZLOOGLVFXVVWKHH[LVWLQJFRQGLWLRQVSURSRVHGLPSURYHPHQWVHVWLPDWHGFRQVWUXFWLRQFRVWVDQG RYHUKHDGFRVWV LHDGPLQLVWUDWLRQHQJLQHHULQJILVFDODQGOHJDOH[SHQVHV &XUUHQWSXEOLFLPSURYHPHQW SROLFLHVDGRSWHGE\WKH$UGHQ+LOOVDQG6KRUHYLHZ&LW\&RXQFLOVZLOOEHXVHGDVDJXLGHOLQHWRGLVFXVV ILQDQFLQJPHWKRGVIRUWKHSURSRVHGLPSURYHPHQWV ,,,([LVWLQJ&RQGLWLRQV /H[LQJWRQ$YHQXHLVPDLQWDLQHGDQGRSHUDWHGE\5DPVH\&RXQW\([LVWLQJ/H[LQJWRQ$YHQXHKDVIRXU WKURXJKODQHVDQGDFRQWLQXRXVOHIWWXUQODQHDWWKH7DUJHW5RDGLQWHUVHFWLRQ7KHWKUHHOHJJHG LQWHUVHFWLRQLVFXUUHQWO\VWRSFRQWUROOHGRQWKH7DUJHW5RDGOHJWRWKHHDVW7DUJHW5RDGRQWKHHDVWVLGHRI /H[LQJWRQ$YHQXHLVDSODWWHGURDGZD\KRZHYHUWKHURDGWHUPLQDWHVDWWKH7DUJHWVWRUH([LVWLQJ7DUJHW 5RDGHVVHQWLDOO\RSHUDWHVDVDIXOODFFHVVSRLQWIRU7DUJHWDQGRWKHUGHYHORSHGSDUFHOVRQWKHHDVWVLGHRI /H[LQJWRQ$YHQXH7KHUHLVDSDYHGPXOWLXVHWUDLODORQJWKHHDVWVLGHRI/H[LQJWRQ$YHQXH7KHUHDUH FXUUHQWO\QRGHGLFDWHGSHGHVWULDQDQGELF\FOHIDFLOLWLHVDORQJWKHZHVWVLGHRI/H[LQJWRQ$YHQXHDW7DUJHW 5RDG7KH/H[LQJWRQ$YHQXHFRUULGRULVDOVRVHUYHGE\PXOWLSOHEXVURXWHV ,93URSRVHG,PSURYHPHQWV /H[LQJWRQ$YHQXHZLOOEHUHFRQVWUXFWHGWKURXJKRXWWKHSURMHFWOLPLWVZLWKDFRQWLQXRXVFHQWHUPHGLDQ 1RUWKERXQGDQGVRXWKERXQGOHIWDQGULJKWWXUQODQHVZLOOEHSURYLGHGDWLQWHUVHFWLRQV$QDGGLWLRQDOOHJ ZLOOEHDGGHGWRWKH7DUJHW5RDGLQWHUVHFWLRQRQWKHZHVWVLGHRI/H[LQJWRQ$YHQXHWRSURYLGHDFFHVVWR WKH/H[LQJWRQ6WDWLRQGHYHORSPHQWDQGSRWHQWLDOO\DGGLWLRQDOSURSHUWLHVWRWKHVRXWK7KHSURSHUWLHV VRXWKRI/H[LQJWRQ6WDWLRQ /H[LQJWRQ$YHQXHDQG/H[LQJWRQ$YHQXH PD\KDYHWKH   RSSRUWXQLW\WRFRQQHFWWRWKHQHZLQWHUVHFWLRQOHJYLDFURVVDFFHVVDJUHHPHQWVLIWKHSDUWLHVFDQZRUNRXW DJUHHPHQWVZLWKIDFLOLWDWLRQDVVLVWDQFHIURPWKH&LW\RI$UGHQ+LOOVDQGZRUNWRJHWKHUWRFRQVWUXFWD VPDOOVHJPHQWRIFRQQHFWLQJGULYHZD\SDYHPHQW7KHH[LVWLQJ/H[LQJWRQ6WDWLRQGULYHZD\RQWR /H[LQJWRQ$YHQXHZLOOEHUHPRYHG7KHQHZVLJQDOL]HGLQWHUVHFWLRQZLOOLPSURYHDFFHVVWRSURSHUWLHVRQ ERWKVLGHVRI/H[LQJWRQ$YHQXHE\SURYLGLQJFRQWUROOHGDFFHVVZKLFKZLOOSURYLGHRSHUDWLRQDODQGVDIHW\ EHQHILWVIRUDOOPRGHVRIWUDYHOWKURXJKWKHLQWHUVHFWLRQ7KHQHZVLJQDOV\VWHPZLOOEHLQWHUFRQQHFWHGWR RWKHUVLJQDOV\VWHPVDORQJ/H[LQJWRQ$YHQXHWRV\QFKURQL]HRSHUDWLRQVDORQJWKHFRUULGRU 5DPVH\&RXQW\KDVPDGHWKHGHWHUPLQDWLRQWKDWWKHQHHGIRUWKHWUDIILFVLJQDOV\VWHPDW7DUJHW5RDGLV VROHO\GULYHQE\DGMDFHQWGHYHORSPHQWDQGSULYDWHDFFHVVQHHGVDQGWKHUHIRUHFRVWUHVSRQVLELOLW\IRU FDSLWDOFRVWVWRSURFXUHDQGLQVWDOOWKHVLJQDOV\VWHPVKRXOGEHSDLGIRUE\WKHORFDODJHQFLHV3HUWKH &RXQW\¶VFRVWVKDULQJSROLF\HDFKFLW\ZLOOEHUHVSRQVLEOHIRUWKHLUOHJVRIWKHVLJQDOV\VWHPDQGLQWKLV FDVHHDFKFLW\ZRXOGDOVREHUHVSRQVLEOHIRURQHRIWKHOHJVRQ/H[LQJWRQ$YHQXH 93XEOLF,QIRUPDWLRQ0HHWLQJV 5DPVH\&RXQW\3XEOLF:RUNVFRQGXFWHGWZRSXEOLFRSHQKRXVHVGXULQJWKHGHVLJQSKDVHRIWKHSURMHFW 7KHLQLWLDOSXEOLFRSHQKRXVHZDVKHOGRQ'HFHPEHU7KHLQLWLDORSHQKRXVHLQFOXGHG SUHVHQWDWLRQRIPDWHULDOVUHJDUGLQJH[LVWLQJFRQGLWLRQVDQGVROLFLWHGLQSXWIURPWKHSXEOLFWRKHOSJXLGH WKHLPSURYHPHQWSURMHFW$VHFRQGSXEOLFRSHQKRXVHZDVKHOGRQ$SULOWRSUHVHQWGHVLJQ DOWHUQDWLYHVDQGVROLFLWIHHGEDFNRQWKHSUHIHUUHGDOWHUQDWLYH6HHWKH6FKHGXOHVHFWLRQEHORZIRU LQIRUPDWLRQRQDQWLFLSDWHG3XEOLF+HDULQJGDWHV 9,7UDIILF$QDO\VLV $WUDIILFDQDO\VLVZDVSHUIRUPHGWRGHWHUPLQHHVWLPDWHGYHKLFOHWULSJHQHUDWLRQIRUSURSHUWLHVWKDWZRXOG EHQHILWIURPWKHQHZWUDIILFVLJQDOV\VWHPDQGDVVRFLDWHGJHRPHWULFLPSURYHPHQWVDW7DUJHW5RDG'XH WRQRQW\SLFDOWUDIILFSDWWHUQVGXULQJWKH&RYLGSDQGHPLFYHKLFOHFRXQWVDWWKHSURMHFWVLWHWR GHWHUPLQHWULSVXWLOL]LQJLQGLYLGXDOGULYHZD\VFRXOGQRWEHFROOHFWHG$OOLDQW(QJLQHHULQJ,QFGHYHORSHG HVWLPDWHGWULSVIRUHDFKSRWHQWLDOEHQHILWWLQJSURSHUW\RQERWKVLGHVRI/H[LQJWRQ$YHQXH7ULSVZHUH HVWLPDWHGXVLQJWKH,QVWLWXWHRI7UDQVSRUWDWLRQ(QJLQHHUV7ULS*HQHUDWLRQ0DQXDOWK(GLWLRQEDVHGRQ DVVXPHGQXPEHURIWULSVIRUHDFKODQGXVHFDWHJRU\IRUWKHH[LVWLQJSURSHUWLHVSHUWKHLUFXUUHQWXVH)XWXUH ODQGXVHIRU/H[LQJWRQ6WDWLRQ3KDVHLVEDVHGRQWKHGHYHORSHU¶VSURSRVHGFRQFHSWSODQGDWHG)HEUXDU\ LQFOXGHGLQ$SSHQGL[(7KHFRQFHSWSODQIRU/H[LQJWRQ6WDWLRQ3KDVHSURSRVHVD VTXDUHIHHWJURFHU\VWRUH%XVLQHVVKRXUVZHUHDQDO\]HGDQGWULSVZHUHGHWHUPLQHGIRUW\SLFDOZHHNGD\ 6DWXUGD\DQG6XQGD\WRGHWHUPLQHWRWDOZHHNO\WULSVIRUHDFKSDUFHO7KHJHQHUDWHGZHHNO\WRWDOWULSV ZKHUHWKHQDVVLJQHGWRWKHDGMDFHQWURDGZD\QHWZRUNEDVHGRQWKHGLUHFWLRQDOGLVWULEXWLRQGHILQHGLQ 5DPVH\&RXQW\¶V/H[LQJWRQ$YHQXH5HFRQVWUXFWLRQ7UDIILF6WXG\DWWDFKHGLQ$SSHQGL[(DQG HQJLQHHULQJMXGJHPHQW  7ULSJHQHUDWLRQZDVSUHSDUHGIRUWZRVFHQDULRVZLWKGLIIHUHQWDFFHVVFRQGLWLRQVRQWKHQHZO\FRQVWUXFWHG ZHVWOHJRIWKHLQWHUVHFWLRQ  6FHQDULR±7KLVVFHQDULRDVVXPHVDJUHHPHQWVFDQEHZRUNHGRXWEHWZHHQWKH/H[LQJWRQ$YHQXH DQG/H[LQJWRQ$YHQXHSURSHUWLHVDQGWKH/H[LQJWRQ6WDWLRQ3KDVHRZQHUWRSURYLGHFURVVDFFHVV DOORZLQJWKH/H[LQJWRQ$YHQXHDQG/H[LQJWRQ$YHQXHSURSHUWLHVWRDFFHVVWKHVLJQDOL]HG LQWHUVHFWLRQ  6FHQDULR±7KLVVFHQDULRDVVXPHVWKDWWKHRQO\EHQHILWWLQJSURSHUW\RQWKHZHVWVLGHRIWKHLQWHUVHFWLRQ LV/H[LQJWRQ6WDWLRQ/H[LQJWRQ$YHQXHDQG/H[LQJWRQ$YHQXHZRXOGKDYHDULJKWLQULJKW RXWDFFHVVWR/H[LQJWRQ$YHQXH1RGULYHZD\FRQQHFWLRQZRXOGEHPDGHEHWZHHQ/H[LQJWRQ6WDWLRQDQG WKHSURSHUWLHVWRWKHVRXWK    $VXPPDU\RIWKHWRWDOZHHNO\WKURXJKWULSVDQGSHUFHQWRIZHHNO\WULSVWRHDFKEHQHILWWLQJSDUFHOIRU 6FHQDULRDQG6FHQDULRLVLQFOXGHGLQ$SSHQGL[& 9,,(VWLPDWHG3URMHFW&RVWV 7KHWRWDOHVWLPDWHGFRQVWUXFWLRQFRVWVIRUWKH5DPVH\&RXQW\UHFRQVWUXFWLRQSURMHFWLV 7KHHVWLPDWHGFRVWVIRUWKHSURSRVHG7DUJHW5RDGWUDIILFVLJQDOV\VWHPLPSURYHPHQWVDUHDVVKRZQEHORZ LQ7DEOH  7DEOH±(VWLPDWHG&RQVWUXFWLRQ&RVWV 7UDIILF&RQWURO6LJQDO6\VWHP&  7UDIILF&RQWURO6LJQDO6\VWHP& (PHUJHQF\9HKLFOH3UHHPSWLRQ6\VWHP&     3URUDWHG,WHPV $VEXLOW0RELOL]DWLRQ)LHOGRIILFH7\SH'0RGLILHG 7UDIILF&RQWURO      7RWDO(VWLPDWHG&RQVWUXFWLRQ&RVWV  &LW\RI$UGHQ+LOOV6KDUHRI(VWLPDWHG&RQVWUXFWLRQ&RVWV±7UDIILF&RQWURO6LJQDO6\VWHP&  7UDIILF&RQWURO6LJQDO6\VWHP&   (PHUJHQF\9HKLFOH3UHHPSWLRQ6\VWHP&      3URUDWHG,WHPV  &LW\RI$UGHQ+LOOV7RWDO(VWLPDWHG&RQVWUXFWLRQ&RVWV      &LW\RI6KRUHYLHZ6KDUHRI(VWLPDWHG&RQVWUXFWLRQ&RVWV±7UDIILF&RQWURO6LJQDO6\VWHP&  7UDIILF&RQWURO6LJQDO6\VWHP&   (PHUJHQF\9HKLFOH3UHHPSWLRQ6\VWHP&      3URUDWHG,WHPV  &LW\RI6KRUHYLHZ7RWDO(VWLPDWHG&RQVWUXFWLRQ&RVWV     1RWH 3URUDWHGLWHPVFRVWLVVKDUHGDFURVVDOOLWHPVEDVHGRQSHUFHQWDJHRIRYHUDOOFRQVWUXFWLRQFRVWV   (QJLQHHULQJDQGFRQVWUXFWLRQDGPLQLVWUDWLRQDQGLQVSHFWLRQFRVWVZLOOEHERUQHE\5DPVH\&RXQW\DQG LQGLUHFWO\E\WKHSURMHFWDJHQF\SDUWQHUV7KHIXWXUHRSHUDWLQJDQGPDLQWHQDQFHFRVWVLQFOXGLQJSRZHU FRVWVIRUWKHVLJQDOV\VWHPZLOOEHDGGUHVVHGLQDVHSDUDWHDJUHHPHQWEHWZHHQWKHDJHQFLHV (QJLQHHULQJFRVWVDUHH[SHFWHGWREHDSSUR[LPDWHO\RIWKHWRWDOFRQVWUXFWLRQFRVWV%LGGLQJVHUYLFHV FRQVWUXFWLRQDGPLQLVWUDWLRQLQVSHFWLRQDQGPDWHULDOVWHVWLQJFRVWVDUHH[SHFWHGWREHDSSUR[LPDWHO\ RIWKHWRWDOFRQVWUXFWLRQFRVWV 7RWDOHVWLPDWHG&LW\FRVWVIRUWKHSURSRVHG7DUJHW5RDGWUDIILFVLJQDOV\VWHPLPSURYHPHQWVDUHVKRZQLQ 7DEOH    7DEOH±(VWLPDWHG&LW\,PSURYHPHQW&RVWV 7UDIILF6LJQDO6\VWHP&  &LW\RI$UGHQ+LOOV7RWDO(VWLPDWHG&RQVWUXFWLRQ&RVWV    (QJLQHHULQJ %LGGLQJ&RQVWUXFWLRQ$GPLQLVWUDWLRQ,QVSHFWLRQDQG7HVWLQJ   &LW\RI$UGHQ+LOOV7RWDO(VWLPDWHG,PSURYHPHQW&RVWV     &LW\RI6KRUHYLHZ7RWDO(VWLPDWHG&RQVWUXFWLRQ&RVWV    (QJLQHHULQJ %LGGLQJ&RQVWUXFWLRQ$GPLQLVWUDWLRQ,QVSHFWLRQDQG7HVWLQJ   &LW\RI6KRUHYLHZ7RWDO(VWLPDWHG,PSURYHPHQW&RVWV     7RWDO,PSURYHPHQW&RVWV 9,,,)LQDQFLQJDQG$VVHVVPHQWV 7KHLPSURYHPHQWVGLVFXVVHGLQWKLVUHSRUWIRUWKH7DUJHW5RDGWUDIILFVLJQDOV\VWHPUHTXLUHGDVSDUWRIWKH /H[LQJWRQ$YHQXH5HFRQVWUXFWLRQ3URMHFWDUHDQWLFLSDWHGWREHILQDQFHGWKURXJKVSHFLDODVVHVVPHQWVWR EHQHILWHGSURSHUWLHV DFFRUGLQJWRWKH&LWLHV$VVHVVPHQW3ROLFLHV  $OORIWKHSURSHUW\RZQHUVZKRZRXOGUHFHLYHEHQHILWVIURPWKHSURSRVHGWUDIILFVLJQDOV\VWHPDQGZKR ZRXOGEHDVVHVVHGIRUDOORUDSRUWLRQRIWKHLPSURYHPHQWVDUHOLVWHGRQWKH3URSRVHG$VVHVVPHQW5ROOVLQ $SSHQGL[,RIWKLVUHSRUW7KHDVVHVVPHQWVSUHDGVKHHWVLQGLFDWHWKHRZQHUWKHDGGUHVVRIWKHSURSHUW\ DQGWKHDPRXQWRIWKHSURSRVHGDVVHVVPHQWEDVHGRQWKHDVVLJQPHQWRIYHKLFXODUWULSV 7KH&LWLHVDVVHVVPHQWSUDFWLFHVIRUSXEOLFLPSURYHPHQWVDOORZIRUWKHGLVWULEXWLRQRIWKHSURSRVHG DVVHVVPHQWVIRUFRPPHUFLDOSURSHUWLHVIRUXSWRD\HDUSHULRG 7KH&LW\RI$UGHQ+LOOV$VVHVVPHQW3ROLF\LVLQFOXGHGLQ$SSHQGL[- 7KHSURSHUWLHVZLWKGLUHFWDFFHVVWR/H[LQJWRQ$YHQXHYLDWKHQHZ7DUJHW5RDGLQWHUVHFWLRQDQGZKLFK DUHWKHUHIRUHEHQHILWWLQJIURPWKHSURSRVHGLPSURYHPHQWVDQGUHTXLULQJQRWLILFDWLRQDUHOLVWHGLQ7DEOH DQGDUHVKRZQRQWKHPDSLQ$SSHQGL[+ 7DEOH±%HQHILWWLQJ3URSHUWLHV  %HQHILWWLQJ3URSHUWLHVLQ$UGHQ+LOOV  3DUFHO,'  $GGUHVV /H[LQJWRQ$YHQXH1$UGHQ+LOOV01 /H[LQJWRQ$YHQXH1$UGHQ+LOOV01 /H[LQJWRQ$YHQXH1$UGHQ+LOOV01 /H[LQJWRQ6WDWLRQ   /H[LQJWRQ$YHQXH1$UGHQ+LOOV01 /H[LQJWRQ6WDWLRQ   /H[LQJWRQ$YHQXH1$UGHQ+LOOV01 /H[LQJWRQ6WDWLRQ   %HQHILWWLQJ3URSHUWLHVLQ6KRUHYLHZ  3DUFHO,'  $GGUHVV /H[LQJWRQ$YHQXH16KRUHYLHZ01 /H[LQJWRQ$YHQXH16KRUHYLHZ01    7KH&LW\RI$UGHQ+LOOVDQGWKH&LW\RI6KRUHYLHZDUHHDFKUHVSRQVLEOHIRURIWKHWUDIILFVLJQDO V\VWHPFRVWV7KHHVWLPDWHGDVVHVVPHQWDPRXQWIRUHDFKEHQHILWWLQJSURSHUW\LVVKRZQLQ7DEOHIRU 6FHQDULRDQG7DEOHIRU6FHQDULR(VWLPDWHGDVVHVVPHQWFRVWVDUHEDVHGRQWKHSHUFHQWDJHRIWRWDO WULSVWREHQHILWWLQJSDUFHOVZLWKLQHDFKFLW\  7DEOH±3URSRVHG$VVHVVPHQW6XPPDU\ 6FHQDULR  6FHQDULR$UGHQ+LOOV$VVHVVPHQWV   WĞƌĐĞŶƚŽĨ  WĞƌĐĞŶƚŽĨ tĞĞŬůLJ  tĞĞŬůLJ dŚƌŽƵŐŚdƌŝƉƐdŽƚĂů 3DUFHO,' 7KURXJK7ULSV LQ$UGHQ+LOOV$VVHVVPHQW   ϯ͘ϳϬй           1RWH3DUFHOVDQGDUHWKH/H[LQJWRQ6WDWLRQ GHYHORSPHQW7RWDODVVHVVPHQWVDUHFRPELQHGIRUDOO/H[LQJWRQ6WDWLRQSDUFHOV  6FHQDULR6KRUHYLHZ$VVHVVPHQWV    WĞƌĐĞŶƚŽĨ  WĞƌĐĞŶƚŽĨ tĞĞŬůLJ  tĞĞŬůLJ dŚƌŽƵŐŚdƌŝƉƐdŽƚĂů 3DUFHO,' 7KURXJK7ULSV LQ6KRUHYLHZ$VVHVVPHQW   ϳϳ͘ϴϳй                     7DEOH±3URSRVHG$VVHVVPHQW6XPPDU\ 6FHQDULR 6FHQDULR$UGHQ+LOOV$VVHVVPHQWV   WĞƌĐĞŶƚŽĨ  WĞƌĐĞŶƚŽĨ tĞĞŬůLJ  tĞĞŬůLJ dŚƌŽƵŐŚdƌŝƉƐdŽƚĂů 3DUFHO,' 7KURXJK7ULSV LQ$UGHQ+LOOV$VVHVVPHQW        6FHQDULR6KRUHYLHZ$VVHVVPHQWV   WĞƌĐĞŶƚŽĨ  WĞƌĐĞŶƚŽĨ tĞĞŬůLJ  tĞĞŬůLJ dŚƌŽƵŐŚdƌŝƉƐdŽƚĂů 3DUFHO,' 7KURXJK7ULSV LQ6KRUHYLHZ$VVHVVPHQW   ϳϳ͘ϴϲй       1RWH3DUFHOVDQGDUHWKH/H[LQJWRQ6WDWLRQ GHYHORSPHQW7RWDODVVHVVPHQWVDUHFRPELQHGIRUDOO/H[LQJWRQ6WDWLRQSDUFHOV ,;3URMHFW6FKHGXOH 5DPVH\&RXQW\DQWLFLSDWHVWKHIROORZLQJELGGLQJDQGFRQVWUXFWLRQVFKHGXOH %LGV2SHQHG1RYHPEHU &RXQW\%RDUGDZDUGV%LG'HFHPEHU 5DPVH\&RXQW\%HJLQV&RQVWUXFWLRQ$SULO &RQVWUXFWLRQ6XEVWDQWLDOO\&RPSOHWH1RYHPEHU 7KHSURSRVHGSURMHFWVFKHGXOHLVDVIROORZVIRUHDFK&LW\ 352326('352-(&76&+('8/(±$5'(1+,//6 &LW\&RXQFLOUHFHLYHV)HDVLELOLW\5HSRUW$XJXVW &LW\&RXQFLORUGHUV3XEOLF,PSURYHPHQW+HDULQJ   $XJXVW &LW\&RXQFLODSSURYHV3ODQVDQG6SHFLILFDWLRQV6HSWHPEHU  &LW\&RXQFLOVHWVGDWHIRU$VVHVVPHQW+HDULQJ6HSWHPEHU &LW\&RXQFLOKROGV$VVHVVPHQW+HDULQJ2FWREHU   352326('352-(&76&+('8/(6+25(9,(: &LW\&RXQFLOUHFHLYHV)HDVLELOLW\5HSRUW$XJXVW &LW\&RXQFLORUGHUV3XEOLF,PSURYHPHQW+HDULQJ   $XJXVW &LW\&RXQFLODSSURYHV3ODQVDQG6SHFLILFDWLRQV6HSWHPEHU  &LW\&RXQFLOVHWVGDWHIRU$VVHVVPHQW+HDULQJ6HSWHPEHU &LW\&RXQFLOKROGV$VVHVVPHQW+HDULQJ2FWREHU ;)HDVLELOLW\1HFHVVLW\DQG&RVW(IIHFWLYHQHVV 7KHSURSRVHGWUDIILFVLJQDOLPSURYHPHQWVDW7DUJHW5RDGLQFOXGHGLQWKH/H[LQJWRQ$YHQXH 5HFRQVWUXFWLRQ3URMHFWDUHIHDVLEOHIURPDQHQJLQHHULQJVWDQGSRLQWQHFHVVDU\DQGFRVWHIIHFWLYHLI FRQVWUXFWHGDVSDUWRIWKH&RXQW\SURMHFWDVSURSRVHG7KHVHLPSURYHPHQWVZRXOGJUHDWO\LPSURYHWKH VDIHW\DQGPRELOLW\IRUDOOXVHUVLQFOXGLQJLPSURYHGDFFHVVWRFRPPHUFLDOSURSHUWLHVRQERWKVLGHVRI /H[LQJWRQ$YHQXH 7KHLPSURYHPHQWVFDQPRVWHIIHFWLYHO\DQGHFRQRPLFDOO\EHFRQVWUXFWHGLIXQGHUWDNHQWKURXJKD FRRUGLQDWHGFRQWUDFWDVSDUWRIWKH&RXQW\SURMHFWWKDWZRXOGFDXVHWKHLPSURYHPHQWVWREHLQVWDOOHGLQ WKHSURSHUVHTXHQFH ;,&RQFOXVLRQ 2XUUHFRPPHQGDWLRQWRWKH&LW\&RXQFLOLVWKDWLILPSURYHPHQWVDUHWREHFRQVWUXFWHGWKDWWKHWUDIILF VLJQDOV\VWHPDQGDVVRFLDWHGJHRPHWULFLPSURYHPHQWVEHLQVWDOOHGDVSURSRVHGLQWKLVIHDVLELOLW\UHSRUW 7KHHVWLPDWHGFRVWRIWKHVHLPSURYHPHQWVLQFOXGLQJWKHSURSRVHGDVVHVVPHQWVLVUHDVRQDEOHDQG FRPSDUDEOHZLWKVLPLODULPSURYHPHQWVEHLQJFRQVWUXFWHGLQRWKHUFLWLHVLQWKHPHWURSROLWDQDUHD džŚŝďŝƚϮ  >ĞdžŝŶŐƚŽŶǀĞŶƵĞ>ĂLJŽƵƚ               COUNTY ROAD ECANADIAN PACIFIC RAILROADISLAND LAKE AVE1103 GOODWILL 1195 ESTREET FLATS 3585 WALGREENS 1160 AMERICAN RED CROSS CARIBOU COFFEE GEORGES SHOES SUBWAY TMOBILE ALLSTATE CHINA EXPRESS GREAT CLIPS UPS H&R BLOCK NAILS 3000 TOBACCO NUTMEG BREWHOUSE CLEAN N PRESS DAVANNIS 3717 CUB FOODS 3673 3720 AMBASSADOR BAPTIST CHURCH 1090 1084 1076 1072 3592 SUPER AMERICA 1080 ODDS AND ENDS AGAIN 3600 STEPHENS ART CENTENNIAL JEWLERS EDWARD JONES PIZZA HUT PIPES CIGARS TOP SHELF ATHLETICS GREY FOX RD13' THRU 13' THRU 13' LEFT (170') 11' THRU 13' THRU 6' BLVD 6' BLVD 10' TRAIL 1:5 TAPER ( 5 5 ' )10' LEFT13' THRU/RIGHT13' THRU1:10 TAPER (110' ) 1:10 TAPER (110') 8' WALK6' BLVD 6' BLVD10' TRAIL STORMWATER-- --POND LOCATION LEXINGTON AVENUECOUNTY ROAD ETOGREY FOX RDLEGEND CONCRETE SURFACE BITUMINOUS SURFACE PARCEL BOUNDARY INPLACE RIGHT OF WAY TRAFFIC FLOW ARROWS GREY FOX RDRED FOX RDTARGET RD3737 PACE INDUSTRIES 3751 ARBYS 3757 BIG O TIRES 3761 ENTERPRISE 3775 - 3785 JIMMY JOHNS BALANCE FOR LIFE BINDERY PLUS PAPA MURPHYS JIM LAABS PIANOS OLIVE ME CHIRO 3833 NOODLES AND CO FROZEN YOGURT FANTASTIC SAMS ROYAL NAILS PAPA JOHNS AT&T GNC POTBELLY STARBUCKS 3836 TCF BANK 3780 RAISING CANES 3800 TARGET3760 YMCA 3720 AMBASSADOR BAPTIST CHURCHGREY FOX RD10' LEFT13' THRU/RIGHT13' THRU13' THRU 13' THRU 13' LEFT (175') 11' THRU 11' THRU 13' RIGHT (225') 1:10 TAPER (110') 1:10 TAPER (110') 1:10 TAPER (110') 1:10 TAPER (110') 1:10 TAPER (110') 10' TRAIL 13' THRU 13' THRU 13' THRU 13' THRU 1:10 TAPER (110') 1:10 TAPER (110') VARIABLE (5' - 20') MEDIAN LEXINGTON AVENUEGREY FOX RDTORED FOX RDLEGEND CONCRETE SURFACE BITUMINOUS SURFACE PARCEL BOUNDARY INPLACE RIGHT OF WAY TRAFFIC FLOW ARROWS RED FOX RDI-694 SBI-694 NB3833 NOODLES AND CO FROZEN YOGURT FANTASTIC SAMS ROYAL NAILS PAPA JOHNS AT&T GNC POTBELLY STARBUCKS 3855 PERKINS 1125 QUALITY INN 3854 EXXON CIRCLE K 3836 TCF BANK 1051 WENDYS 11' LEFT (320') 11' THRU 11' THRU 13' LEFT (260') 13' THRU 13' THRU 13' THRU 13' THRU 13' RIGHT (225') 1:5 TAPER ( 1 1 0 ' ) 1:5 TAPER ( 5 5 ' ) 6' BLVD 10' TRAIL 1:5 TAPER ( 5 5 ' ) 13' THRU 13' THRU 1:10 TAPER (110') VARIABLE (5' - 20') MEDIAN 5' MEDIAN LEXINGTON AVENUERED FOX RDTOI-694LEGEND CONCRETE SURFACE BITUMINOUS SURFACE PARCEL BOUNDARY INPLACE RIGHT OF WAY TRAFFIC FLOW ARROWS ƉƉĞŶĚŝdž  ƌĚĞŶ,ŝůůƐŝƚLJŽƵŶĐŝůZĞƐŽůƵƚŝŽŶEŽ͘ϮϬϮϭͲϬϭϭ                  1 To view the final document, access adopted Resolutions via Arden Hills Public Laserfiche Weblink by visiting cityofardenhills.org and clicking on Archived Documents under Helpful Links on our main webpage. CITY OF ARDEN HILLS COUNTY OF RAMSEY STATE OF MINNESOTA RESOLUTION NO. 2021-011 RESOLUTION ORDERING THE PREPARATION OF FEASIBILITY REPORT FOR THE LEXINGTON AVENUE IMPROVEMENT PROJECT WHEREAS, the Capital Improvement Program for the City of Arden Hills identifies potential street and utility improvements for Lexington Avenue; and WHEREAS, the proposed improvements to Lexington Avenue include the installation of a new traffic control signal system at the intersection of Lexington Avenue and Target Road; and WHEREAS, the proposed traffic signal at Target Road would provide access improvements to the Lexington Station development site located in the southwest quadrant of Lexington Avenue and Red Fox Road; and WHEREAS, the Master Planned Unit Development Agreement for Lexington Station specifies that the developer of the Lexington Station site will be required to pay for or accept an assessment against the property for the cost of access improvements to Lexington Avenue. NOW, THEREFORE, BE IT RESOLVED THAT THE CITY COUNCIL OF THE CITY OF ARDEN HILLS: That the proposed Target Road traffic signal and associated access improvements stated above shall be referred to as the Lexington Avenue Traffic Signal at Target Road for study and that the City Engineer is instructed to report to the Council with all convenient speed advising the Council in a preliminary way as to whether the proposed improvement is necessary, cost-effective, and feasible and as to whether it should best be made as proposed or in connection with some other improvement, and the estimated cost of the improvement as recommended. PASSED AND ADOPTED BY THE CITY COUNCIL OF THE CITY OF ARDEN HILLS THIS 22nd DAY OF FEBRUARY 2021. ________________________________ Mayor Attest: ______________________________ City Clerk Attachment A ƉƉĞŶĚŝdž  ^ŚŽƌĞǀŝĞǁŝƚLJŽƵŶĐŝůZĞƐŽůƵƚŝŽŶEŽ͘ϮϭͲϭϮ                  ƉƉĞŶĚŝdž  ^ƵƉƉŽƌƚŝŶŐdƌĂĨĨŝĐŶĂůLJƐŝƐ&ŝŐƵƌĞƐ                  ĐĐĞƐƐ^ĐĞŶĂƌŝŽϭ>ĂŶĚhƐĞ;/dŽĚĞͿ WĂƌĐĞů/ ƵƐŝŶĞƐƐͬĞǀĞůŽƉŵĞŶƚ hŶŝƚƐ ^ŝnjĞ^ŝŶŐůĞtĞĞŬĚĂLJdƌŝƉƐ^ĂƚƵƌĚĂLJdƌŝƉƐ^ƵŶĚĂLJdƌŝƉƐdŽƚĂůtĞĞŬůLJdƌŝƉƐ;ϭͿWĞƌĐĞŶƚdƌŝƉŝƐƚƌŝďƵƚŝŽŶdŚƌŽƵŐŚ^ŝŐŶĂůdŽƚĂůtĞĞŬůLJdƌŝƉƐdŚƌŽƵŐŚ^ŝŐŶĂůWĞƌĐĞŶƚŽĨdŽƚĂůtĞĞŬůLJdƌŝƉƐdŚƌŽƵŐŚ^ŝŐŶĂů&ƌĞĞͲ^ƚĂŶĚŝŶŐŝƐĐŽƵŶƚ^ƵƉĞƌƐƚŽƌĞ;ϴϭϯͿ ϮϲͲϯϬͲϮϯͲϯϮͲϬϬϭϯ dĂƌŐĞƚ ^ƋƵĂƌĞ&ĞĞƚ'&ϭϴϮ͕ϱϬϬ ϵ͕Ϯϱϰ ϭϭ͕ϲϳϬ ϭϬ͕Ϯϭϰ ϲϴ͕ϭϱϰ ϰϬ͘Ϭй Ϯϳ͕ϮϲϮϰϮ͘ϱϯй^ŚŽƉƉŝŶŐĞŶƚĞƌ;ϴϮϬͿ;ϮͿϮϳͲϯϬͲϮϯͲϰϭͲϬϬϮϮ͕ϮϳͲϯϬͲϮϯͲϰϭͲϬϬϮϯ ^ƋƵĂƌĞ&ĞĞƚ'& ϯϮ͕ϱϬϬ Ϯ͕ϴϬϬ ϰ͕ϰϬϬ ϯ͕ϲϬϬ'ƌŽĐĞƌLJ;ϴϱϰͿ ϮϳͲϯϬͲϮϯͲϰϭͲϬϬϮϰ ^ƋƵĂƌĞ&ĞĞƚ'& ϰϯ͕ϬϬϬ ϯ͕ϵϬϴ ϰ͕ϴϭϬ ϰ͕ϮϵϬdŝƌĞ^ƵƉĞƌƐƚŽƌĞ;ϴϰϵͿ ϮϳͲϯϬͲϮϯͲϰϭͲϬϬϮϬ ŝŐKdŝƌĞƐͬŶƚĞƌƉƌŝƐĞͬDŝĚǁĞƐƚƵƚŽĞƚĂŝůŝŶŐ ^ƋƵĂƌĞ&ĞĞƚ'&ϭϬ͕ϱϬϬ Ϯϭϰ ϮϬϬ Ϭ ϭ͕ϮϳϬ ϴϱ͘Ϭй ϭ͕ϬϴϬϭ͘ϲϴй&ĂƐƚͲ&ŽŽĚZĞƐƚĂƵƌĂŶƚǁͬƌŝǀĞͲdŚƌŽƵŐŚ;ϵϯϰͿ ϮϳͲϯϬͲϮϯͲϰϭͲϬϬϮϭ ƌďLJΖƐ ^ƋƵĂƌĞ&ĞĞƚ'&ϯ͕ϬϬϬ ϭ͕ϰϭϰ ϭ͕ϴϰϴ ϭ͕ϰϭϴ ϭϬ͕ϯϯϲ ϳϱ͘Ϭй ϳ͕ϳϱϮϭϮ͘Ϭϵй&ĂƐƚͲ&ŽŽĚZĞƐƚĂƵƌĂŶƚǁͬƌŝǀĞͲdŚƌŽƵŐŚ;ϵϯϰͿ ϮϲͲϯϬͲϮϯͲϰϭͲϬϬϮϰ ZĂŝƐŝŶŐĂŶĞΖƐ ^ƋƵĂƌĞ&ĞĞƚ'&ϯ͕ϬϬϬ ϭ͕ϰϭϰ ϭ͕ϴϰϴ ϭ͕ϰϭϴ ϭϬ͕ϯϯϲ ϳϱ͘Ϭй ϳ͕ϳϱϮϭϮ͘Ϭϵй'&с'ƌŽƐƐ&ůŽŽƌƌĞĂ;ϭͿdŽƚĂůtĞĞŬůLJdƌŝƉƐс;ϱdž^ŝŶŐůĞtĞĞŬĚĂLJdƌŝƉƐͿн^ĂƚƵƌĚĂLJdƌŝƉƐн^ƵŶĚĂLJdƌŝƉƐ;ϮͿ^ŚŽƉƉŝŶŐĞŶƚĞƌ^ƵŶĚĂLJƚƌŝƉŐĞŶĞƌĂƚŝŽŶĞƐƚŝŵĂƚĞŝƐƚŚĞĂǀĞƌĂŐĞŽĨƚŚĞǁĞĞŬĚĂLJĂŶĚ^ĂƚƵƌĚĂLJĞƐƚŝŵĂƚĞƐĚƵĞƚŽůŝŵŝƚĞĚ^ƵŶĚĂLJĚĂƚĂĂǀĂŝůĂďŝůŝƚLJ͘ĐĐĞƐƐ^ĐĞŶĂƌŝŽϮ>ĂŶĚhƐĞ;/dŽĚĞͿ WĂƌĐĞů/ ƵƐŝŶĞƐƐͬĞǀĞůŽƉŵĞŶƚ hŶŝƚƐ ^ŝnjĞ^ŝŶŐůĞtĞĞŬĚĂLJdƌŝƉƐ^ĂƚƵƌĚĂLJdƌŝƉƐ^ƵŶĚĂLJdƌŝƉƐdŽƚĂůtĞĞŬůLJdƌŝƉƐ;ϭͿWĞƌĐĞŶƚdƌŝƉŝƐƚƌŝďƵƚŝŽŶdŚƌŽƵŐŚ^ŝŐŶĂůdŽƚĂůtĞĞŬůLJdƌŝƉƐdŚƌŽƵŐŚ^ŝŐŶĂůWĞƌĐĞŶƚŽĨdŽƚĂůtĞĞŬůLJdƌŝƉƐdŚƌŽƵŐŚ^ŝŐŶĂů&ƌĞĞͲ^ƚĂŶĚŝŶŐŝƐĐŽƵŶƚ^ƵƉĞƌƐƚŽƌĞ;ϴϭϯͿ ϮϲͲϯϬͲϮϯͲϯϮͲϬϬϭϯ dĂƌŐĞƚ ^ƋƵĂƌĞ&ĞĞƚ'&ϭϴϮ͕ϱϬϬ ϵ͕Ϯϱϰ ϭϭ͕ϲϳϬ ϭϬ͕Ϯϭϰ ϲϴ͕ϭϱϰ ϰϬ͘Ϭй Ϯϳ͕ϮϲϮϰϵ͘ϯϯй^ŚŽƉƉŝŶŐĞŶƚĞƌ;ϴϮϬͿ;ϮͿϮϳͲϯϬͲϮϯͲϰϭͲϬϬϮϮ͕ϮϳͲϯϬͲϮϯͲϰϭͲϬϬϮϯ ^ƋƵĂƌĞ&ĞĞƚ'& ϯϮ͕ϱϬϬ Ϯ͕ϴϬϬ ϰ͕ϰϬϬ ϯ͕ϲϬϬ'ƌŽĐĞƌLJ;ϴϱϰͿ ϮϳͲϯϬͲϮϯͲϰϭͲϬϬϮϰ ^ƋƵĂƌĞ&ĞĞƚ'& ϰϯ͕ϬϬϬ ϯ͕ϵϬϴ ϰ͕ϴϭϬ ϰ͕ϮϵϬ&ĂƐƚͲ&ŽŽĚZĞƐƚĂƵƌĂŶƚǁͬƌŝǀĞͲdŚƌŽƵŐŚ;ϵϯϰͿ ϮϲͲϯϬͲϮϯͲϰϭͲϬϬϮϰ ZĂŝƐŝŶŐĂŶĞΖƐ ^ƋƵĂƌĞ&ĞĞƚ'&ϯ͕ϬϬϬ ϭ͕ϰϭϰ ϭ͕ϴϰϴ ϭ͕ϰϭϴ ϭϬ͕ϯϯϲ ϳϱ͘Ϭй ϳ͕ϳϱϮϭϰ͘Ϭϯй'&с'ƌŽƐƐ&ůŽŽƌƌĞĂ;ϭͿdŽƚĂůtĞĞŬůLJdƌŝƉƐс;ϱdž^ŝŶŐůĞtĞĞŬĚĂLJdƌŝƉƐͿн^ĂƚƵƌĚĂLJdƌŝƉƐн^ƵŶĚĂLJdƌŝƉƐ;ϮͿ^ŚŽƉƉŝŶŐĞŶƚĞƌ^ƵŶĚĂLJƚƌŝƉŐĞŶĞƌĂƚŝŽŶĞƐƚŝŵĂƚĞŝƐƚŚĞĂǀĞƌĂŐĞŽĨƚŚĞǁĞĞŬĚĂLJĂŶĚ^ĂƚƵƌĚĂLJĞƐƚŝŵĂƚĞƐĚƵĞƚŽůŝŵŝƚĞĚ^ƵŶĚĂLJĚĂƚĂĂǀĂŝůĂďŝůŝƚLJ͘ϯϲ͘ϲϱйϰϬ͘Ϭй ϮϬ͕ϮϱϲϱϬ͕ϲϰϬϱϬ͕ϲϰϬ ϰϬ͘Ϭй ϮϬ͕Ϯϱϲϯϭ͘ϲϬйdƌŝƉ'ĞŶĞƌĂƚŝŽŶͲWƌŽƉŽƐĞĚ>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘdĂƌŐĞƚZŽĂĚdƌĂĨĨŝĐ^ŝŐŶĂů^ŽƵƌĐĞ͗/ŶƐƚŝƚƵƚĞŽĨdƌĂŶƐƉŽƌƚĂƚŝŽŶŶŐŝŶĞĞƌƐdƌŝƉ'ĞŶĞƌĂƚŝŽŶDĂŶƵĂů͕ϭϬƚŚĚŝƚŝŽŶ^ŽƵƌĐĞ͗/ŶƐƚŝƚƵƚĞŽĨdƌĂŶƐƉŽƌƚĂƚŝŽŶŶŐŝŶĞĞƌƐdƌŝƉ'ĞŶĞƌĂƚŝŽŶDĂŶƵĂů͕ϭϬƚŚĚŝƚŝŽŶ>ĞdžŝŶŐƚŽŶ^ƚĂƚŝŽŶ>ĞdžŝŶŐƚŽŶ^ƚĂƚŝŽŶ 1 Trip ƉƉĞŶĚŝdž  >ĞdžŝŶŐƚŽŶǀĞŶƵĞZĞĐŽŶƐƚƌƵĐƚŝŽŶ;/ͲϲϵϰƚŽZͿ dƌĂĨĨŝĐ^ƚƵĚLJʹƉƌŝůϭϴ͕ϮϬϭϵ                 Lexington Avenue Reconstruction g (I-694 to CR E) Traffic Study Arden Hills & Shoreview, MN Prepared For: Ramsey County Public Works 1425 Paul Kirkwold Dr Arden Hills, MN 55112 Prepared By: Alliant Engineering, Inc. 733 Marquette Ave, Ste 700 Minneapolis, MN 55402 April 18, 2019 Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 i April 18, 2019 Table of Contents List of Figures ................................................................................................................................ ii List of Tables ................................................................................................................................. ii 1.0 Introduction ........................................................................................................................1 1.1 PURPOSE AND NEED ......................................................................................................... 1 1.2 DESCRIPTION OF LOCATION ............................................................................................. 1 2.0 Existing Conditions ............................................................................................................3 2.1 EXISTING ROADWAY CHARACTERISTICS ......................................................................... 3 2.2 EXISTING INTERSECTION CHARACTERISTICS ................................................................... 4 2.3 EXISTING CRASH EXPERIENCE ......................................................................................... 8 2.4 TRAFFIC OPERATIONS ANALYSIS ................................................................................... 16 3.0 Year 2040 Conditions ......................................................................................................19 3.1 TRIP GENERATION ......................................................................................................... 19 3.2 TRIP DISTRIBUTION AND ASSIGNMENT .......................................................................... 21 3.3 TRAFFIC FORECASTS ...................................................................................................... 23 3.4 YEAR 2040 NO BUILD TRAFFIC OPERATIONS ANALYSIS ............................................... 25 3.5 IDENTIFICATION OF DEFICIENCIES ................................................................................. 26 4.0 Preliminary Alternatives Analysis..................................................................................28 4.1 SIGNAL WARRANT ANALYSIS ........................................................................................ 28 4.2 IDENTIFICATION OF PRELIMINARY INTERSECTION ALTERNATIVES ................................ 29 4.3 PRELIMINARY ALTERNATIVES TRAFFIC OPERATIONS ANALYSIS ................................... 32 4.4 PRELIMINARY ALTERNATIVES COMPARISON MATRIX ................................................... 34 4.5 SELECTION OF PREFERRED ALTERNATIVE ..................................................................... 36 4.6 PREFERRED ALTERNATIVE ANALYSIS ............................................................................ 36 5.0 Conclusions/Recommendations ......................................................................................39 Appendix A: Detailed Intersection Operations Analysis ........................................................ A1 Appendix B: Detailed Signal Warrant Analysis ...................................................................... B1 Appendix C: Preferred Alternative Concept Layout .............................................................. C1 Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 ii April 18, 2019 List of Figures Figure 1. Project Location............................................................................................................... 2 Figure 2. Existing Conditions ......................................................................................................... 6 Figure 3. Year 2020 No Build Conditions ...................................................................................... 7 Figure 4. Existing Crashes by Severity and Type ........................................................................... 8 Figure 5. Existing Crash Diagrams ............................................................................................... 10 Figure 6. Lexington Station Site Plan ........................................................................................... 20 Figure 7. Proposed Development Directional Distribution .......................................................... 22 Figure 8. Year 2040 No Build Conditions .................................................................................... 24 List of Tables Table 1. Crash Rate Summary (2011 – 2015)............................................................................... 15 Table 2. Level of Service Criteria ................................................................................................. 16 Table 3. Existing Operations Analysis Summary ......................................................................... 17 Table 4. Year 2020 No Build Operations Analysis Summary ...................................................... 18 Table 5. Lexington Station Phase 3 Trip Generation Estimates ................................................... 19 Table 6. Existing and Forecast Approach Volumes ...................................................................... 23 Table 7. Year 2040 No Build Operations Analysis Summary ...................................................... 25 Table 8. Signal Warrant Analysis Summary................................................................................. 28 Table 9. Operations Analysis Summary – Preliminary Alternatives (2040 PM Peak Hour) ....... 33 Table 10. Preliminary Alternatives Comparison Matrix............................................................... 35 Table 11. Operations Analysis Summary – Preferred Alternative (Forecast Year 2040) ............ 36 Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 1 April 18, 2019 1.0 Introduction Ramsey County, in cooperation with the City of Arden Hills and the City of Shoreview, has programmed a year 2020 reconstruction of Lexington Avenue (County State Aid Highway 51) between I-694 and County Road E (CR E). Key aspects of the project include pavement rehabilitation, providing geometric improvements that accommodate pedestrians/bicyclists/transit users, traffic signal upgrades/geometric improvements at the Red Fox Road and Grey Fox Road intersections, and a proposed traffic signal at the Target South intersection (see Figure 1: Project Location). Ramsey County has identified the need to conduct a traffic study along the Lexington Avenue corridor to determine the most appropriate forms of access, lane geometrics, and traffic signal improvements. 1.1 Purpose and Need The purpose of this traffic study is to determine the future vision for the Lexington Avenue study corridor in terms of access, lane geometrics, and traffic signal improvements. Understanding the nature of any corridor safety problems and the need to address potential future traffic operations deficiencies, Ramsey County desires improvement solutions that accomplish the following goals: x Improve or maintain the intersection level of service into the future x Reduce the frequency of severe crashes; and x Provide access management recommendations to improve overall traffic flow To support Ramsey County in identifying the appropriate improvements that meet the above stated goals, this traffic study accomplishes the following: x Documents the existing geometric, traffic operations, and safety characteristics x Documents design year 2020 and horizon year 2040 traffic forecasts based upon study area historical traffic volumes and expected population growth x Develops and evaluates high-level conceptual alternatives that will improve intersection safety characteristics to a varying degree x Conducts a traffic operations and safety analysis of each alternative x Identifies a preferred alternative 1.2 Description of Location The subject of this study is the Lexington Avenue corridor between I-694 and CR E, and in particular, the intersections with Red Fox Road, Target South, and Grey Fox Road. The study area is composed primarily of retail and service related land uses with access to a small residential neighborhood (approximately 50 houses) via Grey Fox Road. Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 3 April 18, 2019 2.0 Existing Conditions The following section documents the existing corridor conditions. 2.1 Existing Roadway Characteristics The existing roadway characteristics are summarized as follows: x Lexington Avenue: Lexington Avenue serves as a minor arterial roadway with a posted speed limit of 40 miles per hour (mph). The roadway consists mostly of an undivided five-lane cross-section with a continuous two-way left-turn lane (TWLTL). An at-grade railroad crossing is situated approximately 300 feet north of the Lexington Avenue / CR E intersection near the southern project limits. x Red Fox Road: Red Fox Road serves as a local roadway with a posted speed limit of 30 mph. The roadway consists of an undivided two-lane cross-section west of Lexington Avenue and an undivided three-lane cross-section with a continuous TWLTL to the east. x Grey Fox Road: Grey Fox Road serves as a local roadway with a posted speed limit of 30 mph. The roadway consists of an undivided two-lane cross-section and provides the only access to the Island Lake neighborhood (approximately 50 homes) east of Lexington Avenue. To the west, Grey Fox Road connects to northbound Snelling Avenue via a right-in/right-out (RIRO) intersection. 2.1.1 Pedestrian/Bicycle Accommodations Existing pedestrian/bicycle accommodations are summarized as follows: x Lexington Avenue: A mixed-use path exists along the east side of Lexington Avenue for the entire length of the corridor. Two sidewalk segments exist along the west side of Lexington Avenue; the first between Red Fox Road and Lexington Station, and the second starting at Grey Fox Road and extending south of CR E. x Red Fox Road: Sidewalk is present on both sides of Red Fox Road east of Lexington Avenue and for a short distance on the south side of Red Fox Road to the west. x Grey Fox Road: No pedestrian or bicycle facilities are present. Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 4 April 18, 2019 2.1.2 Public Transportation Metro Transit currently maintains service for Bus Routes 225, 227, and 261 along parts of the Lexington Avenue corridor. Bus Routes 225 and 227 connect Arden Hills and Shoreview to Rosedale Mall, with Route 225 operating along the entire Lexington Avenue study corridor and Route 227 operating as far north as Red Fox Road. Bus Route 261 connects Arden Hills and Shoreview to the Minneapolis Central Business District (CBD), utilizing the entire Lexington Avenue study corridor. Bus stops are located at several study corridor intersections: x Lexington Avenue & Red Fox Road x Lexington Avenue & Target South (northbound only) x Lexington Avenue & Grey Fox Road x Lexington Avenue & County Road E It should be noted that under the current roadway configuration all stops are made in through lanes except for the northbound stop at Red Fox Road, which is made within a dedicated right-turn lane. 2.2 Existing Intersection Characteristics The existing intersection characteristics are summarized as follows: x Lexington Avenue/Red Fox Road Intersection: The Red Fox Road intersection is currently controlled by an actuated eight-phase traffic signal which is coordinated with signals along Lexington Avenue. Protective/permissive left-turn phasing exists for both the mainline northbound/southbound and side-street eastbound/westbound directions. x Lexington Avenue/Lexington Station Driveway: The Lexington Station driveway is currently side-street stop controlled for eastbound vehicles. A traffic signal at the Lexington Avenue / Target South intersection would provide an opportunity to realign driveway access to businesses along the west side of Lexington Avenue. The Target South intersection is located approximately 300 feet south of the Lexington Station driveway. x Lexington Avenue/Target South Intersection: The Target South intersection is currently side-street stop controlled for westbound vehicles. A proposed traffic signal at this location may improve intersection level of service and reduce the frequency of severe crashes while providing pedestrians and bicyclists a safer means to cross Lexington Avenue. Furthermore, a traffic signal at this location would provide an opportunity to realign driveway access to businesses along the west side of Lexington Avenue. The Enterprise / Big O Tires / Arby’s driveway access is located approximately 200 feet south, and the Lexington Station driveway access is located approximately 300 feet north of the Target South driveway. Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 5 April 18, 2019 x Lexington Avenue/Enterprise-Big O Tires-Arby’s Driveway: The Enterprise / Big O Tires / Arby’s driveway is currently side-street stop controlled for eastbound vehicles. A traffic signal at the Lexington Avenue / Target South intersection would provide an opportunity to realign driveway access to businesses along the west side of Lexington Avenue. The Target South intersection is located approximately 200 feet north of the Enterprise / Big O Tires / Arby’s driveway. x Lexington Avenue/Grey Fox Road Intersection: The Grey Fox Road intersection is currently controlled by an actuated five-phase traffic signal which is coordinated with signals along Lexington Avenue. Protective/permissive left-turn phasing exists for the mainline northbound/southbound directions, while permissive only left-turn phasing is in place for the side-street eastbound/westbound directions. x Lexington Avenue/Shannon Square Driveway: The Shannon Square driveway is currently side-street stop controlled for eastbound vehicles. The driveway is located approximately 550 feet south of the Lexington Avenue / Grey Fox Road intersection. With full access also being provided at Grey Fox Road, a RIRO or three-quarter access configuration could be considered. x Lexington Avenue/County Road E Intersection: The CR E intersection is currently controlled by an actuated seven-phase traffic signal which is coordinated with signals along Lexington Avenue during certain periods of the day. Protective/permissive left-turn phasing exists for the mainline northbound/southbound directions, while split phasing is in place for the side-street eastbound/westbound directions. Roadway network characteristics, including existing a.m., midday, and p.m. peak hour traffic volumes, are shown in Figure 2. No build characteristics, including design year 2020 a.m., midday, and p.m. peak hour traffic volumes, are shown in Figure 3. Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 8 April 18, 2019 2.3 Existing Crash Experience Historical crash data at the study intersections from the most recent five years available, years 2011-2015, was obtained from the Minnesota Crash Mapping Analysis Tool (MnCMAT). Based on the available crash data, there were 39 reported crashes at the Lexington Avenue / Red Fox Road intersection, eight (8) reported crashes at the Lexington Avenue / Target South intersection, six (6) reported crashes at the Lexington Avenue / Enterprise-Big O Tires-Arby’s driveway, 14 reported crashes at the Lexington Avenue / Grey Fox Road intersection, and two (2) reported crashes at the Lexington Avenue / Shannon Square driveway during the analysis period (69 total crashes). The reported crashes are summarized by severity and type in Figure 4 while detailed intersection crash diagrams are illustrated in Figure 5. Figure 4. Existing Crashes by Severity and Type Lexington Avenue & Red Fox Road Lexington Avenue & Target South Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 9 April 18, 2019 Figure 4. Existing Crashes by Severity and Type (Continued) Lexington Avenue & Enterprise / Big O Tires / Arby’s Lexington Avenue & Grey Fox Road Lexington Avenue & Shannon Square Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 14 April 18, 2019 2.3.1 Crash Type Further investigation into the types of reported crashes (see Figure 4) revealed that the Lexington Avenue study corridor had a significant number of right-angle and left-turn crashes, accounting for 52 percent (36 of 69) of the crashes between 2011 and 2015. At the intersection of Lexington Avenue / Red Fox Road, right-angle and left-turn crashes also accounted for 51 percent (20 of 39) of the crashes between 2011 and 2015. A more detailed review of the historical crash data revealed that the existing signalized left-turn operation may be negatively affecting the safety of study intersections: x 34 of the 36 right-angle/left-turn crashes throughout the study corridor occurred during midday or p.m. hours, which may suggest that high volumes during these time periods are resulting in poor gap selections by motorists. x 19 of the 20 right-angle/left-turn crashes at Lexington Avenue / Red Fox Road occurred during midday or p.m. hours, which may also suggest that signal operations during this time period are creating hazardous conditions. o 15 of these 19 right-angle/left-turn crashes involved a southbound vehicle, which may suggest that heavier volumes and permissive “green ball” left-turn operation are resulting in driver confusion/poor gap selections. x 10 of the 17 injury crashes throughout the study corridor were rear end crashes, with all 10 crashes occurring between 1 p.m. and 7 p.m. Conclusions based on crash type suggest there is a noteworthy crash pattern at the Red Fox Road intersection, including an observed increase in crashes throughout the study corridor during the afternoon/evening time period. 2.3.2 Crash Rate History has proven that crashes are a function of exposure. Roadways with higher traffic volumes experience more crashes than similar roadways with lower volumes. Rather than simply documenting the number of crashes that occur at an intersection, the crash rate must be considered. Crash rates normalize different locations with varying traffic volumes, providing a useful tool in comparing the locations with respect to safety. Actual crash rates at specific locations can also be compared to average or typical values for an intersection type. Intersection crash rates are defined by the number of crashes occurring per million entering vehicles (MEV). Table 1 summarizes the observed intersection crash rates compared to the statewide averages for similar intersections. Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 15 April 18, 2019 Table 1. Crash Rate Summary (2011 – 2015) Crash occurrence is somewhat random by nature. Identifying every intersection with a crash rate above the average value in an analysis could produce a large amount of data that may not be statistically relevant with respect to safety deficiencies. The critical crash rate identifies locations that have a crash rate higher than similar facilities by a statistically significant amount. The critical crash rate is calculated by adjusting the systemwide average based on the amount of exposure and a statistical constant indicating level of confidence1. At locations where the observed crash rate exceeds the critical crash rate, it is 99 percent certain that an intersection design deficiency exists, or there are hazardous characteristics present at the location. It should be noted that while the observed crash rate at the Lexington Avenue / Red Fox Road intersection (0.83 crashes/MEV) is higher than the statewide average for a signalized high-volume/low-speed intersection (0.70 crashes/MEV), the observed crash rate does not exceed the corresponding critical crash rate (1.03 crashes/MEV). Above average crash rates were also observed at the Lexington Avenue intersections with the Target South access and the Enterprise-Big O Tires-Arby’s driveway. However, the observed crash rates at these intersections also did not exceed the corresponding critical crash rates. 1 MnDOT Traffic Safety Fundamentals Handbook, August 2015. Intersection Traffic Control Total Crashes1 Total Entering Volume2 Crash Rate per MEV State Average Crash Rate3 Crash Critical Rate4, 5 Crash Severity Rate6 State Average Severity Rate3 Crash Severity Critical Rate4, 5 Lexington Avenue & Red Fox Road High Volume, Low Speed Signal 39 46,811,250 0.83 0.70 1.03 1.09 0.97 1.17 Lexington Avenue & Target South Urban Through-Stop 8 38,918,125 0.21 0.18 0.37 0.26 0.26 0.38 Lexington Avenue & Enterprise/Big O Tires/Arby's Urban Through-Stop 6 29,914,792 0.20 0.18 0.40 0.23 0.26 0.40 Lexington Avenue & Grey Fox Road High Volume, Low Speed Signal 14 34,112,292 0.41 0.70 1.08 0.15 0.97 1.20 Lexington Avenue & Shannon Square Urban Through-Stop 2 31,283,542 0.06 0.18 0.39 0.06 0.26 0.39 4 The critical rate is a statistically adjusted crash rate to account for random nature of crashes 5 A 99.5% confidence level was assumed for critical crash rate and an 80% confidence level was assumed for critical severity and K/A rate. 1 Crash Data obtained from MnCMAT and detailed police crash reports. 2 AADT obtained from MnDOT Traffic Data Map 3 MnDOT's 2015 Green Sheets were used to determine the State average crash rate. 6 Severity rate factors: 5 for Fatal Crashes, 4 for A type, 3 for B type, 2 for C type, and 1 for Property Damage Crashes Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 16 April 18, 2019 2.3.3 Crash Severity The observed intersection crash rates do not exceed the corresponding critical crash rates. Therefore, the number of reported crashes would not be considered statistically significant. However, it is worth investigating the severity of reported crashes. At the Lexington Avenue / Red Fox Road intersection, 10 of the reported crashes resulted in an injury, while 29 were property damage only crashes. At the Lexington Avenue / Target South intersection two of the eight reported crashes resulted in an injury. At the Lexington Avenue / Enterprise-Big O Tires-Arby’s driveway one of the six reported crashes resulted in an injury. At the Lexington Avenue / Grey Fox Road intersection, four of the 14 reported crashes resulted in an injury. At the Lexington Avenue / Shannon Square driveway, neither reported crash resulted in an injury. Crash severity quantifies how severe the crashes are at a location. The purpose for analyzing this statistic is to identify locations that experience a low crash rate but have a high percentage of injury or fatal crashes. Conversely, locations which have high crash rates and a large proportion of property damage crashes may not warrant as much priority when deficiencies are being addressed. Although crash rates are not statistically significant, the Lexington Avenue / Red Fox Road intersection experienced a severity rate (1.09) slightly below the critical severity rate (1.17) and 12 percent higher than the statewide average severity rate (0.97). However, it should be noted that no fatal crashes occurred and only one (1) type A injury crash occurred over the analysis period. 2.4 Traffic Operations Analysis An existing traffic operations analysis was completed using Synchro/SimTraffic software to establish a baseline condition to which future traffic operations and alternatives could be compared. Operations analysis results identify a Level of Service (LOS), which indicates the quality of traffic flow through an intersection. Intersections are given a ranking from LOS A through LOS F. The LOS results are based on average delay per vehicle, which correspond to the delay threshold values shown in Table 2. Table 2. Level of Service Criteria Description Signalized Intersection Unsignalized Intersection A Free Flow: Low volumes and no delays.0 - 10 0 - 10 B Stable Flow: Speeds restricted by travel conditions, minor delays.> 10 - 20 > 10 - 15 C Stable Flow: Speeds and maneuverability closely controlled due to higher volumes.> 20 - 35 > 15 - 25 D Stable Flow: Speeds considerably affected by change in operating conditions. High density traffic restricts maneuverability, volume near capacity.> 35 - 55 > 25 - 35 E Unstable Flow: Low speeds, considerable delay, volume at or slightly over capacity.> 55 - 80 > 35 - 50 F Forced Flow: Very low speeds, volume exceed capacity, long delays with stop and go traffic.> 80 > 50 Source: Highway Capacity Manual, 2010 Edition, Transportation Research Board, Exhibits 18-4 & 19-1. Delay per Vehicle (seconds) Level of Service Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 17 April 18, 2019 LOS A indicates the best traffic operation, with vehicles experiencing minimal delays. LOS F indicates an intersection where demand exceeds capacity, or a breakdown of traffic flow. The LOS D/E boundary for overall operations is often used as the indicator of congestion in an urban area. For side-street stop-controlled intersections, a key measure of operational effectiveness is the side-street LOS. Long delays and poor LOS can occur on side-street approaches even if the overall intersection is functioning well, making side-street LOS a valuable design criterion. After LOS, the second component of the operations analysis is a study of vehicular queuing, or the lineup of vehicles waiting to pass through an intersection. An intersection can operate with an acceptable LOS, but if queues from the intersection block entrances to turn lanes or adjacent driveways, unsafe operating conditions could result. The 95th percentile queue, or the length of queue with only a five (5) percent probability of being exceeded during an analysis period, is considered the standard for design purposes. It should be noted that, after consultation with Ramsey County staff, an annual background growth rate of 0.5 percent was applied to existing traffic volumes to provide a conservative estimate of future year 2020 conditions. Results of the existing and year 2020 no build traffic operations analyses, presented in Table 3 and Table 4 respectively, indicate that all study intersections operate at overall LOS D or better during the a.m., midday, and p.m. peak hours. Detailed operations and queuing analysis results are presented in Appendix A. Table 3. Existing Operations Analysis Summary Key conclusions of the existing traffic operations analysis include the following: x Red Fox Road: Under midday and p.m. peak hour traffic volumes, southbound left-turn queuing can occasionally extend beyond available turn lane storage and into the I-694 EB Ramp Terminal intersection to the north. Access to the northbound right-turn lane at the adjacent I-694 EB Ramp Terminal intersection can occasionally be blocked by northbound through queues. Both preceding issues are a consequence of limited spacing between the Red Fox Road and I-694 EB Ramp Terminal intersections. The westbound right-turn movement at Red Fox Road also sees queues exceed provided turn lane storage. Lexington Avenue & Red Fox Road B / C 11.5 / 29.6 C / C 22.7 / 28.9 C / D 29.9 / 39.8 Lexington Avenue & Lexington Station A / A 1.4 / 7.8 C / F 20.6 / 208.7 A / F 8.9 / 109.9 Lexington Avenue & Target South A / B 0.6 / 12.5 B / F 10.2 / 93.9 A / F 4.6 / 65.2 Lexington Avenue & Enterprise/Big O Tires/Arby's A / B 0.7 / 11.5 A / E 2.5 / 48.5 A / C 1.4 / 15.9 Lexington Avenue & Grey Fox Road A / C 6.4 / 31.4 A / C 9.4 / 26.9 B / C 14.1 / 30.9 Lexington Avenue & Shannon Square A / A 2.5 / 8.0 A / C 4.4 / 16.2 A / C 5.8 / 20.7 Lexington Avenue & CR E C / C 21.4 / 32.7 C / C 21.3 / 31.0 D / D 40.9 / 53.2 Intersection AM Peak Hour PM Peak Hour LOS Delay (s)LOS Delay (s) MID Peak Hour LOS Delay (s) Overall Intersection LOS / Worst Approach LOS Overall Intersection Delay / Worst Approach Delay Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 18 April 18, 2019 x Lexington Station and Target South: Left-turn movements out of Lexington Station and Target South experience significant delay under midday and p.m. peak hour volumes. x Side-Street Left-Turns and the Two-Way Left-Turn Lane: Field observations indicate that the Lexington Avenue continuous TWLTL is frequently utilized as an acceleration lane for left-turn maneuvers from unsignalized side-streets due to limited gaps in mainline traffic. Table 4. Year 2020 No Build Operations Analysis Summary Key conclusions of the 2020 no build traffic operations analysis include the following: x Side-Street Left-Turns: Left-turn maneuvers from unsignalized side-streets are expected to become increasingly more difficult under the forecast year 2020 traffic volumes. Lexington Station, Target South, Enterprise/Big O Tires/Arby’s, and Shannon Square driveways are all projected to experience side-street left-turn delays corresponding to at least LOS E during the midday and/or p.m. peak hours. Lexington Avenue & Red Fox Road B / C 11.6 / 30.2 C / C 23.8 / 28.1 C / D 33.7 / 48.2 Lexington Avenue & Lexington Station A / A 1.4 / 7.3 D / F 30.3 / 294.6 C / F 22.7 / 311.0 Lexington Avenue & Target South A / B 0.6 / 13.0 A / F 6.3 / 56.7 A / F 5.7 / 81.8 Lexington Avenue & Enterprise/Big O Tires/Arby's A / B 0.6 / 10.7 A / F 2.4 / 50.1 A / C 1.5 / 23.2 Lexington Avenue & Grey Fox Road A / C 6.7 / 30.2 A / C 10.0 / 28.6 B / C 13.3 / 29.2 Lexington Avenue & Shannon Square A / B 2.6 / 10.4 A / C 4.4 / 18.0 A / E 7.8 / 43.6 Lexington Avenue & CR E C / C 21.8 / 32.4 C / C 21.2 / 31.1 D / D 43.0 / 52.4 PM Peak Hour Overall Intersection LOS / Worst Approach LOS Overall Intersection Delay / Worst Approach Delay Intersection AM Peak Hour LOS Delay (s)LOS Delay (s) MID Peak Hour LOS Delay (s) Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 19 April 18, 2019 3.0 Year 2040 Conditions Increases in vehicle traffic resulting from regional infrastructure, regional connectivity, business and residential development, and demographic changes will influence the long-term operation of the Lexington Avenue corridor and corresponding intersections. This traffic study evaluated intersection geometric and traffic control needs based upon the forecast year 2040 design horizon. The following section documents the forecast year 2040 conditions analysis completed for the Lexington Avenue corridor. 3.1 Trip Generation To account for traffic impacts associated with the ongoing Lexington Station development (see Figure 6), trip generation estimates were developed for the weekday a.m., midday, and p.m. peak hours as well as on a daily basis. The trip generation estimates were developed utilizing trip generation rates for similar land uses as documented in the ITE Trip Generation Manual, 10th Edition. The ITE Trip Generation Manual provides peak hour and daily trip generation rates based on studies of similar land uses. 3.1.1 Lexington Station – Phase 2 Lexington Station – Phase 2 was observed to be complete with approximately 50 percent of retail space occupied at the time of data collection (September 2018). No additional trips were included for the remaining 50 percent of the development as background growth rates included as part of traffic forecasting will provide appropriate estimates of side-street growth through the year 2020. 3.1.2 – Lexington Station – Phase 3 The ITE Trip Generation Manual was utilized to estimate the trip generation potential for Lexington Station – Phase 3, which is expected to be complete in 2021. Estimated site generated traffic for the Lexington Station Phase 3 development is detailed in Table 5. It should be noted that midday peak hour trips were assumed to be equal to p.m. peak hour trips to provide a conservative estimate of generated trips. Table 5. Lexington Station Phase 3 Trip Generation Estimates Trips In Trips Out Total Trips Trips In Trips Out Total Trips Trips In Trips Out Total Trips Gross Floor Area (SF) 7,605 8 1 9 1 8 9 1 8 9 74 Gross Floor Area (SF) 25,446 15 9 24 47 50 97 47 50 97 962 23 10 33 48 58 106 48 58 106 1,036 Source: ITE Trip Generation Manual, 10th Edition 1: Trips generated for the a.m. and p.m. peak hours of the adjacent roadway network. 2: Trips generated for the mid peak hours assumed to be equal to p.m. peak hours. 3: General Retail (Shopping Center) raw trip generation data inherently includes a multi-use reduction. Net New Trips General Office (710) General Retail3 (820) Daily Trips Proposed Development - Phase 3 Land Use (ITE Code)Units Size AM Peak Hour Trips1 PM Peak Hour Trips1 MID Peak Hour Trips2 Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 21 April 18, 2019 Results of the trip generation estimates indicate the current Phase 3 development plan is expected to generate approximately 33 a.m. peak hour trips, 106 midday/p.m. peak hour trips, and 1,036 daily trips. To conservatively estimate additional trips generated by Phase 3, trips will not be subtracted for existing land uses to be removed by Phase 3 construction. It should be noted that to provide conservative trip generation estimates for the Phase 3 development, no multi-use or pass-by trip reductions were applied. 3.1.3 – YMCA/Island Lake Golf Course Within the City of Shoreview 2040 Comprehensive Plan, potential redevelopment of the Island Lake Golf Course and the vacant lot adjacent to the YMCA facility at 3760 Lexington Ave is discussed at length, with low to medium-density housing likely being considered. Recent discussions with Ramsey County staff indicate that if the golf course were to cease operations, the associated land would likely remain a park in some capacity rather than being redeveloped. Therefore, as part of the trip generation process, no trips associated with this potential redevelopment were included. 3.2 Trip Distribution and Assignment The distribution of Lexington Station – Phase 3 development traffic was estimated based on the Lexington Station Traffic Study (dated May 20, 2013, completed by SRF Consulting Group) distribution developed for all three phases of development. This distribution was reviewed based on existing traffic volumes/patterns, engineering judgement, and was found to be appropriate for this study. The estimated proposed development directional distribution is shown in Figure 7. Trips were then assigned to study intersections based on this distribution for the forecast year 2040 conditions. Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 23 April 18, 2019 3.3 Traffic Forecasts After consultation with Ramsey County staff, an annual background growth rate of 0.5 percent was applied to existing traffic volumes to provide a conservative estimate of future year 2040 conditions. The resultant forecast year 2040 traffic volumes, a combination of background growth and Lexington Station – Phase 3 trips, are shown in Figure 8. The existing and forecast approach volumes on each leg of several Lexington Avenue study intersections are shown in Table 6. Table 6. Existing and Forecast Approach Volumes 2018 2020 2040 Eastbound 2810 2840 3140 Westbound 6650 6720 7420 Northbound 11000 11100 12300 Southbound 16500 16700 18400 Eastbound --- Westbound 1860 1880 2080 Northbound 12300 12400 13700 Southbound 12400 12500 13800 Eastbound 3370 3400 3760 Westbound 1510 1530 1690 Northbound 10200 10300 11400 Southbound 12700 12800 14200 Lexington Avenue & Grey Fox Road 1: Volumes shown are based on collected 2018 turning movement counts. 2: The Lexington Avenue & Target South intersection is currently a T-intersection without an eastbound approach. Realignment of either the Enterprise/Big O Tires/Arby's or Lexington Station driveways would increase approach volumes. Roadway Approach Lexington Avenue & Red Fox Road Lexington Avenue & Target South2 Daily Approach Volumes 1 Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 25 April 18, 2019 3.4 Year 2040 No Build Traffic Operations Analysis A traffic operations analysis was conducted to evaluate the operational performance of the various intersections along the Lexington Avenue corridor under forecast year 2040 traffic volumes. The purpose of this no build analysis is to create a baseline to compare the performance of each potential build alternative; ultimately aiding in the selection of a preferred alternative to be evaluated in greater detail. In addition, the traffic operations analysis provides context to the need for intersection improvements based on intersection capacity. The key measures of effectiveness evaluated include overall intersection delay/LOS and worst approach delay/LOS. Table 7 provides a summary of the year 2040 no build traffic operations analysis for the Lexington Avenue corridor. Table 7. Year 2040 No Build Operations Analysis Summary Results of the traffic operations analysis indicate that the Lexington Avenue corridor intersections are expected to operate at overall LOS C or better under year 2040 a.m. peak hour traffic volumes. However, under year 2040 midday and p.m. peak hour traffic volumes, most study intersections are expected to perform significantly worse, enduring long delays and queues under no build conditions. It should be noted that these conditions are partly due to the analysis using existing signal timing. Updating the signal timing and coordination along Lexington Avenue may reduce the magnitude of these problems. Key conclusions of the 2040 no build traffic operations analysis include the following: x Red Fox Road: Issues noted previously under existing and year 2020 conditions are expected to be further exacerbated. During the forecast year 2040 p.m. peak hour, the Lexington Avenue / Red Fox Road intersection is expected to operate at overall LOS E. x Lexington Station: During the forecast year 2040 midday and p.m. peak hours, the Lexington Avenue / Lexington Station intersection is expected to operate at overall LOS F. Lexington Avenue & Red Fox Road B / C 13.6 / 29.7 C / D 30.1 / 36.8 E / E 58.1 / 79.2 Lexington Avenue & Lexington Station A / B 1.7 / 10.4 F / F 102.2 / > 300 F / F 108.9 / > 300 Lexington Avenue & Target South A / C 0.7 / 20.1 C / F 24.7 / 235.0 C / F 20.4 / > 300 Lexington Avenue & Enterprise/Big O Tires/Arby's A / B 0.7 / 12.3 A / E 2.5 / 41.5 A / F 7.5 / 109.9 Lexington Avenue & Grey Fox Road A / C 6.6 / 31.7 B / C 10.6 / 26.6 C / F 25.5 / 94.8 Lexington Avenue & Shannon Square A / B 2.7 / 11.1 A / D 6.4 / 34.9 A / E 8.6 / 41.5 Lexington Avenue & CR E C / C 23.4 / 33.5 C / C 22.9 / 32.2 D / E 54.5 / 70.2 Overall Intersection LOS / Worst Approach LOS Overall Intersection Delay / Worst Approach Delay Intersection AM Peak Hour PM Peak Hour LOS Delay (s)LOS Delay (s) MID Peak Hour LOS Delay (s) Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 26 April 18, 2019 x Side-Street Left-Turns: Left-turn maneuvers from unsignalized side-streets are expected to become significantly more difficult under the forecast year 2040 traffic volumes. Lexington Station, Target South, Enterprise/Big O Tires/Arby’s, and Shannon Square driveways are all projected to experience side-street left-turn delays corresponding to at least LOS E during the midday and/or p.m. peak hours. x County Road E: Under forecast year 2040 p.m. peak hour traffic volumes, inefficient east/west split phasing causes unnecessary delay and queuing, particularly on the eastbound approach. 3.5 Identification of Deficiencies Based on the safety analysis, geometric considerations evaluated, preliminary traffic operations analysis, and discussions with Ramsey County, the following deficiencies have been identified: 3.5.1 Safety Deficiencies Gap Selection At the Lexington Avenue / Red Fox Road intersection, 19 of 20 reported right-angle/left-turn crashes occurred during midday or p.m. hours, with 15 of these 19 crashes involving southbound left-turning vehicles. This trend is evident throughout the Lexington Avenue corridor, with 34 of the 36 right-angle/left-turn crashes occurring during midday or p.m. hours. It can be concluded that heavier volumes and permissive “green ball” left-turn operation may be resulting in driver confusion/poor gap selection throughout the corridor. Rear-End Injuries Examining injury crashes throughout the Lexington Avenue corridor, 10 of the 17 injury crashes were rear-end crashes, with all 10 occurring during midday or p.m. hours. A continuous TWLTL throughout much of the corridor allows mainline left-turning motorists to exit through traffic prior to turning. However, only one intersection has a dedicated right-turn lane (northbound approach at Red Fox Road). High volumes, frequent driveway access, and a lack of right-turn lanes may be contributing to the increased number of rear-end crashes observed throughout the corridor. 3.5.2 Access Management Lexington Station / Target South / Enterprise-Big O Tires-Arby’s Currently, three side-street stop controlled driveways are located within 500 feet of each other between the signalized intersections of Lexington Avenue / Red Fox Road and Lexington Avenue / Grey Fox Road. Lexington Station and Target currently both have connections to Red Fox Road to the north; however, the existing Lexington Avenue driveway for Enterprise-Big O Tires-Arby’s is the only access to these businesses. A signal at the Target South intersection would provide an opportunity to consolidate driveway access to businesses on the west side of Lexington Avenue. Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 27 April 18, 2019 Shannon Square Driveway Shannon Square businesses currently have a connection to Lexington Avenue via the Cub Foods parking lot and Grey Fox Road to the north, in addition to the direct driveway access along Lexington Avenue located approximately 550 feet to the south of Grey Fox Road. Due to frequent significant delay in executing the eastbound left-turn maneuver from Shannon Square, many outbound motorists choose to route through the Cub Foods parking lot to access the traffic signal at Grey Fox Road. This is exhibited by the disparity in traffic volumes between the eastbound left-turn maneuver and the southbound right-turn maneuver, as the eastbound left-turn maneuver exhibits significantly lower volumes over all time periods. 3.5.3 Operational Deficiencies Lexington Avenue & Red Fox Road Results of the traffic operations analysis indicate that the Lexington Avenue / Red Fox Road intersection is expected to operate at overall LOS F under year 2040 no build p.m. peak hour traffic volumes. Limited southbound left-turn capacity and inadequate spacing to the I-694 EB Ramp Terminal intersection create queuing issues, with southbound queues frequently extending into the I-694 EB Ramp Terminal intersection during peak hours. A similar problem affects the northbound approach to the I-694 EB Ramp Terminal intersection, as through queues frequently block access to the adjacent right-turn lane, causing the combined queues to extend to Red Fox Road. Lexington Avenue & Grey Fox Road Results of the traffic operations analysis indicate that the Lexington Avenue & Grey Fox Road intersection is expected to operate at overall LOS E under year 2040 no build p.m. peak hour traffic volumes. However, northbound and southbound movements operate at LOS C or better. Higher side-street volumes/permissive-only left-turn movements result in long delays and queues for the shared eastbound left-turn/through lane. Lexington Avenue & Driveway Access Results of the traffic operations analysis indicate that throughout the Lexington Avenue corridor driveways are expected to perform poorly under year 2040 no build p.m. peak hour traffic volumes. Most eastbound and westbound approaches are expected to operate at LOS F, with only the Lexington Avenue / Enterprise-Big O Tires-Arby’s right-turn movement operating at LOS B as a low volume movement. Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 28 April 18, 2019 4.0 Preliminary Alternatives Analysis To address documented crash concerns and to preserve traffic mobility, a preliminary alternatives analysis was completed. The goals of the preliminary alternatives analysis are to identify engineering considerations, expected traffic operations and safety impacts, as well as select a preferred alternative. Key elements of the preliminary alternatives analysis include: x Completion of a signal warrant analysis based on existing traffic volumes x Identification of preliminary alternatives x Completion of a traffic operations analysis to assess the performance of each alternative x Documentation of potential safety benefits x Selection of a preferred alternative 4.1 Signal Warrant Analysis A signal warrant analysis was completed for the Lexington Avenue intersections at Red Fox Road, Grey Fox Road, and Target South under existing traffic volumes. The warrant analysis was conducted in accordance with the Minnesota Manual on Uniform Traffic Control Devices (MnMUTCD). The following signal warrants were considered: x W1 – Eight-Hour Vehicular Volume x W2 – Four-Hour Vehicular Volume x W3 – Peak Hour x W4 – Pedestrian Volume x W5 – School Crossing x W6 – Coordinated Signal System x W7 – Crash Experience x W8 – Roadway Network x W9 – Intersection Near a Grade Crossing Warrant 1, Warrant 2, Warrant 3, and Warrant 7 were reviewed under existing traffic volumes. The remaining traffic signal warrants were not applicable at the study intersections, or minimum warrant standards were not met. Table 8 presents a summary of the MnMUTCD signal warrant analysis results. Detailed signal warrant analysis results are included in Appendix B. Table 8. Signal Warrant Analysis Summary 1A 1B 1C Met? Hours Met? 3B Met? Crashes Met? Lexington Ave & Red Fox Rd 3148 Yes 13 Yes 9 Yes 7 Yes Lexington Ave & Grey Fox Rd 8149 Yes 10 Yes 9 Yes 3 No Lexington Ave & Target South 030 No 3 No 1 Yes 3 No Warrant 7 - Crash ExperienceIntersection Warrant 1 - Eight-Hour Vehicular Volumes Warrant 3 - Peak Hour Warrant 2 - Four-Hour Vehicular Volumes Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 29 April 18, 2019 Results of the signal warrant analysis indicate that both existing signalized intersections meet eight-hour, four-hour, and peak hour warrants under existing conditions in addition to the Red Fox Road intersection meeting the crash experience warrant. Additionally, the Target South intersection meets the peak hour warrant under existing conditions. Therefore, continuing to operate (Red Fox Road, Grey Fox Road) or beginning to operate (Target South) the study intersections under traffic signal control is warranted. It should be noted that the Lexington Avenue / Target South intersection warrant analysis does not include Lexington Station or Enterprise / Big O Tires / Arby’s driveway volumes, which if included would only further emphasize the need for improved traffic control at the Target South intersection. 4.2 Identification of Preliminary Intersection Alternatives Up to five alternatives were identified for analysis at each of the primary study intersections in addition baseline improvements (Alternative 0) throughout the Lexington Avenue corridor. The baseline improvements should be considered the minimal level of appropriate corridor improvement and will provide a means of comparison for additional geometric and traffic signal improvements proposed under other alternatives. The preliminary alternatives at each primary study intersection are as follows: Lexington Avenue & Red Fox Road x Alternative 0 (Baseline Improvements) o NB/SB protective only left-turn phasing during p.m. peak hour o EB/WB protective/permissive flashing yellow arrow (FYA) left-turn phasing o Signal timing revisions: ƒ WB right-turn overlap with the SB left-turn phase o Add a dedicated EB right-turn lane x Alternative 1 o Add a dedicated SB right-turn lane x Alternative 2 o Add dual SB left-turn lanes o Extend Red Fox Road EB right-turn trap to second Target driveway to minimize the potential for merging conflicts x Alternatives 3/4/5 o No additional improvements Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 30 April 18, 2019 Lexington Avenue & Target South x Alternative 0 (Baseline Improvements) o Install a new traffic signal at the Target South driveway o Relocate Lexington Station access to align with new Target South signal o NB/SB protective/permissive FYA left-turn phasing o EB/WB permissive left-turn phasing o Reconfigure EB/WB to dedicated left-turn lanes and shared through/right-turn lanes x Alternative 1 o Add a dedicated NB right-turn lane x Alternatives 2/3 o No additional improvements x Alternative 4 o Modify Enterprise / Big O Tires / Arby’s driveway to RIRO access x Alternative 5 o Relocate Enterprise / Big O Tires / Arby’s access to align with new Target South signal o Add a dedicated SB right-turn lane Lexington Avenue & Grey Fox Road x Alternative 0 (Baseline Improvements) o NB/SB protective/permissive FYA left-turn phasing o EB/WB protective/permissive FYA left-turn phasing o Reconfigure EB/WB to dedicated left-turn lanes and shared through/right-turn lanes x Alternative 1 o Add a dedicated SB right-turn lane x Alternatives 2/3 o No additional improvements x Alternative 4 o Modify Shannon Square driveway to RIRO access x Alternative 5 o Remove Shannon Square access Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 31 April 18, 2019 Additional Improvements x Alternative 0 – Corridor Improvements (Baseline Improvements) o Replace traffic signal infrastructure as needed throughout the Lexington Avenue corridor from the I-694 WB Ramp Terminal (north end) intersection through CR E (south end) o Update signal timing throughout the Lexington Avenue corridor from CR F (north end) through CR E (south end) ƒ Provide FYA left-turn operations ƒ Provide a leading pedestrian interval (LPI) upon actuation to improve pedestrian visibility/comfort at all signalized intersections o Replace existing continuous TWLTL with a raised median throughout the Lexington Avenue corridor from Red Fox Road (north end) to CR E (south end) ƒ Provide pocket left-turn lanes at all signalized intersections x Alternatives 1/2 o No additional improvements x Alternative 3 – County Road E Intersection Improvements o Modify the WB approach median to offset the left-turn lane further south to allow the EB/WB left-turns to operate simultaneously (eliminate split EB/WB phasing) ƒ Would require a new 55-foot mast arm in addition to a 5-foot mast arm extender for the WB traffic signal indications (NW quadrant signal pole) o EB/WB protective/permissive FYA left-turn phasing x Alternative 4 – I-694 EB Ramp Intersection Improvements o Extend NB right-turn lane to minimize the potential for through queues blocking o Modify Exxon gas station access to right-out only x Alternative 5 o No additional improvements Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 32 April 18, 2019 County Road E Improvements Beyond the CR E intersection improvements detailed above, several others were also considered: x County Road E Intersection o Reconfigure SB approach to consist of separate left-turn / through / right-turn lanes ƒ This improvement would prevent right-turning vehicles from being blocked by queued through vehicles in a shared through/right-turn lane that would otherwise prevent a right-turn on red maneuver. However, the flexibility offered by the shared through/right-turn lane minimizes potential for lengthy southbound queues during peak hours. o Extend SB left-turn lane beyond railroad crossing ƒ This improvement would provide left-turning vehicles more storage and avoid through vehicle queues from blocking the left-turn lane. However, the minimal operational improvement is offset by the safety risk of having another vehicle lane crossing the railroad tracks (located approximately 250 feet north of CR E). ƒ Recommend lagging the SB left-turn movement to allow left-turning vehicles blocked by through vehicle queues to enter the left-turn lane prior to receiving a protected green arrow. 4.3 Preliminary Alternatives Traffic Operations Analysis A traffic operations analysis was conducted to evaluate the operational performance of the various alternatives under forecast year 2040 traffic volumes. Since the p.m. peak hour exhibited the poorest traffic operations under existing conditions, the p.m. peak hour was chosen for the operations analysis of the various preliminary intersection alternatives. The purpose of this preliminary analysis is to compare the performance of each alternative to aid in the selection of a preferred alternative to be evaluated in greater detail. In addition, the traffic operations analysis provides context to the need for intersection improvements based on intersection capacity. The key measures of effectiveness evaluated include overall intersection delay/LOS and approach delay/LOS. Table 9 provides a summary of the traffic operations analysis under forecast year 2040 p.m. peak hour traffic volumes. Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 33 April 18, 2019 Table 9. Operations Analysis Summary – Preliminary Alternatives (2040 PM Peak Hour) Alternatives 0, 1, & 2: Alternatives 3, 4, & 5: Results of the traffic operations analysis indicate that the Lexington Avenue corridor intersections are expected to operate at overall LOS D or better under forecast year 2040 traffic volumes and the various preliminary alternatives. Modeling indicates that the side-street approaches at the Lexington Avenue / Enterprise-Big O Tires-Arby’s and Lexington Avenue / Shannon Square intersections are expected to endure long delays and queues under alternatives 0, 1, 2, and 3. This is primarily due to the difficulty of finding acceptable gaps to make side-street left-turn maneuvers under peak hour volumes. It should be noted that unsignalized side-street right-turn maneuvers would typically be expected to be made with minimal delay, except when blocked by queued left-turning vehicles. Therefore, RIRO access may be acceptable at unsignalized intersections. Lexington Avenue & I-694 WB Ramps C / E 30.3 / 60.9 C / D 26.2 / 45.4 C / D 28.7 / 53.1 Lexington Avenue & I-694 EB Ramps C / E 24.9 / 67.2 C / D 21.1 / 50.6 C / D 21.2 / 41.3 Lexington Avenue & Red Fox Road C / D 34.7 / 47.9 C / D 34.6 / 52.7 C / D 28.5 / 42.4 Lexington Avenue & Lexington Station Lexington Avenue & Target South Lexington Avenue & Enterprise/Big O Tires/Arby's A / C 1.8 / 20.1 A / C 1.5 / 20.8 A / C 1.5 / 20.5 Lexington Avenue & Grey Fox Road B / D 17.0 / 41.1 B / D 15.5 / 42.7 B / D 16.5 / 41.3 Lexington Avenue & Shannon Square A / D 6.9 / 28.3 A / D 6.8 / 32.1 A / E 8.0 / 47.5 Lexington Avenue & CR E D / E 48.8 / 74.5 D / E 48.8 / 74.5 D / E 48.8 / 74.5 1: Lexington Avenue & Lexington Station consolidated with Lexington & Target South for Alternatives 0,1,2,3,4,&5 A /D 7.5 /29.58.6 /29.2 A /D 7.3 /29.6 Overall Intersection LOS / Worst Approach LOS Overall Intersection Delay / Worst Approach Delay ALT 0 ALT 1 ALT 2 LOS Delay (s)LOS Delay (s)LOS Delay (s) A /D Intersection Lexington Avenue & I-694 WB Ramps C / D 28.2 / 46.0 C / E 30.2 / 58.8 C / D 25.0 / 45.4 Lexington Avenue & I-694 EB Ramps C / D 20.9 / 41.9 C / D 21.6 / 44.1 C / D 21.3 / 45.1 Lexington Avenue & Red Fox Road C / D 28.8 / 47.9 C / D 26.9 / 41.4 C / D 27.8 / 41.8 Lexington Avenue & Lexington Station Lexington Avenue & Target South Lexington Avenue & Enterprise/Big O Tires/Arby's A / D 2.1 / 33.9 A / A 1.5 / 9.6 Lexington Avenue & Grey Fox Road B / D 16.6 / 41.2 C / D 21.0 / 41.8 Lexington Avenue & Shannon Square A / F 8.5 / 52.4 A / C 4.5 / 15.6 Lexington Avenue & CR E D / E 42.8 / 56.0 D / E 42.8 / 57.9 D / E 42.2 / 63.4 3: Lexington Avenue & Shannon Square consolidated with Lexington & Grey Fox Road for Alternative 5 2: Lexington Avenue & Enterprise/Big O Tires/Arby's consolidated with Lexington & Target South for Alternative 5 /D Intersection ALT 3 ALT 4 ALT 5 LOS Delay (s)LOS Delay (s)LOS Delay (s) B /D 15.6 /40.6 Overall Intersection LOS / Worst Approach LOS Overall Intersection Delay / Worst Approach Delay 7.8 /30.6 A /D 6.7 /30.0 A /D 8.3 /32.5 A Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 34 April 18, 2019 Key conclusions of the traffic operations analysis include the following: x Alternative 0: Updated signal timing and coordination reduced overall delay and queuing at all intersections, while the Target South signal, with the reconfigured Lexington Station driveway tying into the signal from the west, performed at overall LOS A. x Alternative 1: Additional right-turn lanes at Red Fox Road, Target South, and Grey Fox Road slightly improved delay with the added benefit of safer operations (potential rear-end crash mitigation). x Alternative 2: Dual SB left-turn lanes at Red Fox Road improved overall delay by roughly six seconds per vehicle, as more green time could be provided for other movements. In addition, southbound left-turn 95th percentile queuing is expected to be significantly improved compared to Alternative 0, especially during the p.m. peak hour (No Build – 480 feet, Alternative 0 – 425 feet, Alternative 2 – 247 feet) allowing vehicles to stack within the provided turn lane bays. x Alternative 3: Modification of the WB approach at CR E improved overall delay during the p.m. peak hour, eliminated split phasing, and allowed for off-peak FYA operations. x Alternative 4: Reconfiguring both the Enterprise/Big O Tires/Arby’s and Shannon Square driveways to RIRO operation eliminated left-turn conflicts and improved side-street delay without hurting the overall performance of the adjacent signalized intersections. x Alternative 5: Removing access to the Enterprise/Big O Tires/Arby’s and Shannon Square driveways provided minimal improvements to side-street delay over Alternative 4. However, access removal allowed for better signal coordination and progression throughout the corridor. 4.4 Preliminary Alternatives Comparison Matrix A preliminary alternatives comparison matrix summarizing the key decision factors with respect to project goals is provided in Table 10. The key decision factors include: x Pros and Cons – Qualitative assessment of key advantages and disadvantages of the preliminary intersection alternatives x Operations Evaluation – Documentation of anticipated future traffic operations x Design Considerations – Qualitative assessment of design issues, considerations, property and right of way impacts 7DEOH3UHOLPLQDU\$OWHUQDWLYHV&RPSDULVRQ0DWUL[$OWHUQDWLYH%DVHOLQH,PSURYHPHQWV ĞƐĐƌŝƉƚŝŽŶ WƌŽƐĂŶĚŽŶƐ KƉĞƌĂƚŝŽŶƐǀĂůƵĂƚŝŽŶ ĞƐŝŐŶŽŶƐŝĚĞƌĂƚŝŽŶ dƌĂĨĨŝĐƐŝŐŶĂůŝŵƉƌŽǀĞŵĞŶƚƐĂůŽŶŐƚŚĞ ĞŶƚŝƌĞ>ĞdžŝŶŐƚŽŶǀĞŶƵĞĐŽƌƌŝĚŽƌŝŶĐůƵĚŝŶŐ ƉƌŽƚĞĐƚŝǀĞͬƉĞƌŵŝƐƐŝǀĞ&zůĞĨƚͲƚƵƌŶ ŽƉĞƌĂƚŝŽŶ͕ĂĚĚŝƚŝŽŶŽĨĂƚƌĂĨĨŝĐƐŝŐŶĂůĂƚ dĂƌŐĞƚ^ŽƵƚŚ͕ƌĞĂůŝŐŶŵĞŶƚŽĨƚŚĞ>ĞdžŝŶŐƚŽŶ ^ƚĂƚŝŽŶĚƌŝǀĞǁĂLJƚŽĂůŝŐŶǁŝƚŚƚŚĞŶĞǁ dĂƌŐĞƚ^ŽƵƚŚƐŝŐŶĂů͕ĂŶĚĂĚĚŝƚŝŽŶŽĨĂŶ ƌŝŐŚƚͲƚƵƌŶůĂŶĞĂƚZĞĚ&ŽdžZŽĂĚ͘ WƌŽƐ͗ ϭ͘ůůŽǁƐĨŽƌƉĞƌŵŝƐƐŝǀĞ&zůĞĨƚͲƚƵƌŶŽƉĞƌĂƚŝŽŶƐĂƚĂůůƐŝŐŶĂůŝnjĞĚŝŶƚĞƌƐĞĐƚŝŽŶƐ͕ǁŚŝĐŚĐĂŶďĞĂŶŽƉĞƌĂƚŝŽŶĂůďĞŶĞĨŝƚƉĂƌƚŝĐƵůĂƌůLJĚƵƌŝŶŐƚŚĞŽĨĨͲ ƉĞĂŬŚŽƵƌƐ Ϯ͘ƌŝǀĞƌĨĂŵŝůŝĂƌŝƚLJ ŽŶƐ͗ ϭ͘ŽĞƐŶŽƚĂĚĚƌĞƐƐ^ZĞĚ&ŽdžZŽĂĚƋƵĞƵŝŶŐŝƐƐƵĞ Ϯ͘ŽĞƐŶŽƚĞůŝŵŝŶĂƚĞŝŶĞĨĨŝĐŝĞŶƚZͬtƐƉůŝƚƉŚĂƐĞƐŝŐŶĂůƚŝŵŝŶŐ ϯ͘ŽĞƐŶŽƚŝŵƉƌŽǀĞƐŝĚĞͲƐƚƌĞĞƚĚĞůĂLJĂƚƐƚŽƉͲĐŽŶƚƌŽůůĞĚŝŶƚĞƌƐĞĐƚŝŽŶƐĚƵƌŝŶŐŵŝĚĚĂLJĂŶĚƉ͘ŵ͘ƉĞĂŬŚŽƵƌƐ ϰ͘>ŝŵŝƚĞĚƚƌĂĨĨŝĐƐĂĨĞƚLJŝŵƉƌŽǀĞŵĞŶƚĂůŽŶŐƚŚĞĐŽƌƌŝĚŽƌ KǀĞƌĂůů/ŶƚĞƌƐĞĐƚŝŽŶ>K^ͬĞůĂLJ;ϮϬϰϬWDͿ͗ >ĞdžŝŶŐƚŽŶͬZĞĚ&Ždž͗>K^ͬϯϰ͘ϳ >ĞdžŝŶŐƚŽŶͬdĂƌŐĞƚ^ŽƵƚŚ͗>K^ͬϴ͘ϲ >ĞdžŝŶŐƚŽŶͬ'ƌĞLJ&Ždž͗>K^ͬϭϳ͘Ϭ >ĞdžŝŶŐƚŽŶͬZ͗>K^ͬϰϴ͘ϴ KƉĞƌĂƚŝŽŶƐǀĂůƵĂƚŝŽŶ,ŝŐŚůŝŐŚƚ͗ ^ŝŐŶŝĨŝĐĂŶƚůLJŝŵƉƌŽǀĞƐĚĞůĂLJͬƋƵĞƵĞŝŶŐƚŚƌŽƵŐŚŽƵƚƚŚĞ ĐŽƌƌŝĚŽƌĨŽƌďŽƚŚƉĞĂŬŚŽƵƌĂŶĚŽĨĨͲƉĞĂŬƉĞƌŝŽĚƐ ͲWƌŽǀŝĚĞ&zůĞĨƚͲƚƵƌŶƐŝŐŶĂůŝŶĚŝĐĂƚŝŽŶƐŽŶĂůůĨŽƵƌĂƉƉƌŽĂĐŚĞƐ;ŝĨŽƉƉŽƐŝŶŐůĞĨƚͲƚƵƌŶƉĂƚŚƐĚŽŶŽƚĐŽŶĨůŝĐƚͿĂƚZĞĚ &ŽdžZŽĂĚ͕dĂƌŐĞƚ^ŽƵƚŚ͕ĂŶĚ'ƌĞLJ&ŽdžZŽĂĚ͘KƉĞƌĂƚĞƉƌŽƚĞĐƚĞĚŽŶůLJůĞĨƚͲƚƵƌŶƐĚƵƌŝŶŐƉ͘ŵ͘ƉĞĂŬƉĞƌŝŽĚƐĂƚZĞĚ&Ždž ZŽĂĚŽƌĂƐĚĞĞŵĞĚĂƉƉƌŽƉƌŝĂƚĞƚŚƌŽƵŐŚĂ&zĂƐƐĞƐƐŵĞŶƚ͘ $OWHUQDWLYH7XUQ/DQH$GGLWLRQV ĞƐĐƌŝƉƚŝŽŶ WƌŽƐĂŶĚŽŶƐ KƉĞƌĂƚŝŽŶƐǀĂůƵĂƚŝŽŶ ĞƐŝŐŶŽŶƐŝĚĞƌĂƚŝŽŶ /ŶĐůƵĚĞƐĂůůůƚĞƌŶĂƚŝǀĞϬŝŵƉƌŽǀĞŵĞŶƚƐŝŶ ĂĚĚŝƚŝŽŶƚŽĂ^ƌŝŐŚƚͲƚƵƌŶůĂŶĞĂƚZĞĚ&Ždž ZŽĂĚ͕ĂEƌŝŐŚƚͲƚƵƌŶůĂŶĞĂƚdĂƌŐĞƚ^ŽƵƚŚ͕ ĂŶĚĂ^ƌŝŐŚƚͲƚƵƌŶůĂŶĞĂƚ'ƌĞLJ&ŽdžZŽĂĚ͘ WƌŽƐ͗ ϭ͘/ŵƉƌŽǀĞƐƚƌĂĨĨŝĐƐĂĨĞƚLJĂŶĚŽƉĞƌĂƚŝŽŶƐďLJƉƌŽǀŝĚŝŶŐƌŝŐŚƚͲƚƵƌŶŵŽǀĞŵĞŶƚƐǁŝƚŚĂĚĞĚŝĐĂƚĞĚůĂŶĞ ŽŶƐ͗ ϭ͘ŽĞƐŶŽƚŝŵƉƌŽǀĞůĞĨƚͲƚƵƌŶƐĂĨĞƚLJĂƚƐƚŽƉͲĐŽŶƚƌŽůůĞĚŝŶƚĞƌƐĞĐƚŝŽŶƐ KǀĞƌĂůů/ŶƚĞƌƐĞĐƚŝŽŶ>K^ͬĞůĂLJ;ϮϬϰϬWDͿ͗ >ĞdžŝŶŐƚŽŶͬZĞĚ&Ždž͗>K^ͬϯϰ͘ϲ >ĞdžŝŶŐƚŽŶͬdĂƌŐĞƚ^ŽƵƚŚ͗>K^ͬϳ͘ϱ >ĞdžŝŶŐƚŽŶͬ'ƌĞLJ&Ždž͗>K^ͬϭϱ͘ϱ KƉĞƌĂƚŝŽŶƐǀĂůƵĂƚŝŽŶ,ŝŐŚůŝŐŚƚ͗ ^ůŝŐŚƚůLJŝŵƉƌŽǀĞƐďŽƚŚƚŚƌŽƵŐŚĂŶĚƌŝŐŚƚͲƚƵƌŶ ĚĞůĂLJͬƋƵĞƵĞŝŶŐĂƚZĞĚ&ŽdžZŽĂĚ͕dĂƌŐĞƚ^ŽƵƚŚ͕ĂŶĚ'ƌĞLJ &ŽdžZŽĂĚŝŶƚĞƌƐĞĐƚŝŽŶƐ ͲZĞƋƵŝƌĞƐĂĚĚŝƚŝŽŶĂůǁŝĚƚŚĂƚZĞĚ&ŽdžZŽĂĚ͕dĂƌŐĞƚ^ŽƵƚŚ͕ĂŶĚ'ƌĞLJ&ŽdžZŽĂĚŝŶƚĞƌƐĞĐƚŝŽŶƐƚŽĂĐĐŽŵŵŽĚĂƚĞ ĂĚĚĞĚƌŝŐŚƚͲƚƵƌŶůĂŶĞƐ͘ $OWHUQDWLYH5HG)R[5RDG,QWHUVHFWLRQ'XDO6%/HIW7XUQ/DQHV ĞƐĐƌŝƉƚŝŽŶ WƌŽƐĂŶĚŽŶƐ KƉĞƌĂƚŝŽŶƐǀĂůƵĂƚŝŽŶ ĞƐŝŐŶŽŶƐŝĚĞƌĂƚŝŽŶ /ŶĐůƵĚĞƐĂůůůƚĞƌŶĂƚŝǀĞƐϬͬϭŝŵƉƌŽǀĞŵĞŶƚƐ ŝŶĂĚĚŝƚŝŽŶƚŽĚƵĂů^ůĞĨƚͲƚƵƌŶůĂŶĞƐĂƚZĞĚ &ŽdžZŽĂĚ͘ WƌŽƐ͗ ϭ͘ĚĚƌĞƐƐĞƐƚŚĞ^ZĞĚ&ŽdžZŽĂĚƋƵĞƵŝŶŐŝƐƐƵĞďLJƉƌŽǀŝĚŝŶŐĂĚĚŝƚŝŽŶĂůůĞĨƚͲƚƵƌŶĐĂƉĂĐŝƚLJ͕ŵŝŶŝŵŝnjŝŶŐƚŚĞƉŽƚĞŶƚŝĂůĨŽƌ^ŵŽǀĞŵĞŶƚƋƵĞƵĞƐƚŽ ĞdžƚĞŶĚŝŶƚŽƚŚĞ>ĞdžŝŶŐƚŽŶǀĞŶƵĞͬ/ͲϲϵϰZĂŵƉƐŝŶƚĞƌƐĞĐƚŝŽŶ ŽŶƐ͗ ϭ͘ŽƐƚŝŶĐƌĞĂƐĞǀŝĂƐŝŐŶŝĨŝĐĂŶƚƌĞĐŽŶƐƚƌƵĐƚŝŽŶŽĨƚŚĞ^ĂƉƉƌŽĂĐŚ͕ĂŶĚƉŽƚĞŶƚŝĂůƌĞĂůŝŐŶŵĞŶƚŽĨƚŚĞEĂƉƉƌŽĂĐŚĂƐǁĞůů Ϯ͘ĚĚŝƚŝŽŶĂůĐŽƐƚƚŽŝƚLJŽĨ^ŚŽƌĞǀŝĞǁƚŽĞdžƚĞŶĚƌŝŐŚƚͲƚƵƌŶƚƌĂƉƚŽƐĞĐŽŶĚdĂƌŐĞƚĚƌŝǀĞǁĂLJŽŶZĞĚ&ŽdžZŽĂĚƚŽŵŝŶŝŵŝnjĞƉŽƚĞŶƚŝĂůŵĞƌŐŝŶŐ ĐŽŶĨůŝĐƚƐ͘ KǀĞƌĂůů/ŶƚĞƌƐĞĐƚŝŽŶ>K^ͬĞůĂLJ;ϮϬϰϬWDͿ͗ >ĞdžŝŶŐƚŽŶͬZĞĚ&Ždž͗>K^ͬϮϴ͘ϱ KƉĞƌĂƚŝŽŶƐǀĂůƵĂƚŝŽŶ,ŝŐŚůŝŐŚƚ͗ /ŵƉƌŽǀĞƐ^ůĞĨƚͲƚƵƌŶƋƵĞƵĞŝŶŐ͕ǁŚŝůĞƐůŝŐŚƚůLJŝŵƉƌŽǀŝŶŐ ŽƚŚĞƌŵŽǀĞŵĞŶƚƐĚƵĞƚŽŝŶĐƌĞĂƐĞƐŝŶĂůůŽƚƚĞĚŐƌĞĞŶƚŝŵĞ ͲZĞƋƵŝƌĞƐĂĚĚŝƚŝŽŶĂůǁŝĚƚŚĂƚZĞĚ&ŽdžZŽĂĚŝŶƚĞƌƐĞĐƚŝŽŶƚŽĂĐĐŽŵŵŽĚĂƚĞĚĚƵĂů^ůĞĨƚͲƚƵƌŶůĂŶĞƐ͘ ͲDĂLJƌĞƋƵŝƌĞĂĚĚŝƚŝŽŶĂůĐŽŶƐƚƌƵĐƚŝŽŶŽŶZĞĚ&ŽdžZŽĂĚ $OWHUQDWLYH&RXQW\5RDG(,QWHUVHFWLRQ,PSURYHPHQWV ĞƐĐƌŝƉƚŝŽŶ WƌŽƐĂŶĚŽŶƐ KƉĞƌĂƚŝŽŶƐǀĂůƵĂƚŝŽŶ ĞƐŝŐŶŽŶƐŝĚĞƌĂƚŝŽŶ /ŶĐůƵĚĞƐĂůůůƚĞƌŶĂƚŝǀĞƐϬͬϭͬϮ ŝŵƉƌŽǀĞŵĞŶƚƐŝŶĂĚĚŝƚŝŽŶƚŽƚŚĞ ŵŽĚŝĨŝĐĂƚŝŽŶŽĨƚŚĞtĂƉƉƌŽĂĐŚĂƚ ŽƵŶƚLJZŽĂĚ͕ĂůůŽǁŝŶŐĐŽŶĐƵƌƌĞŶƚ ͬtůĞĨƚͲƚƵƌŶŵŽǀĞŵĞŶƚƐĂŶĚ ĞůŝŵŝŶĂƚŝŽŶŽĨƐƉůŝƚƉŚĂƐŝŶŐ͘ WƌŽƐ͗ ϭ͘ůŝŵŝŶĂƚĞƐŝŶĞĨĨŝĐŝĞŶƚͬtƐƉůŝƚƉŚĂƐŝŶŐďLJĂůůŽǁŝŶŐĐŽŶĐƵƌƌĞŶƚůĞĨƚͲƚƵƌŶŵĂŶĞƵǀĞƌƐ ŽŶƐ͗ ϭ͘DŽĚĞƌĂƚĞĐŽƐƚǀŝĂŵĞĚŝĂŶƌĞĐŽŶƐƚƌƵĐƚŝŽŶŽŶƚŚĞtĂƉƉƌŽĂĐŚ Ϯ͘ZĞƋƵŝƌĞƐŶĞǁϱϱΖŵĂƐƚĂƌŵŝŶĂĚĚŝƚŝŽŶƚŽĂϱΖĞdžƚĞŶĚĞƌĨŽƌƚŚĞtƚƌĂĨĨŝĐƐŝŐŶĂůŝŶĚŝĐĂƚŝŽŶƐ;EtƋƵĂĚƌĂŶƚƐŝŐŶĂůƉŽůĞͿ KǀĞƌĂůů/ŶƚĞƌƐĞĐƚŝŽŶ>K^ͬĞůĂLJ;ϮϬϰϬWDͿ͗ >ĞdžŝŶŐƚŽŶͬZ͗>K^ͬϰϮ͘ϴ KƉĞƌĂƚŝŽŶƐǀĂůƵĂƚŝŽŶ,ŝŐŚůŝŐŚƚ͗ /ŵƉƌŽǀĞƐĚĞůĂLJĨŽƌĂůůĂƉƉƌŽĂĐŚĞƐĚƵƌŝŶŐƉ͘ŵ͘ƉĞĂŬŚŽƵƌ͕ ǁŝƚŚƉŽƚĞŶƚŝĂůĨŽƌĨƵƌƚŚĞƌŵŝŶŝŵŝnjĞĚĚĞůĂLJĚƵƌŝŶŐŽĨĨͲƉĞĂŬ ƉĞƌŝŽĚƐ ͲZĞƋƵŝƌĞƐŵŽĚĞƌĂƚĞŵĞĚŝĂŶƌĞĐŽŶƐƚƌƵĐƚŝŽŶŽŶƚŚĞtĂƉƉƌŽĂĐŚ ͲZĞƋƵŝƌĞƐƐƚƌŝƉŝŶŐĂŶĚƐŝŐŶŝŶŐŵŽĚŝĨŝĐĂƚŝŽŶƐ ͲZĞƋƵŝƌĞƐŵŽĚŝĨŝĐĂƚŝŽŶƐƚŽEtƋƵĂĚƌĂŶƚƐŝŐŶĂůƉŽůĞ Ͳ^ĞƉĂƌĂƚĞůĞĨƚͲƚƵƌŶͬƚŚƌŽƵŐŚͬƌŝŐŚƚͲƚƵƌŶůĂŶĞƐǁĞƌĞĐŽŶƐŝĚĞƌĞĚ͕ďƵƚƚŚĞĨůĞdžŝďŝůŝƚLJŽĨĨĞƌĞĚďLJƚŚĞĞdžŝƐƚŝŶŐƐŚĂƌĞĚ ƚŚƌŽƵŐŚͬƌŝŐŚƚͲƚƵƌŶůĂŶĞŵŝŶŝŵŝnjĞƐƉŽƚĞŶƚŝĂůĨŽƌůĞŶŐƚŚLJƐŽƵƚŚďŽƵŶĚƋƵĞƵĞƐĚƵƌŝŶŐƉĞĂŬŚŽƵƌƐ͘ $OWHUQDWLYH'ULYHZD\$FFHVV5HVWULFWLRQV ĞƐĐƌŝƉƚŝŽŶ WƌŽƐĂŶĚŽŶƐ KƉĞƌĂƚŝŽŶƐǀĂůƵĂƚŝŽŶ ĞƐŝŐŶŽŶƐŝĚĞƌĂƚŝŽŶ /ŶĐůƵĚĞƐĂůůůƚĞƌŶĂƚŝǀĞƐϬͬϭͬϮͬϯ ŝŵƉƌŽǀĞŵĞŶƚƐŝŶĂĚĚŝƚŝŽŶƚŽƌĞĐŽŶĨŝŐƵƌŝŶŐ ďŽƚŚƚŚĞŶƚĞƌƉƌŝƐĞͬŝŐKdŝƌĞƐͬƌďLJ͛ƐĂŶĚ ^ŚĂŶŶŽŶ^ƋƵĂƌĞĚƌŝǀĞǁĂLJƐƚŽ^Z/ZK ŽƉĞƌĂƚŝŽŶ͕ĂŶĚƚŚĞĞdžƚĞŶƐŝŽŶŽĨƚŚĞE ƌŝŐŚƚͲƚƵƌŶůĂŶĞĂƚƚŚĞ/ͲϲϵϰZĂŵƉ ŝŶƚĞƌƐĞĐƚŝŽŶ͘ WƌŽƐ͗ ϭ͘/ŵƉƌŽǀĞƐƚƌĂĨĨŝĐƐĂĨĞƚLJďLJĞůŝŵŝŶĂƚŝŶŐƵŶƐŝŐŶĂůŝnjĞĚůĞĨƚͲƚƵƌŶŵŽǀĞŵĞŶƚƐĨƌŽŵƐŝĚĞͲƐƚƌĞĞƚƐ Ϯ͘DŝŶŝŵŝnjĞƐƉŽƚĞŶƚŝĂůĨŽƌEƚŚƌŽƵŐŚŵŽǀĞŵĞŶƚƋƵĞƵĞƐƚŽďůŽĐŬĂĐĐĞƐƐƚŽƚŚĞEƌŝŐŚƚͲƚƵƌŶůĂŶĞ ŽŶƐ͗ ϭ͘^ůŝŐŚƚŝŶĐƌĞĂƐĞŝŶĚĞůĂLJĨŽƌƐŝĚĞͲƐƚƌĞĞƚŵŽǀĞŵĞŶƚƐĂƚƐŝŐŶĂůŝnjĞĚŝŶƚĞƌƐĞĐƚŝŽŶƐ Ϯ͘WŽƚĞŶƚŝĂůƚŽŝŶƚƌŽĚƵĐĞ^ƚŽEhͲƚƵƌŶŵĂŶĞƵǀĞƌƐĂƚƚŚĞZŝŶƚĞƌƐĞĐƚŝŽŶ KǀĞƌĂůů/ŶƚĞƌƐĞĐƚŝŽŶ>K^ͬĞůĂLJ;ϮϬϰϬWDͿ͗ >ĞdžŝŶŐƚŽŶͬdĂƌŐĞƚ^ŽƵƚŚ͗>K^ͬϳ͘ϴ >ĞdžŝŶŐƚŽŶͬ'ƌĞLJ&Ždž͗>K^ͬϮϭ͘Ϭ KƉĞƌĂƚŝŽŶƐǀĂůƵĂƚŝŽŶ,ŝŐŚůŝŐŚƚ͗ ^ůŝŐŚƚŝŶĐƌĞĂƐĞŝŶĚĞůĂLJĨŽƌƐŝĚĞͲƐƚƌĞĞƚŵŽǀĞŵĞŶƚƐĂƚ ƐŝŐŶĂůŝnjĞĚŝŶƚĞƌƐĞĐƚŝŽŶƐ͕ƚŚŽƵŐŚŝŵƉƌŽǀĞĚƐĂĨĞƚLJĂƚ ƵŶƐŝŐŶĂůŝnjĞĚŝŶƚĞƌƐĞĐƚŝŽŶƐ ͲZĂŝƐĞĚŵĞĚŝĂŶƚŚƌŽƵŐŚŽƵƚƚŚĞ>ĞdžŝŶŐƚŽŶǀĞŶƵĞĐŽƌƌŝĚŽƌǁŽƵůĚƉƌĞǀĞŶƚŵŽƚŽƌŝƐƚƐĨƌŽŵŵĂŬŝŶŐůĞĨƚͲƚƵƌŶƐĨƌŽŵ ƚŚĞƐŝĚĞͲƐƚƌĞĞƚƐĂƚƵŶƐŝŐŶĂůŝnjĞĚŝŶƚĞƌƐĞĐƚŝŽŶƐ $OWHUQDWLYH'ULYHZD\$FFHVV&ORVXUHV ĞƐĐƌŝƉƚŝŽŶ WƌŽƐĂŶĚŽŶƐ KƉĞƌĂƚŝŽŶƐǀĂůƵĂƚŝŽŶ ĞƐŝŐŶŽŶƐŝĚĞƌĂƚŝŽŶ /ŶĐůƵĚĞƐĂůůůƚĞƌŶĂƚŝǀĞƐϬͬϭͬϮͬϯͬϰ ŝŵƉƌŽǀĞŵĞŶƚƐŝŶĂĚĚŝƚŝŽŶƚŽƌĞŵŽǀŝŶŐ ĂĐĐĞƐƐƚŽďŽƚŚƚŚĞŶƚĞƌƉƌŝƐĞͬŝŐK dŝƌĞƐͬƌďLJ͛ƐĂŶĚ^ŚĂŶŶŽŶ^ƋƵĂƌĞ ĚƌŝǀĞǁĂLJƐ͕ĂƐǁĞůůĂƐƚŚĞĂĚĚŝƚŝŽŶŽĨĂ^ ƌŝŐŚƚͲƚƵƌŶůĂŶĞĂƚdĂƌŐĞƚ^ŽƵƚŚ͘ WƌŽƐ͗ ϭ͘&ƵƌƚŚĞƌŝŵƉƌŽǀĞƐƚƌĂĨĨŝĐƐĂĨĞƚLJďLJĞůŝŵŝŶĂƚŝŶŐĚƌŝǀĞǁĂLJƐ;ƉŽƚĞŶƚŝĂůĐŽŶĨůŝĐƚƉŽŝŶƚƐͿĂůŽŶŐ>ĞdžŝŶŐƚŽŶǀĞŶƵĞ Ϯ͘ůůŽǁƐĨŽƌŝŵƉƌŽǀĞĚ>ĞdžŝŶŐƚŽŶǀĞŶƵĞĐŽƌƌŝĚŽƌƚŚƌŽƵŐŚƉƵƚďLJŽƉƚŝŵŝnjŝŶŐƐŝŐŶĂůƚŝŵŝŶŐĨŽƌEͬ^ŵŽǀĞŵĞŶƚƐ ŽŶƐ͗ ϭ͘^ůŝŐŚƚŝŶĐƌĞĂƐĞŝŶĚĞůĂLJĨŽƌƐŝĚĞͲƐƚƌĞĞƚŵŽǀĞŵĞŶƚƐĂƚƐŝŐŶĂůŝnjĞĚŝŶƚĞƌƐĞĐƚŝŽŶƐ KǀĞƌĂůů/ŶƚĞƌƐĞĐƚŝŽŶ>K^ͬĞůĂLJ;ϮϬϰϬWDͿ͗ >ĞdžŝŶŐƚŽŶͬdĂƌŐĞƚ^ŽƵƚŚ͗>K^ͬϲ͘ϳ >ĞdžŝŶŐƚŽŶͬ'ƌĞLJ&Ždž͗>K^ͬϭϱ͘ϲ KƉĞƌĂƚŝŽŶƐǀĂůƵĂƚŝŽŶ,ŝŐŚůŝŐŚƚ͗ ^ůŝŐŚƚŝŶĐƌĞĂƐĞŝŶĚĞůĂLJĨŽƌƐŝĚĞͲƐƚƌĞĞƚŵŽǀĞŵĞŶƚƐĂƚ ƐŝŐŶĂůŝnjĞĚŝŶƚĞƌƐĞĐƚŝŽŶƐ͕ƚŚŽƵŐŚŝŵƉƌŽǀĞĚƐĂĨĞƚLJĂƚ ƵŶƐŝŐŶĂůŝnjĞĚŝŶƚĞƌƐĞĐƚŝŽŶƐ ͲZĞƋƵŝƌĞƐĂĚĚŝƚŝŽŶĂůǁŝĚƚŚĂƚdĂƌŐĞƚ^ŽƵƚŚŝŶƚĞƌƐĞĐƚŝŽŶƚŽĂĐĐŽŵŵŽĚĂƚĞ^ƌŝŐŚƚͲƚƵƌŶůĂŶĞ Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 36 April 18, 2019 4.5 Selection of Preferred Alternative Based on the preliminary alternatives analysis, geometric considerations evaluated, preliminary comparison matrix, and discussion with Ramsey County, the City of Arden Hills, and the City of Shoreview, Alternative 4 was selected for detailed evaluation with the inclusion of a southbound right-turn lane at Grey Fox Road (listed under Alternative 5). 4.6 Preferred Alternative Analysis The goal of the preferred alternative analysis is to evaluate in greater detail the selected improvements and to present the key decision-making factors that aid in developing the study recommendations. Key elements of the preferred alternative analysis include: x Operational analysis of the forecast year 2040 a.m., midday, and p.m. peak hours x Document key decision-making factors 4.6.1 Preferred Alternative Traffic Operations Analysis In addition to the year 2040 p.m. peak hour already analyzed under the preliminary alternatives traffic operations analysis, the year 2040 a.m. and midday peak hours were analyzed using Synchro/SimTraffic software. Results of the preferred alternative traffic operations analysis shown in Table 11 indicate that each study intersection is expected to operate at LOS C or better during the year 2040 peak hours, except the Lexington Avenue / CR E intersection which operates at LOS D during the p.m. peak hour. Detailed operations and queuing analysis results are presented in Appendix A. Table 11. Operations Analysis Summary – Preferred Alternative (Forecast Year 2040) Lexington Avenue & Red Fox Road B / C 11.7 / 28.8 C / D 25.2 / 36.3 C / D 26.9 / 44.5 Lexington Avenue & Lexington Station Lexington Avenue & Target South Lexington Avenue & Enterprise/Big O Tires/Arby's A / B 0.6 / 10.1 A / A 1.3 / 9.6 A / B 1.3 / 11.4 Lexington Avenue & Grey Fox Road A / C 6.8 / 29.3 B / D 16.7 / 38.8 C / D 20.0 / 43.4 Lexington Avenue & Shannon Square A / A 2.0 / 6.2 A / B 3.6 / 10.6 A / C 4.9 / 17.1 Lexington Avenue & CR E C / C 22.9 / 35.0 C / D 27.5 / 44.1 D / E 42.7 / 62.2 Overall Intersection LOS / Worst Approach LOS Overall Intersection Delay / Worst Approach Delay A /D 8.2 /30.111.5 /34.0A/D 3.4 /28.8 B /D Intersection AM Peak Hour MID Peak Hour PM Peak Hour LOS Delay (s)LOS Delay (s)LOS Delay (s) Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 37 April 18, 2019 Key delay and queuing observations include the following: Lexington Avenue & Red Fox Road Results of the preferred alternative traffic operations analysis indicate that the Lexington Avenue / Red Fox Road intersection is expected to operate at overall LOS C or better under the forecast year 2040 peak hour traffic volumes. In addition, southbound queuing is expected to be significantly improved with the addition of dual southbound left-turn lanes. Furthermore, westbound queuing is expected to be improved with the addition of a westbound right-turn overlap with the southbound left-turn signal phase. Lexington Avenue & Target South Results of the preferred alternative traffic operations analysis indicate that the Lexington Avenue / Target South intersection is expected to operate at overall LOS B or better under the forecast year 2040 peak hour traffic volumes. However, eastbound queuing should be considered if/when Lexington Station and Enterprise/Big O Tires/Arby’s driveways are consolidated at the Target South intersection. Lexington Avenue & Grey Fox Road Results of the preferred alternative traffic operations analysis indicate that the Lexington Avenue / Grey Fox Road intersection is expected to operate at overall LOS C or better under the forecast year 2040 peak hour traffic volumes. It should be noted that side-street operations are somewhat dependent on the driveway configuration at Shannon Square, with RIRO or full closure resulting in slight increases in side-street delay at Grey Fox Road. Lexington Avenue & County Road E Results of the preferred alternative traffic operations analysis indicate that the Lexington Avenue / CR E intersection is expected to operate at overall LOS D or better under the forecast year 2040 peak hour traffic volumes. With the reconfiguration of the westbound approach to allow concurrent EB/WB left-turn movements and removal of split signal phasing, overall delay and queuing are expected to be improved. Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 38 April 18, 2019 4.6.2 Key Decision Factors Operations were improved across all peak hours. Key decision factors for each intersection are: Lexington Avenue & Red Fox Road At the Lexington Avenue / Red Fox Road intersection where the southbound approach was the primary concern (southbound left-turns in particular), expanding the intersection to accommodate dual southbound left-turn lanes was a key factor in managing queues. Additional operational benefits are achieved through the separation of left-turn/through/right-turn movements into dedicated lanes, while providing permissive FYA left-turn operations for all approaches during off-peak hours. An additional improvement recommended in conjunction with the dual SB left-turn lanes involves extending the eastbound Red Fox Road right-turn lane trap approximately 265 feet east to the second Target driveway, thus minimizing potential merging conflicts. However, it should be noted that this recommended improvement is not expected to be implemented as part of the Lexington Avenue reconstruction. Therefore, operational and safety performance along eastbound Red Fox Road should continue to be monitored, and the recommended lane extension made in the future if performance is determined to be inadequate. Lexington Avenue & Target South At the Lexington Avenue / Target South intersection where side-street operations were the primary concern, the installation of a new traffic signal facilitated operational and safety improvements. Furthermore, consolidating the Lexington Station and Enterprise/Big O Tires/Arby’s driveways to oppose Target South would further improve safety along the Lexington Avenue corridor. Lexington Avenue & Grey Fox Road At the Lexington Avenue / Grey Fox Road intersection, improving side-street operations while also improving coordination along the Lexington Avenue corridor was the key factor in restriping and resigning the eastbound/westbound lane geometry. These operational improvements allowed consideration of access restrictions at the Shannon Square driveway to the south. Lexington Avenue & County Road E At the Lexington Avenue / CR E intersection, eliminating eastbound/westbound split signal phasing while providing protective/permissive FYA left-turn operations for the entire intersection was a key factor in improving operations. Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 39 April 18, 2019 5.0 Conclusions/Recommendations The selection of a preferred alternative for the Lexington Avenue corridor was made based upon discussions with Ramsey County, the City of Arden Hills, and the City of Shoreview as well as results of the analysis herein and consideration of key decision factors. For reference, a concept layout detailing the preferred alternative and final recommended geometrics at each intersection is included in Appendix C. The key conclusions for the recommended preferred alternative are documented as follows: Overall Improvements x Replace traffic signal infrastructure as needed throughout the Lexington Avenue corridor from the I-694 WB Ramp Terminal (north end) intersection through CR E (south end) x Update signal timing throughout the Lexington Avenue corridor from CR F (north end) through CR E (south end) o Provide FYA left-turn operations o Provide a leading pedestrian interval (LPI) upon actuation at all signalized intersections to improve pedestrian visibility/comfort x Replace existing continuous TWLTL with a raised median throughout the Lexington Avenue corridor from Red Fox Road (north end) to CR E (south end) o Provide pocket left-turn lanes at all signalized intersections Pedestrian/Bicycle Improvements x The existing mixed-use path along the east side of Lexington Avenue will be maintained for the entire length of the corridor x Sidewalk will be installed along the west side of Lexington Avenue, connecting the existing two sidewalk segments, to provide pedestrian access starting at Red Fox Road and extending south beyond CR E x LPI at all signalized intersections, as previously noted Transit Improvements x The existing bus stops along Lexington Avenue will be maintained or relocations will be coordinated with Metro Transit x Under the proposed roadway layout, bus stops that were previously located in through lanes could now be located in dedicated right-turn lanes at the following intersections: o Lexington Avenue & Red Fox Road o Lexington Avenue & Target South (northbound only) ƒ If added, a southbound stop could be located in a dedicated right-turn lane o Lexington Avenue & Grey Fox Road Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 40 April 18, 2019 Lexington Avenue & Red Fox Road Proposed improvements: x Add a dedicated EB right-turn lane x Add a dedicated SB right-turn lane x Add dual SB left-turn lanes x Modify signal timing to provide WB right-turn overlap with SB left-turn movement x Extend NB right-turn lane at I-694 EB Ramp Intersection to the Exxon gas station driveway Key benefits include: x Provides significant operational benefit during peak and non-peak periods o Expected to operate at overall LOS C or better under forecast year 2040 conditions o Southbound 95th percentile queuing is expected to be significantly improved compared to Alternative 0, especially during the p.m. peak hour (No Build – 480 feet, Alternative 0 – 425 feet, Preferred Alternative – 272 feet) x Provides flexibility for protective/permissive, protected only, or permissive only operation as determined through a FYA assessment analysis x Protective only phasing for the dual SB left-turn lanes during peak periods is likely to reduce crashes previously associated with poor gap selection under protective/permissive “green ball” operation Key design considerations include: x Reconstruction of the southbound approach is required x Provide four-section left-turn heads with FYA indications on all approaches o Operate the NB/SB left-turn movements protected only all day except for overnight periods or as deemed appropriate through a FYA assessment analysis Future considerations include: x Monitor operational and safety performance along EB Red Fox Road o If performance is determined to be inadequate, consider extending the EB right-turn lane trap approximately 265 feet east to the second Target driveway to minimize potential merging conflicts. Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 41 April 18, 2019 Lexington Avenue & Target South Proposed improvements: x Relocate Lexington Station access to align with new Target South signal x Add a dedicated NB right-turn lane x Add a dedicated SB right-turn lane x Modify Enterprise / Big O Tires / Arby’s driveway to RIRO access Key benefits include: x Provides significant operational benefit during peak and non-peak periods o Expected to operate at overall LOS B or better under forecast year 2040 conditions o Improves side-street delay and queuing x Provides flexibility for protective/permissive, protected only, or permissive only operation as determined through a FYA assessment analysis Key design considerations include: x Construction of an eastbound approach is required to connect to Lexington Station, in addition to the installation of a new traffic signal system x Provide four-section left-turn heads with FYA indications on all approaches o Operate the NB/SB left-turn movements protective/permissive all day except for overnight periods o Operate the EB/WB left-turn movements as permissive only all day Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 42 April 18, 2019 Lexington Avenue & Grey Fox Road Proposed improvements: x Add a dedicated SB right-turn lane x Modify Shannon Square driveway to RIRO access x Modification of EB/WB lane geometry to provide a dedicated left-turn lane and shared through / right-turn lane Key benefits include: x Provides operational benefit during peak and non-peak periods o Expected to operate at overall LOS C or better under forecast year 2040 conditions o Improves side-street delay and queuing x Provides flexibility for protective/permissive, protected only, or permissive only operation as determined through a FYA assessment analysis Key design considerations include: x Provide four-section left-turn heads with FYA indications on all approaches o Operate the NB/SB left-turn movements protective/permissive all day except for overnight periods o Operate the EB/WB left-turn movements protective/permissive between 7 a.m. – 7 p.m. x Potentially eliminate access to Shannon Square to further improve safety along the corridor by removing intermediate access and conflict points between signals Traffic Study Lexington Avenue Reconstruction Alliant No. 118-0186.0 43 April 18, 2019 Lexington Avenue & County Road E Proposed improvements: x Modify the WB approach median to offset the left-turn lane further south Key benefits include: x Provides operational benefit during peak and non-peak periods o Expected to operate at overall LOS D or better under forecast year 2040 conditions x Eliminates EB/WB split phase signal timing x Provides flexibility for protective/permissive, protected only, or permissive only operation as determined through a FYA assessment analysis Key design considerations include: x Reconstruction of the westbound approach is required in addition to restriping and resigning east of the intersection x Requires a new 55-foot mast arm in addition to a 5-foot mast arm extender for the WB traffic signal indications (NW quadrant signal pole) x Provide four-section left-turn heads with FYA indications on all approaches o Operate the EB/WB left-turn movements as protected only all day except for overnight periods or as deemed appropriate through a FYA assessment analysis o Operate the NB/SB left-turn movements as protective/permissive all day except for overnight periods Optional Improvements Additional improvements that are not warranted based on operational and safety analyses but may be included as part of the overall reconstruction of the Lexington Avenue corridor include: x Add a dedicated NB right-turn lane at Grey Fox Road x A three-quarter access at the Shannon Square driveway is acceptable if RIRO access is not feasible (EB left-turns prohibited) 7UDIILF6WXG\ /H[LQJWRQ$YHQXH5HFRQVWUXFWLRQ    $OOLDQW1R$                   $SSHQGL[$ 'HWDLOHG,QWHUVHFWLRQ2SHUDWLRQV$QDO\VLV  >ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ/ͲϲϵϰtZĂŵƉƐ  ͬ  Ϯϯ͘ϯ ͬ ϯϴ͘ϴ  ͬ  ϭϵ͘ϭ ͬ Ϯϵ͘Ϯ  ͬ  Ϯϯ͘ϲ ͬ ϯϰ͘ϵ >ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ/ͲϲϵϰZĂŵƉƐ  ͬ  Ϯϯ͘Ϯ ͬ ϯϴ͘Ϯ  ͬ  ϭϰ͘ϳ ͬ ϮϮ͘ϲ  ͬ  ϭϵ͘ϳ ͬ Ϯϵ͘Ϭ >ĞdžŝŶŐƚŽŶǀĞŶƵĞΘZĞĚ&ŽdžZŽĂĚ  ͬ  ϭϭ͘ϱ ͬ Ϯϵ͘ϲ  ͬ  ϮϮ͘ϳ ͬ Ϯϴ͘ϵ  ͬ  Ϯϵ͘ϵ ͬϯϵ͘ϴ >ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ>ĞdžŝŶŐƚŽŶ^ƚĂƚŝŽŶ  ͬ  ϭ͘ϰ ͬ ϳ͘ϴ  ͬ & ϮϬ͘ϲ ͬ ϮϬϴ͘ϳ  ͬ &ϴ͘ϵ ͬ ϭϬϵ͘ϵ >ĞdžŝŶŐƚŽŶǀĞŶƵĞΘdĂƌŐĞƚ^ŽƵƚŚ  ͬ  Ϭ͘ϲ ͬ ϭϮ͘ϱ  ͬ & ϭϬ͘Ϯ ͬ ϵϯ͘ϵ  ͬ & ϰ͘ϲ ͬ ϲϱ͘Ϯ >ĞdžŝŶŐƚŽŶǀĞŶƵĞΘŶƚĞƌƉƌŝƐĞͬŝŐKdŝƌĞƐͬƌďLJΖƐ  ͬ  Ϭ͘ϳ ͬ ϭϭ͘ϱ  ͬ  Ϯ͘ϱ ͬ ϰϴ͘ϱ  ͬ  ϭ͘ϰ ͬ ϭϱ͘ϵ >ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ'ƌĞLJ&ŽdžZŽĂĚ  ͬ  ϲ͘ϰ ͬ ϯϭ͘ϰ  ͬ  ϵ͘ϰ ͬ Ϯϲ͘ϵ  ͬ  ϭϰ͘ϭ ͬ ϯϬ͘ϵ >ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ^ŚĂŶŶŽŶ^ƋƵĂƌĞ  ͬ  Ϯ͘ϱ ͬ ϴ͘Ϭ  ͬ  ϰ͘ϰ ͬ ϭϲ͘Ϯ  ͬ  ϱ͘ϴ ͬ ϮϬ͘ϳ >ĞdžŝŶŐƚŽŶǀĞŶƵĞΘZ  ͬ  Ϯϭ͘ϰ ͬ ϯϮ͘ϳ  ͬ  Ϯϭ͘ϯ ͬ ϯϭ͘Ϭ  ͬ  ϰϬ͘ϵ ͬ ϱϯ͘Ϯ >ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ/ͲϲϵϰtZĂŵƉƐ  ͬ  ϮϮ͘ϭ ͬ ϯϰ͘ϵ  ͬ  ϮϬ͘ϭ ͬ ϯϮ͘Ϭ  ͬ  Ϯϰ͘ϳ ͬ ϯϲ͘ϳ >ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ/ͲϲϵϰZĂŵƉƐ  ͬ  ϮϬ͘ϯ ͬ ϯϬ͘ϲ  ͬ  ϭϱ͘ϭ ͬ Ϯϯ͘ϲ  ͬ  ϮϬ͘Ϭ ͬ Ϯϳ͘ϯ >ĞdžŝŶŐƚŽŶǀĞŶƵĞΘZĞĚ&ŽdžZŽĂĚ  ͬ  ϭϭ͘ϲ ͬ ϯϬ͘Ϯ  ͬ  Ϯϯ͘ϴ ͬ Ϯϴ͘ϭ  ͬ  ϯϯ͘ϳ ͬϰϴ͘Ϯ >ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ>ĞdžŝŶŐƚŽŶ^ƚĂƚŝŽŶ  ͬ  ϭ͘ϰ ͬ ϳ͘ϯ  ͬ & ϯϬ͘ϯ ͬ Ϯϵϰ͘ϲ  ͬ &ϮϮ͘ϳ ͬ ϯϭϭ͘Ϭ >ĞdžŝŶŐƚŽŶǀĞŶƵĞΘdĂƌŐĞƚ^ŽƵƚŚ  ͬ  Ϭ͘ϲ ͬ ϭϯ͘Ϭ  ͬ & ϲ͘ϯ ͬ ϱϲ͘ϳ  ͬ & ϱ͘ϳ ͬ ϴϭ͘ϴ >ĞdžŝŶŐƚŽŶǀĞŶƵĞΘŶƚĞƌƉƌŝƐĞͬŝŐKdŝƌĞƐͬƌďLJΖƐ  ͬ  Ϭ͘ϲ ͬ ϭϬ͘ϳ  ͬ & Ϯ͘ϰ ͬ ϱϬ͘ϭ  ͬ  ϭ͘ϱ ͬ Ϯϯ͘Ϯ >ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ'ƌĞLJ&ŽdžZŽĂĚ  ͬ  ϲ͘ϳ ͬ ϯϬ͘Ϯ  ͬ  ϭϬ͘Ϭ ͬ Ϯϴ͘ϲ  ͬ  ϭϯ͘ϯ ͬϮϵ͘Ϯ >ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ^ŚĂŶŶŽŶ^ƋƵĂƌĞ  ͬ  Ϯ͘ϲ ͬ ϭϬ͘ϰ  ͬ  ϰ͘ϰ ͬ ϭϴ͘Ϭ  ͬ  ϳ͘ϴ ͬ ϰϯ͘ϲ >ĞdžŝŶŐƚŽŶǀĞŶƵĞΘZ  ͬ  Ϯϭ͘ϴ ͬ ϯϮ͘ϰ  ͬ  Ϯϭ͘Ϯ ͬ ϯϭ͘ϭ  ͬ  ϰϯ͘Ϭ ͬ ϱϮ͘ϰ >ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ/ͲϲϵϰtZĂŵƉƐ  ͬ & ϯϴ͘Ϭ ͬ ϴϭ͘Ϯ  ͬ  ϮϮ͘Ϯ ͬ ϯϰ͘Ϭ  ͬ & ϱϰ͘ϰ ͬ ϵϴ͘ϳ >ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ/ͲϲϵϰZĂŵƉƐ  ͬ  Ϯϲ͘ϳ ͬ ϰϱ͘Ϭ  ͬ  ϭϴ͘Ϯ ͬ ϯϮ͘ϳ  ͬ & ϱϭ͘ϱ ͬ ϮϬϱ͘ϵ >ĞdžŝŶŐƚŽŶǀĞŶƵĞΘZĞĚ&ŽdžZŽĂĚ  ͬ  ϭϯ͘ϲ ͬ Ϯϵ͘ϳ  ͬ  ϯϬ͘ϭ ͬ ϯϲ͘ϴ  ͬ  ϱϴ͘ϭ ͬϳϵ͘Ϯ >ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ>ĞdžŝŶŐƚŽŶ^ƚĂƚŝŽŶ  ͬ  ϭ͘ϳ ͬ ϭϬ͘ϰ & ͬ & ϭϬϮ͘Ϯ ͬ хϯϬϬ &ͬ & ϭϬϴ͘ϵ ͬ хϯϬϬ >ĞdžŝŶŐƚŽŶǀĞŶƵĞΘdĂƌŐĞƚ^ŽƵƚŚ  ͬ  Ϭ͘ϳ ͬ ϮϬ͘ϭ  ͬ & Ϯϰ͘ϳ ͬ Ϯϯϱ͘Ϭ  ͬ & ϮϬ͘ϰ ͬхϯϬϬ >ĞdžŝŶŐƚŽŶǀĞŶƵĞΘŶƚĞƌƉƌŝƐĞͬŝŐKdŝƌĞƐͬƌďLJΖƐ  ͬ  Ϭ͘ϳ ͬ ϭϮ͘ϯ  ͬ  Ϯ͘ϱ ͬ ϰϭ͘ϱ  ͬ & ϳ͘ϱ ͬ ϭϬϵ͘ϵ >ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ'ƌĞLJ&ŽdžZŽĂĚ  ͬ  ϲ͘ϲ ͬ ϯϭ͘ϳ  ͬ  ϭϬ͘ϲ ͬ Ϯϲ͘ϲ  ͬ & Ϯϱ͘ϱ ͬϵϰ͘ϴ >ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ^ŚĂŶŶŽŶ^ƋƵĂƌĞ  ͬ  Ϯ͘ϳ ͬ ϭϭ͘ϭ  ͬ  ϲ͘ϰ ͬ ϯϰ͘ϵ  ͬ  ϴ͘ϲ ͬ ϰϭ͘ϱ >ĞdžŝŶŐƚŽŶǀĞŶƵĞΘZ  ͬ  Ϯϯ͘ϰ ͬ ϯϯ͘ϱ  ͬ  ϮϮ͘ϵ ͬ ϯϮ͘Ϯ  ͬ  ϱϰ͘ϱ ͬ ϳϬ͘Ϯ KǀĞƌĂůů/ŶƚĞƌƐĞĐƚŝŽŶ>K^ͬtŽƌƐƚƉƉƌŽĂĐŚ>K^ KǀĞƌĂůů/ŶƚĞƌƐĞĐƚŝŽŶĞůĂLJͬtŽƌƐƚƉƉƌŽĂĐŚĞůĂLJ KǀĞƌĂůů/ŶƚĞƌƐĞĐƚŝŽŶ>K^ͬtŽƌƐƚƉƉƌŽĂĐŚ>K^ KǀĞƌĂůů/ŶƚĞƌƐĞĐƚŝŽŶĞůĂLJͬtŽƌƐƚƉƉƌŽĂĐŚĞůĂLJ zĞĂƌϮϬϮϬEŽƵŝůĚͲDĞĂƐƵƌĞƐŽĨĨĨĞĐƚŝǀĞŶĞƐƐ^ƵŵŵĂƌLJ /ŶƚĞƌƐĞĐƚŝŽŶ DWĞĂŬ,ŽƵƌ >K^ ĞůĂLJ;ƐͿ >K^ ĞůĂLJ;ƐͿ D/WĞĂŬ,ŽƵƌ >K^ ĞůĂLJ;ƐͿ >y/E'dKEsEhDK džŝƐƚŝŶŐzĞĂƌϮϬϭϴͲDĞĂƐƵƌĞƐŽĨĨĨĞĐƚŝǀĞŶĞƐƐ^ƵŵŵĂƌLJ /ŶƚĞƌƐĞĐƚŝŽŶ DWĞĂŬ,ŽƵƌ WDWĞĂŬ,ŽƵƌ WDWĞĂŬ,ŽƵƌ >K^ ĞůĂLJ;ƐͿ >K^ ĞůĂLJ;ƐͿ D/WĞĂŬ,ŽƵƌ >K^ ĞůĂLJ;ƐͿ KǀĞƌĂůů/ŶƚĞƌƐĞĐƚŝŽŶ>K^ͬtŽƌƐƚƉƉƌŽĂĐŚ>K^ KǀĞƌĂůů/ŶƚĞƌƐĞĐƚŝŽŶĞůĂLJͬtŽƌƐƚƉƉƌŽĂĐŚĞůĂLJ zĞĂƌϮϬϰϬEŽƵŝůĚͲDĞĂƐƵƌĞƐŽĨĨĨĞĐƚŝǀĞŶĞƐƐ^ƵŵŵĂƌLJ /ŶƚĞƌƐĞĐƚŝŽŶ DWĞĂŬ,ŽƵƌ WDWĞĂŬ,ŽƵƌ >K^ ĞůĂLJ;ƐͿ >K^ ĞůĂLJ;ƐͿ D/WĞĂŬ,ŽƵƌ >K^ ĞůĂLJ;ƐͿ >ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ/ͲϲϵϰtZĂŵƉƐ  ͬ  ϯϬ͘ϯ ͬ ϲϬ͘ϵ  ͬ  Ϯϲ͘Ϯ ͬ ϰϱ͘ϰ  ͬ  Ϯϴ͘ϳ ͬ ϱϯ͘ϭ >ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ/ͲϲϵϰZĂŵƉƐ  ͬ  Ϯϰ͘ϵ ͬ ϲϳ͘Ϯ  ͬ  Ϯϭ͘ϭ ͬ ϱϬ͘ϲ  ͬ  Ϯϭ͘Ϯ ͬ ϰϭ͘ϯ >ĞdžŝŶŐƚŽŶǀĞŶƵĞΘZĞĚ&ŽdžZŽĂĚ  ͬ  ϯϰ͘ϳ ͬ ϰϳ͘ϵ  ͬ  ϯϰ͘ϲ ͬ ϱϮ͘ϳ  ͬ  Ϯϴ͘ϱ ͬϰϮ͘ϰ >ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ>ĞdžŝŶŐƚŽŶ^ƚĂƚŝŽŶ >ĞdžŝŶŐƚŽŶǀĞŶƵĞΘdĂƌŐĞƚ^ŽƵƚŚ >ĞdžŝŶŐƚŽŶǀĞŶƵĞΘŶƚĞƌƉƌŝƐĞͬŝŐKdŝƌĞƐͬƌďLJΖƐ  ͬ  ϭ͘ϴ ͬ ϮϬ͘ϭ  ͬ  ϭ͘ϱ ͬ ϮϬ͘ϴ  ͬ  ϭ͘ϱ ͬ ϮϬ͘ϱ >ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ'ƌĞLJ&ŽdžZŽĂĚ  ͬ  ϭϳ͘Ϭ ͬ ϰϭ͘ϭ  ͬ  ϭϱ͘ϱ ͬ ϰϮ͘ϳ  ͬ  ϭϲ͘ϱ ͬ ϰϭ͘ϯ >ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ^ŚĂŶŶŽŶ^ƋƵĂƌĞ  ͬ  ϲ͘ϵ ͬ Ϯϴ͘ϯ  ͬ  ϲ͘ϴ ͬ ϯϮ͘ϭ  ͬ  ϴ͘Ϭ ͬ ϰϳ͘ϱ >ĞdžŝŶŐƚŽŶǀĞŶƵĞΘZ  ͬ  ϰϴ͘ϴ ͬ ϳϰ͘ϱ  ͬ  ϰϴ͘ϴ ͬ ϳϰ͘ϱ  ͬ  ϰϴ͘ϴ ͬ ϳϰ͘ϱ >ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ/ͲϲϵϰtZĂŵƉƐ  ͬ  Ϯϴ͘Ϯ ͬ ϰϲ͘Ϭ  ͬ  ϯϬ͘Ϯ ͬ ϱϴ͘ϴ  ͬ  Ϯϱ͘Ϭ ͬ ϰϱ͘ϰ >ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ/ͲϲϵϰZĂŵƉƐ  ͬ  ϮϬ͘ϵ ͬ ϰϭ͘ϵ  ͬ  Ϯϭ͘ϲ ͬ ϰϰ͘ϭ  ͬ  Ϯϭ͘ϯ ͬ ϰϱ͘ϭ >ĞdžŝŶŐƚŽŶǀĞŶƵĞΘZĞĚ&ŽdžZŽĂĚ  ͬ  Ϯϴ͘ϴ ͬ ϰϳ͘ϵ  ͬ  Ϯϲ͘ϵ ͬ ϰϭ͘ϰ  ͬ  Ϯϳ͘ϴ ͬϰϭ͘ϴ >ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ>ĞdžŝŶŐƚŽŶ^ƚĂƚŝŽŶ >ĞdžŝŶŐƚŽŶǀĞŶƵĞΘdĂƌŐĞƚ^ŽƵƚŚ >ĞdžŝŶŐƚŽŶǀĞŶƵĞΘŶƚĞƌƉƌŝƐĞͬŝŐKdŝƌĞƐͬƌďLJΖƐ  ͬ  Ϯ͘ϭ ͬ ϯϯ͘ϵ  ͬ  ϭ͘ϱ ͬ ϵ͘ϲ >ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ'ƌĞLJ&ŽdžZŽĂĚ  ͬ  ϭϲ͘ϲ ͬ ϰϭ͘Ϯ  ͬ  Ϯϭ͘Ϭ ͬ ϰϭ͘ϴ >ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ^ŚĂŶŶŽŶ^ƋƵĂƌĞ  ͬ & ϴ͘ϱ ͬ ϱϮ͘ϰ  ͬ  ϰ͘ϱ ͬ ϭϱ͘ϲ >ĞdžŝŶŐƚŽŶǀĞŶƵĞΘZ  ͬ  ϰϮ͘ϴ ͬ ϱϲ͘Ϭ  ͬ  ϰϮ͘ϴ ͬ ϱϳ͘ϵ  ͬ  ϰϮ͘Ϯ ͬ ϲϯ͘ϰ >ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ/ͲϲϵϰtZĂŵƉƐ  ͬ  ϯϰ͘ϱ ͬ ϲϰ͘ϳ  ͬ  Ϯϭ͘Ϭ ͬ ϰϳ͘Ϯ  ͬ  Ϯϳ͘ϰ ͬ ϰϵ͘ϱ >ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ/ͲϲϵϰZĂŵƉƐ  ͬ  Ϯϲ͘ϳ ͬ Ϯϴ͘ϳ  ͬ  ϭϵ͘ϰ ͬ ϯϵ͘ϰ  ͬ  ϮϬ͘ϯ ͬ ϯϴ͘ϯ >ĞdžŝŶŐƚŽŶǀĞŶƵĞΘZĞĚ&ŽdžZŽĂĚ  ͬ  ϭϭ͘ϳ ͬ Ϯϴ͘ϴ  ͬ  Ϯϱ͘Ϯ ͬ ϯϲ͘ϯ  ͬ  Ϯϲ͘ϵ ͬϰϰ͘ϱ >ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ>ĞdžŝŶŐƚŽŶ^ƚĂƚŝŽŶ >ĞdžŝŶŐƚŽŶǀĞŶƵĞΘdĂƌŐĞƚ^ŽƵƚŚ >ĞdžŝŶŐƚŽŶǀĞŶƵĞΘŶƚĞƌƉƌŝƐĞͬŝŐKdŝƌĞƐͬƌďLJΖƐ  ͬ  Ϭ͘ϲ ͬ ϭϬ͘ϭ  ͬ  ϭ͘ϯ ͬ ϵ͘ϲ  ͬ  ϭ͘ϯ ͬ ϭϭ͘ϰ >ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ'ƌĞLJ&ŽdžZŽĂĚ  ͬ  ϲ͘ϴ ͬ Ϯϵ͘ϯ  ͬ  ϭϲ͘ϳ ͬ ϯϴ͘ϴ  ͬ  ϮϬ͘Ϭ ͬϰϯ͘ϰ >ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ^ŚĂŶŶŽŶ^ƋƵĂƌĞ  ͬ  Ϯ͘Ϭ ͬ ϲ͘Ϯ  ͬ  ϯ͘ϲ ͬ ϭϬ͘ϲ  ͬ  ϰ͘ϵ ͬ ϭϳ͘ϭ >ĞdžŝŶŐƚŽŶǀĞŶƵĞΘZ  ͬ  ϮϮ͘ϵ ͬ ϯϱ͘Ϭ  ͬ  Ϯϳ͘ϱ ͬ ϰϰ͘ϭ  ͬ  ϰϮ͘ϳ ͬ ϲϮ͘Ϯ KǀĞƌĂůů/ŶƚĞƌƐĞĐƚŝŽŶ>K^ͬtŽƌƐƚƉƉƌŽĂĐŚ>K^ KǀĞƌĂůů/ŶƚĞƌƐĞĐƚŝŽŶĞůĂLJͬtŽƌƐƚƉƉƌŽĂĐŚĞůĂLJ  ͬ  ϴ͘Ϯ ͬ ϯϬ͘ϭϭϭ͘ϱ ͬ ϯϰ͘Ϭ ͬ  ϯ͘ϰ ͬ Ϯϴ͘ϴ  ͬ  zĞĂƌϮϬϰϬƵŝůĚWƌĞĨĞƌƌĞĚůƚĞƌŶĂƚŝǀĞͲDĞĂƐƵƌĞƐŽĨĨĨĞĐƚŝǀĞŶĞƐƐ^ƵŵŵĂƌLJ /ŶƚĞƌƐĞĐƚŝŽŶ DWĞĂŬ,ŽƵƌ D/WĞĂŬ,ŽƵƌ WDWĞĂŬ,ŽƵƌ >K^ ĞůĂLJ;ƐͿ >K^ ĞůĂLJ;ƐͿ >K^ ĞůĂLJ;ƐͿ  ϭϱ͘ϲ ͬ ϰϬ͘ϲ KǀĞƌĂůů/ŶƚĞƌƐĞĐƚŝŽŶ>K^ͬtŽƌƐƚƉƉƌŽĂĐŚ>K^ KǀĞƌĂůů/ŶƚĞƌƐĞĐƚŝŽŶĞůĂLJͬtŽƌƐƚƉƉƌŽĂĐŚĞůĂLJ ϳ͘ϴ ͬ ϯϬ͘ϲ  ͬ  ϲ͘ϳ ͬ ϯϬ͘Ϭ  ͬ  ϴ͘ϯ ͬ ϯϮ͘ϱ  zĞĂƌϮϬϰϬƵŝůĚůƚĞƌŶĂƚŝǀĞƐͲDĞĂƐƵƌĞƐŽĨĨĨĞĐƚŝǀĞŶĞƐƐ^ƵŵŵĂƌLJ /ŶƚĞƌƐĞĐƚŝŽŶ KǀĞƌĂůů/ŶƚĞƌƐĞĐƚŝŽŶ>K^ͬtŽƌƐƚƉƉƌŽĂĐŚ>K^ KǀĞƌĂůů/ŶƚĞƌƐĞĐƚŝŽŶĞůĂLJͬtŽƌƐƚƉƉƌŽĂĐŚĞůĂLJ >dϬ >dϭ >dϮ >K^ ĞůĂLJ;ƐͿ >K^ ĞůĂLJ;ƐͿ >K^ ĞůĂLJ;ƐͿ  ͬ  ϴ͘ϲ ͬ Ϯϵ͘Ϯ  ͬ  ϳ͘ϯ ͬ Ϯϵ͘ϲ ͬ  ϳ͘ϱ ͬ Ϯϵ͘ϱ ϯ͗>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ^ŚĂŶŶŽŶ^ƋƵĂƌĞĐŽŶƐŽůŝĚĂƚĞĚǁŝƚŚ>ĞdžŝŶŐƚŽŶΘ'ƌĞLJ&ŽdžZŽĂĚĨŽƌůƚĞƌŶĂƚŝǀĞϱ ϭ͗>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ>ĞdžŝŶŐƚŽŶ^ƚĂƚŝŽŶĐŽŶƐŽůŝĚĂƚĞĚǁŝƚŚ>ĞdžŝŶŐƚŽŶΘdĂƌŐĞƚ^ŽƵƚŚĨŽƌůƚĞƌŶĂƚŝǀĞƐϬ͕ϭ͕Ϯ͕ϯ͕ϰ͕Θϱ Ϯ͗>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘŶƚĞƌƉƌŝƐĞͬŝŐKdŝƌĞƐͬƌďLJΖƐĐŽŶƐŽůŝĚĂƚĞĚǁŝƚŚ>ĞdžŝŶŐƚŽŶΘdĂƌŐĞƚ^ŽƵƚŚĨŽƌůƚĞƌŶĂƚŝǀĞϱ ͬ zĞĂƌϮϬϰϬƵŝůĚůƚĞƌŶĂƚŝǀĞƐͲDĞĂƐƵƌĞƐŽĨĨĨĞĐƚŝǀĞŶĞƐƐ^ƵŵŵĂƌLJ /ŶƚĞƌƐĞĐƚŝŽŶ >dϯ >dϰ >dϱ >K^ ĞůĂLJ;ƐͿ >K^ ĞůĂLJ;ƐͿ >K^ ĞůĂLJ;ƐͿ ͬ ϮϬϰϬEŽƵŝůĚͲDWĞĂŬ,ŽƵƌ(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK            7RWDO'HOD\ KU             0RYHPHQW/26 ' ' % & & % & % $ % & % &0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW            $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 '$$$$$%$$$$$ $0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW       6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 ''$''$%$$$$$ $0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW            $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 &$$$$$$$$$$$ $0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW       6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 $$$&$$$$$$$$ $0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 '$$$$$$$$$$$ $0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW       6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 &'%''$&$$%%% %0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW            $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 ')&$$$$&$&%$ &0RYHPHQW9ROXPH 0RYHPHQWWK4XHXH IW   6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK            7RWDO'HOD\ KU             0RYHPHQW/26 $$$(()&%$$&$ '0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/26:HVWERXQG$SSURDFK,QWHUVHFWLRQ7RWDO$,QWHUVHFWLRQ7RWDO,QWHUVHFWLRQ7RWDO $$6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDO&6RXWKERXQG$SSURDFK%$$  ,QWHUVHFWLRQ7RWDO(DVWERXQG$SSURDFK$$&  :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘZ  ,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK&&%%,QWHUVHFWLRQ 02( 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDO1RUWKERXQG$SSURDFK6RXWKERXQG$SSURDFK6RXWKERXQG$SSURDFK$6RXWKERXQG$SSURDFK   %$$$>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ'ƌĞLJ&ŽdžZŽĂĚ>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘŶƚĞƌƉƌŝƐĞͬƌďLJΖƐ,QWHUVHFWLRQ,QWHUVHFWLRQ02((DVWERXQG$SSURDFK$,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ>ĞdžŝŶŐƚŽŶ^ƚĂƚŝŽŶ>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘdĂƌŐĞƚ^ŽƵƚŚ$,QWHUVHFWLRQ>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘƵďͬĂǀĂŶŶŝƐ%&)02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK%$$02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK&6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘZĞĚ&ŽdžZŽĂĚ   $%&%,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDO6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ/ͲϲϵϰZĂŵƉƐ   &%'$,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ/ͲϲϵϰtZĂŵƉƐ   ,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK ϮϬϰϬEŽƵŝůĚͲD/WĞĂŬ,ŽƵƌ(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 &&%''&%%%&&% &0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW            $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK            7RWDO'HOD\ KU             0RYHPHQW/26 )$$$$$&$$$$$ $0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 &'$&&$%$$%$$ %0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW            $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 )$$$$$%$$$$$ $0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW       6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 $$$)$)$$$%$$ &0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK            7RWDO'HOD\ KU             0RYHPHQW/26 )$)$$$%$$$$$ )0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK            7RWDO'HOD\ KU             0RYHPHQW/26 ''&''&&'$'%% &0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW            $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK            7RWDO'HOD\ KU             0RYHPHQW/26 '&&$$$$%$'%$ %0RYHPHQW9ROXPH 0RYHPHQWWK4XHXH IW   6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 $$$'%%&$$$&$ &0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/26>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ/ͲϲϵϰtZĂŵƉƐ   $&%&,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ/ͲϲϵϰZĂŵƉƐ   &$%%,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘZĞĚ&ŽdžZŽĂĚ   &'&&,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ>ĞdžŝŶŐƚŽŶ^ƚĂƚŝŽŶ   )$$$,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘdĂƌŐĞƚ^ŽƵƚŚ   $)$$,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘŶƚĞƌƉƌŝƐĞͬƌďLJΖƐ   ($$$,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ'ƌĞLJ&ŽdžZŽĂĚ   &&$$,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDO,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘƵďͬĂǀĂŶŶŝƐ   '$$$   &&%%,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘZ ϮϬϰϬEŽƵŝůĚͲWDWĞĂŬ,ŽƵƌ(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 ((('('''&((' '0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW            $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK            7RWDO'HOD\ KU             0RYHPHQW/26 )$($$$&$$$$$ $0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 ))(&&&%%%%%$ &0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW            $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK            7RWDO'HOD\ KU             0RYHPHQW/26 )$$$$$%%$$$$ $0RYHPHQW9ROXPH 0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 $$$)$)$$$&$$ &0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 )$)$$$&($$$$ )0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 ) & % & & ( ' ) % ) & & (0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW            $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK            7RWDO'HOD\ KU             0RYHPHQW/26 )))$$$$&&&%$ '0RYHPHQW9ROXPH 0RYHPHQWWK4XHXH IW   6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK            7RWDO'HOD\ KU             0RYHPHQW/26 $$$''&%$$$)( '0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/26:HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK 6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDO ('''>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘZ ,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘƵďͬĂǀĂŶŶŝƐ   ($$$>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ'ƌĞLJ&ŽdžZŽĂĚ   )&%%,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘŶƚĞƌƉƌŝƐĞͬƌďLJΖƐ   )$%$,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘdĂƌŐĞƚ^ŽƵƚŚ   $)$$,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ>ĞdžŝŶŐƚŽŶ^ƚĂƚŝŽŶ   )$($,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘZĞĚ&ŽdžZŽĂĚ   (((',QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ/ͲϲϵϰZĂŵƉƐ   )$&%,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ/ͲϲϵϰtZĂŵƉƐ   $&$),QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDO ϮϬϰϬ>dϬͲWDWĞĂŬ,ŽƵƌ(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK           7RWDO'HOD\ KU             0RYHPHQW/26 ( ( ( ' ( ' ' & % ' ' & '0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW            $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK            7RWDO'HOD\ KU             0RYHPHQW/26 )$&$$$'$$$$$ $0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK            7RWDO'HOD\ KU             0RYHPHQW/26 ''&'(%'%$&%$ %0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW            $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK            7RWDO'HOD\ KU             0RYHPHQW/26 ($%$$$%$$$$$ $0RYHPHQW9ROXPH     0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 ) ) & ) ' % & $ $ ' $ $ $0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK           7RWDO'HOD\ KU             0RYHPHQW/26 ('%''&''%(%% &0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW            $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK            7RWDO'HOD\ KU             0RYHPHQW/26 '(($$$$%$'%$ &0RYHPHQW9ROXPH        0RYHPHQWWK4XHXH IW   6WRUDJH%D\'LVWDQFH IW   $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 $$$(((&$$$'& &0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/26$($'1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ/ͲϲϵϰtZĂŵƉƐ  ,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK($%&,QWHUVHFWLRQ7RWDO1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ/ͲϲϵϰZĂŵƉƐ '&'&,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDO:HVWERXQG$SSURDFK>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘZĞĚ&ŽdžZŽĂĚ  ,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK''$$&$$$:HVWERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘdĂƌŐĞƚ^ŽƵƚŚ  ,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘƵďͬĂǀĂŶŶŝƐ,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘŶƚĞƌƉƌŝƐĞͬƌďLJΖƐ '&%%,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ'ƌĞLJ&ŽdžZŽĂĚ,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK'$$$:HVWERXQG$SSURDFK1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK((&&,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘZ  ,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK ϮϬϰϬ>dϭͲWDWĞĂŬ,ŽƵƌ(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 ) ) ) ' ( ( ' & % ' ' & (0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW            $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK            7RWDO'HOD\ KU             0RYHPHQW/26 )$&$$$'$$$$$ $0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 ''&'(&'$$&$$ %0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW            $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 )$$$$$%$$$$$ $0RYHPHQW9ROXPH    0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 ) ( & ) ( % & $ $ ' $ $ $0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 ('%''&''%(%$ &0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW            $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK            7RWDO'HOD\ KU             0RYHPHQW/26 '''$$$$%$'%$ &0RYHPHQW9ROXPH        0RYHPHQWWK4XHXH IW   6WRUDJH%D\'LVWDQFH IW   $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 $ $ $ ' ( ' & $ $ $ ' & &0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/26,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘZ  ,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK'$$$:HVWERXQG$SSURDFK1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK)(&&,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ'ƌĞLJ&ŽdžZŽĂĚ,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘƵďͬĂǀĂŶŶŝƐ,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘŶƚĞƌƉƌŝƐĞͬƌďLJΖƐ ''%$,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘdĂƌŐĞƚ^ŽƵƚŚ  ,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK''$$&$$$:HVWERXQG$SSURDFK>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘZĞĚ&ŽdžZŽĂĚ  ,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK02((DVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDO:HVWERXQG$SSURDFK,QWHUVHFWLRQ7RWDO1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ/ͲϲϵϰZĂŵƉƐ '&'&,QWHUVHFWLRQ$'$&1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ/ͲϲϵϰtZĂŵƉƐ  ,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK'$%% ϮϬϰϬ>dϮͲWDWĞĂŬ,ŽƵƌ(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 ) ) ) ' ( ' ' & % ' ' & (0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW            $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK            7RWDO'HOD\ KU             0RYHPHQW/26 )$'$$$'$$$$$ $0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 ''&'(&'%%&%$ %0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW            $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 )$$$$$%$$$$$ $0RYHPHQW9ROXPH     0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 ) ) % ) ( % & $ $ & $ $ $0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK            7RWDO'HOD\ KU             0RYHPHQW/26 ' ' % ' ' & ( & $ ' % % &0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW            $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK            7RWDO'HOD\ KU             0RYHPHQW/26 '('$$$$%$'%$ &0RYHPHQW9ROXPH        0RYHPHQWWK4XHXH IW   6WRUDJH%D\'LVWDQFH IW   $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 $ $ $ ' ( ' & $ $ $ ' & &0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/26,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘZ  ,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK($$$:HVWERXQG$SSURDFK1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK)(&',QWHUVHFWLRQ 02((DVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ'ƌĞLJ&ŽdžZŽĂĚ,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘƵďͬĂǀĂŶŶŝƐ,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘŶƚĞƌƉƌŝƐĞͬƌďLJΖƐ ''%%,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘdĂƌŐĞƚ^ŽƵƚŚ  ,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK&'$$&$$$:HVWERXQG$SSURDFK>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘZĞĚ&ŽdžZŽĂĚ  ,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK02((DVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDO:HVWERXQG$SSURDFK,QWHUVHFWLRQ7RWDO1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ/ͲϲϵϰZĂŵƉƐ ''&&,QWHUVHFWLRQ$'$'1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ/ͲϲϵϰtZĂŵƉƐ  ,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK'$%& ϮϬϰϬ>dϯͲWDWĞĂŬ,ŽƵƌ(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK           7RWDO'HOD\ KU             0RYHPHQW/26 (''('''&%''& '0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW            $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK            7RWDO'HOD\ KU             0RYHPHQW/26 )$'$$$'$$$$$ $0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 ''&'(&&%$&%$ %0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW            $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK            7RWDO'HOD\ KU             0RYHPHQW/26 )$%$$$%$$$$$ $0RYHPHQW9ROXPH    0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 ) ( & ) ) % ' $ $ & $ $ $0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK            7RWDO'HOD\ KU             0RYHPHQW/26 ('%''''&$'%% &0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW            $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK            7RWDO'HOD\ KU             0RYHPHQW/26 '''$$$$%$'%$ &0RYHPHQW9ROXPH        0RYHPHQWWK4XHXH IW   6WRUDJH%D\'LVWDQFH IW   $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 $$$'''&$$$'& &0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/26,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘZ  ,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK)$$$:HVWERXQG$SSURDFK1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK('&',QWHUVHFWLRQ 02((DVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ'ƌĞLJ&ŽdžZŽĂĚ,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘƵďͬĂǀĂŶŶŝƐ,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘŶƚĞƌƉƌŝƐĞͬƌďLJΖƐ '&%%,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘdĂƌŐĞƚ^ŽƵƚŚ  ,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK''$$'$$$:HVWERXQG$SSURDFK>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘZĞĚ&ŽdžZŽĂĚ  ,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK02((DVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDO:HVWERXQG$SSURDFK,QWHUVHFWLRQ7RWDO1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ/ͲϲϵϰZĂŵƉƐ ''&&,QWHUVHFWLRQ$'$'1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ/ͲϲϵϰtZĂŵƉƐ  ,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK'$%& ϮϬϰϬ>dϰͲWDWĞĂŬ,ŽƵƌ(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK           7RWDO'HOD\ KU             0RYHPHQW/26 ( ' ' ( ( ' ' & % ' ' & '0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW            $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 $$&$$$$$$$$$ $0RYHPHQW9ROXPH    0RYHPHQWWK4XHXH IW   6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 ''&'(&'%%&%$ &0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW            $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 $$$$$$$$$$$$ $0RYHPHQW9ROXPH     0RYHPHQWWK4XHXH IW   6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 ) ( % ) ) % & $ $ & $ $ $0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK            7RWDO'HOD\ KU             0RYHPHQW/26 '(%''&'&$'%% &0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW            $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK            7RWDO'HOD\ KU             0RYHPHQW/26 '''$$$$%$'%$ &0RYHPHQW9ROXPH        0RYHPHQWWK4XHXH IW   6WRUDJH%D\'LVWDQFH IW   $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 $$$(((&$$$'% &0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/26,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘZ  ,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK&$$$:HVWERXQG$SSURDFK1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK((&&,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ'ƌĞLJ&ŽdžZŽĂĚ,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘƵďͬĂǀĂŶŶŝƐ,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘŶƚĞƌƉƌŝƐĞͬƌďLJΖƐ ''%%,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘdĂƌŐĞƚ^ŽƵƚŚ  ,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK''$$$$$$:HVWERXQG$SSURDFK>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘZĞĚ&ŽdžZŽĂĚ  ,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK02((DVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDO:HVWERXQG$SSURDFK,QWHUVHFWLRQ7RWDO1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ/ͲϲϵϰZĂŵƉƐ '&&&,QWHUVHFWLRQ$($'1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ/ͲϲϵϰtZĂŵƉƐ  ,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK'$%& ϮϬϰϬ>dϱͲWDWĞĂŬ,ŽƵƌ(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK           7RWDO'HOD\ KU             0RYHPHQW/26 ) ' ' ( ( ' ' & % ' & & '0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW            $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 ''&'(&&%%&$$ %0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW            $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 ) ( % ) ( % & $ $ & $ $ $0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK            7RWDO'HOD\ KU             0RYHPHQW/26 ''%''''&$'%% &0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW            $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK            7RWDO'HOD\ KU             0RYHPHQW/26 '''$$$$%$'%$ &0RYHPHQW9ROXPH        0RYHPHQWWK4XHXH IW   6WRUDJH%D\'LVWDQFH IW   $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 $$$'''&$$$'% &0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/26,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘZ  ,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK('&&1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ'ƌĞLJ&ŽdžZŽĂĚ,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK'&%%,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘdĂƌŐĞƚ^ŽƵƚŚ  ,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK&'$$>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘZĞĚ&ŽdžZŽĂĚ,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK02((DVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDO:HVWERXQG$SSURDFK,QWHUVHFWLRQ7RWDO1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ/ͲϲϵϰZĂŵƉƐ ''&&,QWHUVHFWLRQ$'$&1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ/ͲϲϵϰtZĂŵƉƐ  ,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK'$%& ϮϬϰϬWZ&ZZ>dͲDWĞĂŬ,ŽƵƌ(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK            7RWDO'HOD\ KU             0RYHPHQW/26 ' & % ' & & % % $ & % % &0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW            $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 $$$$$$$$$$$$ $0RYHPHQW9ROXPH 0RYHPHQWWK4XHXH IW   6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK            7RWDO'HOD\ KU             0RYHPHQW/26 &'%''%%$$$$$ $0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW            $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 $$%$$$$$$$$$ $0RYHPHQW9ROXPH   0RYHPHQWWK4XHXH IW   6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK            7RWDO'HOD\ KU             0RYHPHQW/26 ($$($$%$$$$$ $0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 & & $ ' % $ ' % $ ' $ $ %0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW            $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK            7RWDO'HOD\ KU             0RYHPHQW/26 &'&$$$$&$'&$ &0RYHPHQW9ROXPH 0RYHPHQWWK4XHXH IW   6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK            7RWDO'HOD\ KU             0RYHPHQW/26 $$$''((%$$&$ &0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 $$$$$$$$$$$$ $0RYHPHQW9ROXPH  0RYHPHQWWK4XHXH IW 6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/26$(%&,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ/ͲϲϵϰtZĂŵƉƐ  ,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ/ͲϲϵϰZĂŵƉƐ &%%$,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK &$&&:HVWERXQG$SSURDFK1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘZĞĚ&ŽdžZŽĂĚ  ,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK%'$$1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘdĂƌŐĞƚ^ŽƵƚŚ  ,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘŶƚĞƌƉƌŝƐĞͬƌďLJΖƐ &&$$,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK %$$$:HVWERXQG$SSURDFK1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ'ƌĞLJ&ŽdžZŽĂĚ  ,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ^ŚĂŶŶŽŶ^ƋƵĂƌĞ &&%%,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK $$$$:HVWERXQG$SSURDFK1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘZ  ,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDOZĞĚ&ŽdžZŽĂĚΘdĂƌŐĞƚͬ'ĂƐ^ƚĂƚŝŽŶ   $$$$ ϮϬϰϬWZ&ZZ>dͲD/WĞĂŬ,ŽƵƌ(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 ''&('&&%%&%% &0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW            $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 $$%$$$$$$$$$ $0RYHPHQW9ROXPH 0RYHPHQWWK4XHXH IW   6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 ''&'(%&$$&%$ %0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW            $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 $$$$$$$$$$$$ $0RYHPHQW9ROXPH   0RYHPHQWWK4XHXH IW   6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK            7RWDO'HOD\ KU             0RYHPHQW/26 ) $ & ) $ % ' $ $ & $ $ %0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK            7RWDO'HOD\ KU             0RYHPHQW/26 ' ' % ' & % ' & $ ' % $ &0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW            $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK            7RWDO'HOD\ KU             0RYHPHQW/26 '('$$$$%$'%$ %0RYHPHQW9ROXPH 0RYHPHQWWK4XHXH IW   6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 $$$()%&$$$&$ &0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 $$$$$$&$$$$$ $0RYHPHQW9ROXPH  0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/261RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ/ͲϲϵϰtZĂŵƉƐ '$%%,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK $'$&:HVWERXQG$SSURDFK1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ/ͲϲϵϰZĂŵƉƐ  ,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘZĞĚ&ŽdžZŽĂĚ ,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK '&&&:HVWERXQG$SSURDFK1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘdĂƌŐĞƚ^ŽƵƚŚ $$$$,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK ''$$:HVWERXQG$SSURDFK1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘŶƚĞƌƉƌŝƐĞͬƌďLJΖƐ  ,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ'ƌĞLJ&ŽdžZŽĂĚ %$$$,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK '&%%:HVWERXQG$SSURDFK1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ^ŚĂŶŶŽŶ^ƋƵĂƌĞ  ,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK ''%%:HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘZ ,QWHUVHFWLRQ 02((DVWERXQG$SSURDFKZĞĚ&ŽdžZŽĂĚΘdĂƌŐĞƚͬ'ĂƐ^ƚĂƚŝŽŶ   $$&$,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDO ϮϬϰϬWZ&ZZ>dͲWDWĞĂŬ,ŽƵƌ(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 )''('''&%''& '0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW            $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 $$&$$$$$$$$$ $0RYHPHQW9ROXPH 0RYHPHQWWK4XHXH IW   6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 ''&''%'%%&%$ &0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW            $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 $$%$$$$$$$$$ $0RYHPHQW9ROXPH   0RYHPHQWWK4XHXH IW   6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 ) ) & ) ( % ' $ $ & $ $ $0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK            7RWDO'HOD\ KU             0RYHPHQW/26 ''%'&&'&$'%$ &0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW            $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK            7RWDO'HOD\ KU             0RYHPHQW/26 ''&$$$$%$'%$ &0RYHPHQW9ROXPH 0RYHPHQWWK4XHXH IW   6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 $$$'('&$$$'% &0RYHPHQW9ROXPH             0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/26(%/ (%7 (%5 :%/ :%7 :%5 1%/ 1%7 1%5 6%/ 6%7 6%50RYHPHQW'HOD\ VHFYHK             7RWDO'HOD\ KU             0RYHPHQW/26 $$$$$$&$$$$& $0RYHPHQW9ROXPH0RYHPHQWWK4XHXH IW            6WRUDJH%D\'LVWDQFH IW $SSURDFK'HOD\ VHFYHK $SSURDFK/261RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDOZĞĚ&ŽdžZŽĂĚΘdĂƌŐĞƚͬ'ĂƐ^ƚĂƚŝŽŶ $'$&,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK $$&&:HVWERXQG$SSURDFK1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ/ͲϲϵϰtZĂŵƉƐ  ,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ/ͲϲϵϰZĂŵƉƐ '&&&,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK '$%&:HVWERXQG$SSURDFK1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘZĞĚ&ŽdžZŽĂĚ  ,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK''$$1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘdĂƌŐĞƚ^ŽƵƚŚ  ,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘŶƚĞƌƉƌŝƐĞͬƌďLJΖƐ '&%%,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK %$$$:HVWERXQG$SSURDFK1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ'ƌĞLJ&ŽdžZŽĂĚ  ,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘ^ŚĂŶŶŽŶ^ƋƵĂƌĞ ('&&,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK &$$$:HVWERXQG$SSURDFK1RUWKERXQG$SSURDFK 6RXWKERXQG$SSURDFK,QWHUVHFWLRQ7RWDO>ĞdžŝŶŐƚŽŶǀĞŶƵĞΘZ  ,QWHUVHFWLRQ 02((DVWERXQG$SSURDFK :HVWERXQG$SSURDFK 7UDIILF6WXG\ /H[LQJWRQ$YHQXH5HFRQVWUXFWLRQ    $OOLDQW1R%                   $SSHQGL[% 'HWDLOHG6LJQDO:DUUDQW$QDO\VLV   7$%/(%6,*1$/:$55$17$1$/<6,6:$55$17/2&$7,21/H[LQJWRQ$YHQXH 5HG)R[5RDG&RXQW'DWH180%(52) 63(('6RXUFH$3352$&+ '(6&5,37,21 /$1(6 03+ )DFWRU 3RSXODWLRQ"126SHHGRYHUPSK"1292/80(5(4$712120$-25675((70,125675((7:$55$170(7 :$55$170(7$3352$&+ :$55$170(7 $3352$&+ :$55$170(7$3352$&+ :$55$170(7$3352$&+ 6$0(+285621 6$0(+28562192/80( &RQG$ &RQG% $ % &RPE ([LVWLQJ6LJQDO 92/80( &RQG$ &RQG% $ % &RPE ([LVWLQJ6LJQDO &RQG$ &RQG% $ % &RPE ([LVWLQJ6LJQDO 0$-25$1'0,125675((76 0$-25$1'0,125675((76727$/RI$ RI% RI$ RI% RI$ RI% RI$ RI% RI$ RI% RI$ RI% $ % &RPE ([LVWLQJ6LJQDO $ % &RPE ([LVWLQJ6LJQDO+285                       &RQG$ &RQG%RI$ RI% RI$ RI%&RQG$ &RQG%RI$RU%RI$ RI% RI$ RI%$0     $0     $0     $0     $0     $0    ;  $0   ;;;;;;;; $0   ;;;;;;; ;;; ; ;;;     $0   ;;;;;;; ;;; ; ;;;     $0   ;;;;;;;;;;;;;;;; $0   ;;;;;;;;;;;;;;;  1RRQ   ;;;;;; ;;;;; ; ;;; ;;;;;30   ;;;;;;;;;;;; ; ;;;;;;;;;30   ;;;;;; ;;;;; ; ;;; ;;;;;30   ;;;;;; ;;;;; ; ;;; ;;;;;30   ;;;;;; ;;;;; ;;;;; ;;;;;30   ;;;;;; ;;;;;;;;;;;;;;;;;30   ;;;;;;;;;;;;;;;;;;;;;;;;30   ;;;;;; ;;;;; ; ; ;;;;;30   ;;;;;; ; ;;; ; ; ;;;     30   ;;;;;; ; ; ;;;;  30    ; ; ;  30    ;  0LGQLJKW     6800$5<2)5(68/76:DUUDQW&RQG$ZDV QRWPHW  KRXUVVDWLVILHGUHTXLUHPHQWV:DUUDQW&RQG%ZDV PHW  KRXUVVDWLVILHGUHTXLUHPHQWV:DUUDQW&RPELQH$ %ZDV PHW  KRXUVVDWLVILHGUHTXLUHPHQWV([LVWLQJ6LJQDO:DUUDQW$ PHW  KRXUVVDWLVILHGUHTXLUHPHQWV([LVWLQJ6LJQDO:DUUDQW% PHW  KRXUVVDWLVILHGUHTXLUHPHQWV:DUUDQW PHW  KRXUVVDWLVILHGUHTXLUHPHQWV:DUUDQW PHW  KRXUVVDWLVILHGUHTXLUHPHQWV/H[LQJWRQ$YHQXH1%5HG)R[5RDG:%5HG)R[5RDG(%0DMRU$SSURDFK0DMRU$SSURDFK0LQRU$SSURDFK0LQRU$SSURDFK,ISRSXODWLRQLVOHVVWKDQRUWKHPDMRUVWUHHWVSHHGLVRYHUPSKVHYHQW\SHUFHQWIDFWRUFDQEHDSSOLHG$SSO\VHYHQW\SHUFHQWIDFWRU"/H[LQJWRQ$YHQXH6%:DUUDQW$QDO\VLVB5HG)R[5RDG[OV:DUUDQW$QDO\VLVB5HG)R[5RDG[OV VWB0DLQ7DE  6RXUFH0LQQHVRWD0DQXDORQ8QLIRUP7UDIILF&RQWURO'HYLFHV :DUUDQW$QDO\VLVB5HG)R[5RDG[OV VWB+U&KDUW                 0LQRU6WUHHW+LJK9ROXPH$SSURDFK 93+ 0DMRU6WUHHW7RWDORI%RWK$SSURDFKHV 93+ :$55$171270(7:$55$170(7 25025(/$1(6 25025(/$1(6/H[LQJWRQ$YHQXH 5HG)R[5RDG6,*1$/:$55$17$1$/<6,6([LVWLQJ:HHNGD\9ROXPHV7$%/(:$55$17)RXU+RXU:DUUDQW:DUUDQW0HWIRU+RXUV 127(YSKDSSOLHVDVWKHORZHUWKUHVKROGYROXPHIRUDPLQRUVWUHHWDSSURDFKZLWKWZRRUPRUHODQHV 7KHILUVWQXPEHUUHIHUVWRWKHQXPEHURIODQHVRIDSSURDFKRQWKHPDMRUVWUHHWDQGWKHVHFRQGQXPEHUUHIHUVWRWKHQXPEHURIODQHVRIDSSURDFKRQWKHPLQRUVWUHHW6RXUFH0LQQHVRWD0DQXDORQ8QLIRUP7UDIILF&RQWURO'HYLFHV  6RXUFH0LQQHVRWD0DQXDORQ8QLIRUP7UDIILF&RQWURO'HYLFHV :DUUDQW$QDO\VLVB5HG)R[5RDG[OV VWB3N+U&KDUW                 0LQRU6WUHHW+LJK9ROXPH$SSURDFK 93+ 0DMRU6WUHHW7RWDORI%RWK$SSURDFKHV 93+ :$55$171270(7:$55$170(7 25025(/$1(6 25025(/$1(67$%/(:$55$173HDN+RXU:DUUDQW:DUUDQW0HWIRU+RXUV 127(YSKDSSOLHVDVWKHORZHUWKUHVKROGYROXPHIRUDPLQRUVWUHHWDSSURDFKZLWKWZRODQHVRUPRUH 7KHILUVWQXPEHUUHIHUVWRWKHQXPEHURIODQHVRIDSSURDFKRQWKHPDMRUVWUHHWDQGWKHVHFRQGQXPEHUUHIHUVWRWKHQXPEHURIODQHVRIDSSURDFKRQWKHPLQRUVWUHHW6RXUFH0LQQHVRWD0DQXDORQ8QLIRUP7UDIILF&RQWURO'HYLFHV /H[LQJWRQ$YHQXH 5HG)R[5RDG6,*1$/:$55$17$1$/<6,6([LVWLQJ:HHNGD\9ROXPHV 7$%/(%6,*1$/:$55$17$1$/<6,6:$55$17/2&$7,21/H[LQJWRQ$YHQXH *UH\)R[5RDG&RXQW'DWH180%(52) 63(('6RXUFH$3352$&+ '(6&5,37,21 /$1(6 03+ )DFWRU 3RSXODWLRQ"126SHHGRYHUPSK"1292/80(5(4$712120$-25675((70,125675((7:$55$170(7 :$55$170(7$3352$&+ :$55$170(7 $3352$&+ :$55$170(7$3352$&+ :$55$170(7$3352$&+ 6$0(+285621 6$0(+28562192/80( &RQG$ &RQG% $ % &RPE ([LVWLQJ6LJQDO 92/80( &RQG$ &RQG% $ % &RPE ([LVWLQJ6LJQDO &RQG$ &RQG% $ % &RPE ([LVWLQJ6LJQDO 0$-25$1'0,125675((76 0$-25$1'0,125675((76727$/RI$ RI% RI$ RI% RI$ RI% RI$ RI% RI$ RI% RI$ RI% $ % &RPE ([LVWLQJ6LJQDO $ % &RPE ([LVWLQJ6LJQDO+285                        &RQG$ &RQG%RI$ RI% RI$ RI%&RQG$ &RQG%RI$RU%RI$ RI% RI$ RI%$0     $0     $0     $0     $0     $0     $0    ; ; ; ;   ; ; ; $0   ;;;;;;;;;;;;  $0   ;;;;;;;;;;;;;  $0   ;;;;;;;;;;;;;;  $0   ;;;;;; ; ; ;;;;; ;;;;;1RRQ   ;;;;;; ; ; ;;;;;;;;;;;;;30   ;;;;;; ;;;;;;;;;;;;;30   ;;;;;; ;;;;;;;;;;;;;30   ;;;;;; ;;;;;;;;;;;;30   ;;;;;; ;;;;;;;;;;;;;30   ;;;;;; ;;;;;;;;;;;;30   ;;;;;; ;;;;;;;;;;;;30   ;;;;;; ;;;;;;;;;;;;;30   ;;;;;; ; ; ;;; ; ;;;     30   ;;;;;;;;;;;;;  30    ; ;  ;;30     ;;0LGQLJKW     6800$5<2)5(68/76:DUUDQW&RQG$ZDV PHW  KRXUVVDWLVILHGUHTXLUHPHQWV:DUUDQW&RQG%ZDV PHW  KRXUVVDWLVILHGUHTXLUHPHQWV:DUUDQW&RPELQH$ %ZDV PHW  KRXUVVDWLVILHGUHTXLUHPHQWV([LVWLQJ6LJQDO:DUUDQW$ PHW  KRXUVVDWLVILHGUHTXLUHPHQWV([LVWLQJ6LJQDO:DUUDQW% PHW  KRXUVVDWLVILHGUHTXLUHPHQWV:DUUDQW PHW  KRXUVVDWLVILHGUHTXLUHPHQWV:DUUDQW PHW  KRXUVVDWLVILHGUHTXLUHPHQWV/H[LQJWRQ$YHQXH1%*UH\)R[5RDG:%*UH\)R[5RDG(%0DMRU$SSURDFK0DMRU$SSURDFK0LQRU$SSURDFK0LQRU$SSURDFK,ISRSXODWLRQLVOHVVWKDQRUWKHPDMRUVWUHHWVSHHGLVRYHUPSKVHYHQW\SHUFHQWIDFWRUFDQEHDSSOLHG$SSO\VHYHQW\SHUFHQWIDFWRU"/H[LQJWRQ$YHQXH6%:DUUDQW$QDO\VLVB*UH\)R[5RDG[OV:DUUDQW$QDO\VLVB*UH\)R[5RDG[OV VWB0DLQ7DE  6RXUFH0LQQHVRWD0DQXDORQ8QLIRUP7UDIILF&RQWURO'HYLFHV :DUUDQW$QDO\VLVB*UH\)R[5RDG[OV VWB+U&KDUW                 0LQRU6WUHHW+LJK9ROXPH$SSURDFK 93+ 0DMRU6WUHHW7RWDORI%RWK$SSURDFKHV 93+ :$55$171270(7:$55$170(7 25025(/$1(6 25025(/$1(6/H[LQJWRQ$YHQXH *UH\)R[5RDG6,*1$/:$55$17$1$/<6,6([LVWLQJ:HHNGD\9ROXPHV7$%/(:$55$17)RXU+RXU:DUUDQW:DUUDQW0HWIRU+RXUV 127(YSKDSSOLHVDVWKHORZHUWKUHVKROGYROXPHIRUDPLQRUVWUHHWDSSURDFKZLWKWZRRUPRUHODQHV 7KHILUVWQXPEHUUHIHUVWRWKHQXPEHURIODQHVRIDSSURDFKRQWKHPDMRUVWUHHWDQGWKHVHFRQGQXPEHUUHIHUVWRWKHQXPEHURIODQHVRIDSSURDFKRQWKHPLQRUVWUHHW6RXUFH0LQQHVRWD0DQXDORQ8QLIRUP7UDIILF&RQWURO'HYLFHV  6RXUFH0LQQHVRWD0DQXDORQ8QLIRUP7UDIILF&RQWURO'HYLFHV :DUUDQW$QDO\VLVB*UH\)R[5RDG[OV VWB3N+U&KDUW                 0LQRU6WUHHW+LJK9ROXPH$SSURDFK 93+ 0DMRU6WUHHW7RWDORI%RWK$SSURDFKHV 93+ :$55$171270(7:$55$170(7 25025(/$1(6 25025(/$1(67$%/(:$55$173HDN+RXU:DUUDQW:DUUDQW0HWIRU+RXUV 127(YSKDSSOLHVDVWKHORZHUWKUHVKROGYROXPHIRUDPLQRUVWUHHWDSSURDFKZLWKWZRODQHVRUPRUH 7KHILUVWQXPEHUUHIHUVWRWKHQXPEHURIODQHVRIDSSURDFKRQWKHPDMRUVWUHHWDQGWKHVHFRQGQXPEHUUHIHUVWRWKHQXPEHURIODQHVRIDSSURDFKRQWKHPLQRUVWUHHW6RXUFH0LQQHVRWD0DQXDORQ8QLIRUP7UDIILF&RQWURO'HYLFHV /H[LQJWRQ$YHQXH *UH\)R[5RDG6,*1$/:$55$17$1$/<6,6([LVWLQJ:HHNGD\9ROXPHV 7$%/(%6,*1$/:$55$17$1$/<6,6:$55$17/2&$7,21/H[LQJWRQ$YHQXH 7DUJHW6RXWK&RXQW'DWH180%(52) 63(('6RXUFH$3352$&+ '(6&5,37,21 /$1(6 03+ )DFWRU 3RSXODWLRQ"126SHHGRYHUPSK"1292/80(5(4$712120$-25675((70,125675((7:$55$170(7 :$55$170(7$3352$&+ :$55$170(7 $3352$&+ :$55$170(7$3352$&+ :$55$170(7$3352$&+ 6$0(+285621 6$0(+28562192/80( &RQG$ &RQG% $ % &RPE ([LVWLQJ6LJQDO 92/80( &RQG$ &RQG% $ % &RPE ([LVWLQJ6LJQDO &RQG$ &RQG% $ % &RPE ([LVWLQJ6LJQDO 0$-25$1'0,125675((76 0$-25$1'0,125675((76727$/RI$ RI% RI$ RI% RI$ RI% RI$ RI% RI$ RI% RI$ RI% $ % &RPE ([LVWLQJ6LJQDO $ % &RPE ([LVWLQJ6LJQDO+285                        &RQG$ &RQG%RI$ RI% RI$ RI%&RQG$ &RQG%RI$RU%RI$ RI% RI$ RI%$0     $0     $0     $0     $0     $0     $0    ; ; ; ;  $0   ;;;;;; $0   ;;;;;;$0   ;;;;;;$0   ;;;;;;1RRQ   ;;;;;;30   ;;;;;; ; ;;;; ;;;  30   ;;;;;; ; ;;; 30   ;;;;;; ; ;;; 30   ;;;;;; ;;30   ;;;;;;30   ;;;;;; ;;30   ;;;;;; ; ;;; 30   ;;;;;; ; ;;;; ;;;  30   ;;;;;; ; ;;;; ;;;  30    ; ; ;   ;;30     0LGQLJKW     6800$5<2)5(68/76:DUUDQW&RQG$ZDV QRWPHW  KRXUVVDWLVILHGUHTXLUHPHQWV:DUUDQW&RQG%ZDV QRWPHW  KRXUVVDWLVILHGUHTXLUHPHQWV:DUUDQW&RPELQH$ %ZDV QRWPHW  KRXUVVDWLVILHGUHTXLUHPHQWV([LVWLQJ6LJQDO:DUUDQW$ QRWPHW  KRXUVVDWLVILHGUHTXLUHPHQWV([LVWLQJ6LJQDO:DUUDQW% PHW  KRXUVVDWLVILHGUHTXLUHPHQWV:DUUDQW QRWPHW  KRXUVVDWLVILHGUHTXLUHPHQWV:DUUDQW PHW  KRXUVVDWLVILHGUHTXLUHPHQWV/H[LQJWRQ$YHQXH1%7DUJHW6RXWK:%0DMRU$SSURDFK0DMRU$SSURDFK0LQRU$SSURDFK0LQRU$SSURDFK,ISRSXODWLRQLVOHVVWKDQRUWKHPDMRUVWUHHWVSHHGLVRYHUPSKVHYHQW\SHUFHQWIDFWRUFDQEHDSSOLHG$SSO\VHYHQW\SHUFHQWIDFWRU"/H[LQJWRQ$YHQXH6%:DUUDQW$QDO\VLVB7DUJHW6RXWK[OV:DUUDQW$QDO\VLVB7DUJHW6RXWK[OV VWB0DLQ7DE  6RXUFH0LQQHVRWD0DQXDORQ8QLIRUP7UDIILF&RQWURO'HYLFHV :DUUDQW$QDO\VLVB7DUJHW6RXWK[OV VWB+U&KDUW                 0LQRU6WUHHW+LJK9ROXPH$SSURDFK 93+ 0DMRU6WUHHW7RWDORI%RWK$SSURDFKHV 93+ :$55$171270(7:$55$170(7 25025(/$1(6 25025(/$1(6/H[LQJWRQ$YHQXH 7DUJHW6RXWK6,*1$/:$55$17$1$/<6,6([LVWLQJ:HHNGD\9ROXPHV7$%/(:$55$17)RXU+RXU:DUUDQW:DUUDQW0HWIRU+RXUV 127(YSKDSSOLHVDVWKHORZHUWKUHVKROGYROXPHIRUDPLQRUVWUHHWDSSURDFKZLWKWZRRUPRUHODQHV 7KHILUVWQXPEHUUHIHUVWRWKHQXPEHURIODQHVRIDSSURDFKRQWKHPDMRUVWUHHWDQGWKHVHFRQGQXPEHUUHIHUVWRWKHQXPEHURIODQHVRIDSSURDFKRQWKHPLQRUVWUHHW6RXUFH0LQQHVRWD0DQXDORQ8QLIRUP7UDIILF&RQWURO'HYLFHV  6RXUFH0LQQHVRWD0DQXDORQ8QLIRUP7UDIILF&RQWURO'HYLFHV :DUUDQW$QDO\VLVB7DUJHW6RXWK[OV VWB3N+U&KDUW                 0LQRU6WUHHW+LJK9ROXPH$SSURDFK 93+ 0DMRU6WUHHW7RWDORI%RWK$SSURDFKHV 93+ :$55$171270(7:$55$170(7 25025(/$1(6 25025(/$1(67$%/(:$55$173HDN+RXU:DUUDQW:DUUDQW0HWIRU+RXU 127(YSKDSSOLHVDVWKHORZHUWKUHVKROGYROXPHIRUDPLQRUVWUHHWDSSURDFKZLWKWZRODQHVRUPRUH 7KHILUVWQXPEHUUHIHUVWRWKHQXPEHURIODQHVRIDSSURDFKRQWKHPDMRUVWUHHWDQGWKHVHFRQGQXPEHUUHIHUVWRWKHQXPEHURIODQHVRIDSSURDFKRQWKHPLQRUVWUHHW6RXUFH0LQQHVRWD0DQXDORQ8QLIRUP7UDIILF&RQWURO'HYLFHV /H[LQJWRQ$YHQXH 7DUJHW6RXWK6,*1$/:$55$17$1$/<6,6([LVWLQJ:HHNGD\9ROXPHV 7UDIILF6WXG\ /H[LQJWRQ$YHQXH5HFRQVWUXFWLRQ    $OOLDQW1R&                  $SSHQGL[& 3UHIHUUHG$OWHUQDWLYH&RQFHSW/D\RXW                COUNTY ROAD ECANADIAN PACIFIC RAILROADISLAND LAKE AVE1103 GOODWILL 1195 ESTREET FLATS 3585 WALGREENS 1160 AMERICAN RED CROSS CARIBOU COFFEE GEORGES SHOES SUBWAY TMOBILE ALLSTATE CHINA EXPRESS GREAT CLIPS UPS H&R BLOCK NAILS 3000 TOBACCO NUTMEG BREWHOUSE CLEAN N PRESS DAVANNIS 3717 CUB FOODS 3673 3720 AMBASSADOR BAPTIST CHURCH 1090 1084 1076 1072 3592 SUPER AMERICA 1080 ODDS AND ENDS AGAIN 3600 STEPHENS ART CENTENNIAL JEWLERS EDWARD JONES PIZZA HUT PIPES CIGARS TOP SHELF ATHLETICS GREY FOX RD13' THRU 13' THRU 13' LEFT (170') 11' THRU 13' THRU 6' BLVD 6' BLVD 10' TRAIL MODIFY MEDIAN TO OFFSET OPPOSING LEFT TURNS 1:5 TAPER ( 5 5 ' )10' LEFT13' THRU/RIGHT13' THRU1:10 TAPER (110') 1:10 TAPER (110') 16' ALIGNMENT OFFSET WITH 3600' AND 1500' RADIUS REVERSE CURVES WITH A 70' LONG TANGENT BETWEEN CURVES (40 MPH DESIGN, NORMAL CROWN) 13' THRU 13' THRU 13' THRU 13' THRU VARIABLE MEDIAN 8' WALK6' BLVD 6' BLVD 10' TRAIL 40:1 ALIGNMENT TAPERS TO REDUCE MEDIAN FROM 16' TO 4' (40 MPH DESIGN, NORMAL CROWN) STORMWATER-- --POND LOCATION 16' ALIGNMENT OFFSET WITH 22000' RADIUS CURVE FROM TAPER (40 MPH DESIGN, NORMAL CROWN)LEXINGTON AVENUECOUNTY ROAD ETOGREY FOX RDLEGEND ROADWAY (CONCRETE) ROADWAY (BITUMINOUS) CURB & MEDIAN CONCRETE WALK BITUMINOUS TRAIL DRIVEWAY PARCEL BOUNDARY INPLACE RIGHT OF WAY TRAFFIC FLOW ARROWS GREY FOX RDRED FOX RDTARGET RD3737 PACE INDUSTRIES 3751 ARBYS 3757 BIG O TIRES 3761 ENTERPRISE 3775 - 3785 JIMMY JOHNS BALANCE FOR LIFE BINDERY PLUS PAPA MURPHYS JIM LAABS PIANOS OLIVE ME CHIRO 3833 NOODLES AND CO FROZEN YOGURT FANTASTIC SAMS ROYAL NAILS PAPA JOHNS AT&T GNC POTBELLY STARBUCKS 3836 TCF BANK 3780 RAISING CANES 3800 TARGET3760 YMCA 3720 AMBASSADOR BAPTIST CHURCHGREY FOX RD10' LEFT13' THRU/RIGHT13' THRU 13' THRU 13' THRU 13' LEFT (175') 11' THRU 11' THRU 13' RIGHT (225') 1:10 TAPER (110') 1:10 TAPER (110') 1:10 TAPER (110') 1:10 TAPER (110') 1:10 TAPER (110') 10' TRAIL 16' ALIGNMENT OFFSET WITH 1:40 TAPER (40 MPH DESIGN, NORMAL CROWN) 13' THRU 13' THRU 13' THRU 13' THRU 1:10 TAPER (110') 1:10 TAPER (110') VARIABLE (5' - 20') MEDIAN LEXINGTON AVENUEGREY FOX RDTORED FOX RDLEGEND PRIVATE CONSTRUCTION POTENTIAL CONNECTIONS ROADWAY (CONCRETE) ROADWAY (BITUMINOUS) CURB & MEDIAN CONCRETE WALK BITUMINOUS TRAIL DRIVEWAY PARCEL BOUNDARY INPLACE RIGHT OF WAY TRAFFIC FLOW ARROWS RED FOX RDI-694 SBI-694 NB3833 NOODLES AND CO FROZEN YOGURT FANTASTIC SAMS ROYAL NAILS PAPA JOHNS AT&T GNC POTBELLY STARBUCKS 3855 PERKINS 1125 QUALITY INN 3854 EXXON CIRCLE K 3836 TCF BANK 1051 WENDYS 11' LEFT (330') 11' THRU 11' THRU 13' LEFT (275') 13' THRU 13' THRU 13' THRU 13' THRU 16' ALIGNMENT OFFSET WITH 1500' RADIUS REVERSE CURVES WITH A 160' TANGENT BETWEEN CURVES (40 MPH DESIGN, NORMAL CROWN) 13' RIGHT (225') 1:5 TAPER ( 1 1 0 ' ) 1:5 TAPER ( 5 5 ' ) 6' BLVD 10' TRAIL 1:5 TAPER ( 5 5 ' ) 16' ALIGNMENT OFFSET WITH 1:40 TAPER (40 MPH DESIGN, NORMAL CROWN) 13' THRU 13' THRU 1:10 TAPER (110') VARIABLE (5' - 20') MEDIAN 10' MEDIAN LEXINGTON AVENUERED FOX RDTOI-694LEGEND ROADWAY (CONCRETE) ROADWAY (BITUMINOUS) CURB & MEDIAN CONCRETE WALK BITUMINOUS TRAIL DRIVEWAY PARCEL BOUNDARY INPLACE RIGHT OF WAY TRAFFIC FLOW ARROWS ƉƉĞŶĚŝdž  >ĞdžŝŶŐƚŽŶ^ƚĂƚŝŽŶWŚĂƐĞϯŽŶĐĞƉƚWůĂŶ &ĞďƌƵĂƌLJϮϱ͕ϮϬϮϭ                                    12" CIP W(P)12" CIP W(P)LEXINGTON AVENUEEXISTING BUILDING1 S3PROPOSED BUILDING FFE = 934.00 ~43,000 SF 2828 31 18 6 4 6 6 6 6 6 6 27 5 17  ƉƉĞŶĚŝdž&  ŶŐŝŶĞĞƌ͛ƐƐƚŝŵĂƚĞĨŽƌZĂŵƐĞLJŽƵŶƚLJ>ĞdžŝŶŐƚŽŶ ǀĞŶƵĞWƌŽũĞĐƚ                                   52$':$< 48$17,7< 52$':$< &267 672506(:(5 48$17,7< 672506(:(5 &267 52$':$< 48$17,7< 52$':$< &267 672506(:(5 48$17,7< 672506(:(5 &267 52$':$< 48$17,7< 52$':$< &267 52$':$< 48$17,7< 52$':$< &267 48$17,7< &267 48$17,7< &267  $6%8,/7 /803680                 02%,/,=$7,21 /803680                ),(/'2)),&(7<3('02',),(' ($&+                       &/($5,1*$&5(           *58%%,1* $&5(           &/($5,1*75((           *58%%,1* 75((                    3$9(0(170$5.,1*5(029$/ /,1)7          3$9(0(170$5.,1*5(029$/ 64)7                   5(029(3,3($3521 ($&+           5(029(0$1+2/( ($&+            5(029(*$7(9$/9( %2; ($&+             5(029(+<'5$17 ($&+             5(029('5$,1$*(6758&785( ($&+          5(029(0$5.(5 ($&+          5(029(6,*17<3(& ($&+           5(029(6,*17<3(' ($&+          5(029(/,*+7)281'$7,21 ($&+          6$/9$*(7$1*(177(50,1$/  ($&+          6$/9$*(/,*+767$1'$5' /80,1$,5( ($&+          6$/9$*(6,*17<3(& ($&+           6$/9$*(6,*17<3(' ($&+          6$:,1*&21&5(7(3$9(0(17 )8//'(37+ /,1)7          6$:,1*%,73$9(0(17 )8//'(37+ /,1)7          5(029(:$7(50$,1 /,1)7           5(029(6(:(53,3( 67250 /,1)7          5(029(6(:(53,3( 6$1,7$5< /,1)7           5(029(&85% *877(5 /,1)7          5(029(5(7$,1,1*:$// /,1)7           5(029(&+$,1/,1.)(1&( /,1)7          5(029(:$7(56(59,&(3,3( /,1)7          6$/9$*(75$)),&%$55,(5 /,1)7           5(029(&21&5(7(0(',$1 64<'          5(029(&21&5(7(:$/. 64<'          5(029(&21&5(7('5,9(:$<3$9(0(17 64<'           5(029(&21&5(7(3$9(0(17 64<'          5(029(%,780,12863$9(0(17 64<'          5(029(%,780,1286:$/. 64)7          $%$1'21:$7(50$,1 /,1)7                    *(27(;7,/()$%5,&7<3( 64<'          +$8/ ',6326(2)&217$0,1$7('0$7(5,$/ 3 &8<'                   (;&$9$7,21&20021 3 &8<'          (;&$9$7,2108&. &8<'          (;&$9$7,2168%*5$'( 3 &8<'          6(/(&7*5$18/$5(0%$1.0(17 &9 3 &8<'          &20021(0%$1.0(17 &9 3 &8<'                   &20021/$%25(56 +285           75$&72502817('%$&.+2( +285           675((76:((3(5 :,7+3,&.83%5220  +285                    :$7(5 0*$//21                    $**5(*$7(%$6( &9 &/$66 3 &8<'                  %,780,12863$7&+63(&,$/ 64<'                   0,//%,780,1286685)$&(  64<'                    '2:(/%$5 ($&+          &21&5(7(3$9(0(17 64<'          6833/(0(17$/3$9(0(175(,1)25&(0(17 3281'          '5,// *52875(,1)%$5 (32;<&2$7(' ($&+                    %,780,12860$7(5,$/)257$&.&2$7 *$//21                    7<3(63:($5,1*&2856(0,; % 721           7<3(63121:($5&2856(0,; % 721           7<3(63:($5,1*&2856(0,; ) 721                   (;3$16,21-2,176'(6,*1(+ /,1)7                    3/$67,&62,/6&$3 &9 &8<'           6$1'%$&.),// &8<'                    5&3,3($3521 ($&+           5&3,3($3521 ($&+                    3(5)3(3,3('5$,1 /,1)7          3(5)3(3,3('5$,1 /,1)7                    39&3,3(6(:(5 /,1)7           5&3,3(6(:(5'(6&/9 /,1)7          5&3,3(6(:(5'(6&/9 /,1)7           5&3,3(6(:(5'(6&/9 /,1)7           5&3,3(6(:(5'(6&/9 /,1)7           6$1,7$5<6(:(56<67(0  /803680           &211(&772(;,67,1*6$1,7$5<6(:(5 ($&+           &211(&772(;,67,1*672506(:(5 ($&+          &216758&7,21&267(67,0$7(&216758&7,213/$16 ,7(0 12 '(6&5,37,21 81,76 &6$+1213$57,&,3$7,1* /(;,1*721$9(18(5(&216758&7,216$3 &6$+ 63 7+  81,7&267 727$/(67,0$7( 48$17,7< &267 01'2763 $ &,7<2)6+25(9,(: 6$3 &,7<2)$5'(1+,//6 6$3 /5,3$1'&6$+3$57,&,3$7,1* &,7<2)6+25(9,(: &,7<2)$5'(1+,//65$06(<&2817<6$3 52$':$< 48$17,7< 52$':$< &267 672506(:(5 48$17,7< 672506(:(5 &267 52$':$< 48$17,7< 52$':$< &267 672506(:(5 48$17,7< 672506(:(5 &267 52$':$< 48$17,7< 52$':$< &267 52$':$< 48$17,7< 52$':$< &267 48$17,7< &267 48$17,7< &267 &216758&7,21&267(67,0$7(&216758&7,213/$16 ,7(0 12 '(6&5,37,21 81,76 &6$+1213$57,&,3$7,1* /(;,1*721$9(18(5(&216758&7,216$3 &6$+ 63 7+  81,7&267 727$/(67,0$7( 48$17,7< &267 01'2763 $ &,7<2)6+25(9,(: 6$3 &,7<2)$5'(1+,//6 6$3 /5,3$1'&6$+3$57,&,3$7,1* &,7<2)6+25(9,(: &,7<2)$5'(1+,//65$06(<&2817<6$3  &211(&7,172(;,67,1*'5$,1$*(6758&785( ($&+           &211(&772(;,67,1*6$1,7$5<6(:(56(5 ($&+          67((/&$6,1*3,3( -$&.(' /,1)7                    7(0325$5<:$7(56(59,&( /803680             &211(&772(;,67,1*:$7(50$,1 ($&+             &211(&772(;,67,1*:$7(56(59,&( ($&+           +<'5$17 ($&+             $'-8679$/9(%2;:$7(5 ($&+            &25325$7,216723 ($&+           *$7(9$/9( %2; ($&+             *$7(9$/9( %2; ($&+             *$7(9$/9( %2; ($&+            7<3(.&233(53,3( /,1)7          :$7(50$,1'8&7,/(,521&/ /,1)7             :$7(50$,1'8&7,/(,521&/ /,1)7             :$7(50$,1'8&7,/(,521&/ /,1)7            :$7(50$,1+'3( /,1)7             :$7(50$,1+'3( ',5(&7,21$/'5,//('  /,1)7          39&:$7(50$,1 /,1)7           :$7(50$,1,168/$7,21  64<'           :$7(50$,1),77,1*6 3281'                    &$67,1*$66(0%/<  ($&+          $'-867)5$0( 5,1*&$67,1*  ($&+          &2167'5$,1$*(6758&785('(6,*1* /,1)7           &2167'5$,1$*(6758&785('(6,*1+ /,1)7           &2167'5$,1$*(6758&785('(6,*16' /,1)7           &2167'5$,1$*(6758&785('(6,*163(&,$/  /,1)7           &2167'5$,1$*(6758&785('(6 /,1)7          &2167'5$,1$*(6758&785('(6 /,1)7           &2167'5$,1$*(6758&785('(6 /,1)7           &2167'5$,1$*(6758&785('(6 /,1)7           &2167'5$,1$*(6758&785('(6 /,1)7           &2167'5$,1$*(6758&785('(6 /,1)7           5(&216758&7'5$,1$*(6758&785( /,1)7          ,1),/75$7,21),/75$7,216<67(0 /803680           &216758&7&21752/6758&785( ($&+                    *(27(;7,/(),/7(57<3( 64<'          5$1'205,35$3&/$66,, &8<'                   &21&5(7(:$/. 64)7         &21&5(7(:$/. 64)7                   &21&5(7(&85% *877(5'(6,*1% /,1)7           &21&5(7(&85% *877(5'(6,*1% /,1)7           &21&5(7(&85% *877(5'(6,*1% /,1)7           &21&5(7(&85% *877(5'(6,*1% /,1)7          &21&5(7('5,9(:$<3$9(0(17 64<'          7581&$7(''20(6 64)7                    3257$%/(35(&$67&21&%$55,(5'(6 /,1)7                    /,*+7)281'$7,21'(6,*163(&,$/ ($&+           ,167$///,*+732/( ($&+                   ,167$//75$)),&%$55,(5'(6,*1% /,1)7           ,167$//7$1*(177(50,1$/  ($&+                    :,5()(1&('(6,*1 /,1)7           :,5()(1&('(6,*19 /,1)7                    75$)),&&21752/683(59,625 /803680           75$)),&&21752/ /803680                $/7(51$7(3('(675,$15287( /803680           )/$**(5 +285           32/,&(2)),&(5 +285           7(0325$5<,03$&7$77(18$725 $66(0%/<                    ,167$//6,*17<3(& ($&+          ,167$//6,*17<3(' ($&+          2%-(&70$5.(57<3(; ($&+           2%-(&70$5.(57<3(; ($&+          2%-(&70$5.(57<3(; ($&+          6,*17<3(& 64)7                    (0(5*(1&<9(+,&/(35((037,216<67(0%  /803680           (0(5*(1&<9(+,&/(35((037,216<67(0& /803680            (0(5*(1&<9(+,&/(35((037,216<67(0' /803680           (0(5*(1&<9(+,&/(35((037,216<67(0( /803680           (0(5*(1&<9(+,&/(35((037,216<67(0) /803680           75$)),&&21752/,17(5&211(&7 /803680           75$)),&&21752/6,*1$/6<67(0% 6<67(0          75$)),&&21752/6,*1$/6<67(0& 6<67(0          75$)),&&21752/6,*1$/6<67(0' 6<67(0          5(9,6(6,*1$/6<67(0$ 6<67(0             5(9,6(6,*1$/6<67(0( 6<67(0           5(9,6(6,*1$/6<67(0) 6<67(0           7(0325$5<6,*1$/6<67(0$ 6<67(0           7(0325$5<6,*1$/6<67(0% 6<67(0           7(0325$5<6,*1$/6<67(0' 6<67(0           7(0325$5<6,*1$/6<67(0( 6<67(0                   52$':$< 48$17,7< 52$':$< &267 672506(:(5 48$17,7< 672506(:(5 &267 52$':$< 48$17,7< 52$':$< &267 672506(:(5 48$17,7< 672506(:(5 &267 52$':$< 48$17,7< 52$':$< &267 52$':$< 48$17,7< 52$':$< &267 48$17,7< &267 48$17,7< &267 &216758&7,21&267(67,0$7(&216758&7,213/$16 ,7(0 12 '(6&5,37,21 81,76 &6$+1213$57,&,3$7,1* /(;,1*721$9(18(5(&216758&7,216$3 &6$+ 63 7+  81,7&267 727$/(67,0$7( 48$17,7< &267 01'2763 $ &,7<2)6+25(9,(: 6$3 &,7<2)$5'(1+,//6 6$3 /5,3$1'&6$+3$57,&,3$7,1* &,7<2)6+25(9,(: &,7<2)$5'(1+,//65$06(<&2817<6$3  *(27(;7,/(:(('%$55,(5)$%5,& 64<'                   67$%,/,=('&216758&7,21(;,7 /803680           (526,21&21752/683(59,625 /803680           67250'5$,1,1/(73527(&7,21 ($&+           6,/7)(1&(7<3(06 /,1)7           6(',0(17&21752//2*7<3(:22'),%(5 /,1)7                   )(57,/,=(57<3( 3281'          )(57,/,=(57<3( 3281'                   62'',1*7<3(6$/772/(5$17 64<'          6((',1*$&5(           6(('0,;785( 3281'          6(('0,;785( 3281'           +<'5$8/,&67$%,/,=('),%(50$75,; 3281'          52//('(526,2135(9(17,21&$7(*25< 64<'          /$1'6&$3(52&. &8<'                   5(029$%/(35()2503$9(0(170$5.,1*7$3( /,1)7                   62/,'/,1(3$,17 :5 /,1)7          62/,'/,1(3$,17 :5 /,1)7          '277('/,1(3$,17 :5 /,1)7           '%/(62/,'/,1(3$,17 :5 /,1)7          62/,'/,1(08/7,&203*5,1 :5 /,1)7          62/,'/,1(08/7,&203*5,1 :5 /,1)7           62/,'/,1(08/7,&203*5,1 :5 /,1)7           %52.(1/,1(08/7,&203*5,1 :5 /,1)7          '277('/,1(08/7,&203*5,1 :5 /,1)7          '277('/,1(08/7,&203*5,1 :5 /,1)7          '%/(62/,'/,1(08/7,&203*5,1 :5 /,1)7          62/,'/,1(35()7$3(*5,1 :5 &217 /,1)7          62/,'/,1(35()7$3(*5,1 :5 &217 /,1)7           %52.(1/,1(35()7$3(*5,1 :5 &217 /,1)7          '277('/,1(35()7$3(*5,1 :5 &217 /,1)7           3$97066*35()7+(502*5,1 64)7          &5266:$/.35()7+(502*5,1 64)7         127(6 3 '(127(63/$148$17,7<,7(0 $ &223(5$7,9($*5((0(17  (;,67,1*7$1*(177(50,1$/,6(,7+(5(73/86256.7  )25$//6:((3,1*$6',5(&7('%<7+((1*,1((5,1&/8'(66:((3(57,0(21/<$1''2(6127,1&/8'(7,0(7275$1632576:((3(572$1')5206,7(  %<3$663803,1*6<67(0)2586('85,1*6$1,7$5<6(:(5,167$//$7,21  3,3(%8567,1*,167$//$7,21  6$1,7$5<6(:(5$1':$7(50$,1,168/7$7,21$61(('('/2&$7,216$1',167$//$7,21:,//%(',5(&7('%<7+((1*,1((5  ,1&/8'(648$17,7<)25672506(:(5$1'6$1,7$5<6(:(5  6$1,7$5<0$1+2/(66((&,7<2)6+25(9,(:67$1'$5'3/$7(6$1  &216,6762)7:2/,)762)7<3(63:($5,1*&2856( 63:(%% 29(5$0,1,0802)&/$66$**5(*$7(%$6(    75$)),&&21752/6,*1$/6<67(0%,7(0)81',1*63/,75()/(&76/2&$/6+$5(2)/5,3)81',1* &216758&7,21727$/    ƉƉĞŶĚŝdž'  ZĂŵƐĞLJŽƵŶƚLJWƵďůŝĐtŽƌŬƐ ŽƐƚWĂƌƚŝĐŝƉĂƚŝŽŶWŽůŝĐLJ                                   22 APPENDIX A Ramsey County Public Works Cost Participation Policy Approved May 28, 2013 The intent of Ramsey County's Public Works Cost Participation Policy is to equitably distribute the cost of construction and major maintenance projects between the County and its partner communities. The policy recognizes that projects undertaken by the County should benefit the County and provide local benefits to the communities in which they are completed. The policy also defines the County's contributions to locally-initiated projects. All County cost contributions are subject to project feasibility and availability of funding. The policy, as amended on May 28, 2013, reflects Ramsey County's commitment to develop a safe, effective, multimodal transportation system for users of all abilities and incomes. It is upon that foundation the Public Works Department will work with partnering agencies to ensure investments in construction and major maintenance accommodate an appropriate mix of motorized and non-motorized travel options. County cost participation levels have been selectively increased in recognition of the growing importance of integrating pedestrian, bicycle, transit and American Disabilities Act (ADA) features into transportation planning and implementation. Amended policy provisions also remove former provisions which identified differing cost participation levels when federal funds have been secured. In the event unique design considerations or project impacts are identified, the Director of Public Works may negotiate mutually beneficial deviations from this policy, subject to review and approval of the County Board. 23 Department of Public Works Cost Participation PolicyRamsey County Public Works Cost Participation Policy for the Reconstruction and Major Maintenance of County Roads and County State Aid Highways ITEM: COUNTY SHARE: NOTES: Right of Way 50% County cost participation on right of way acquisition may be reduced or eliminated where the acquisition is specifically for detached trails, aesthetics, or special design elements requested by municipalities or other project partners. County participation on right of way acquisition applies only to construction projects and shall be 0% for maintenance projects, except where additional right of way is required to accommodate improvements within the curb or shoulder line. Removals 100% Travel Lanes 100% Parking Lanes 25% 100% in cities under 5,000 population or in White Bear Township. 100% on maintenance pavement preservation projects. Shoulders 100% 100% of the width required to meet State Aid design standards. 100% in cities under 5,000 population or in White Bear Township. 100% on maintenance pavement preservation projects. 50% outside of the required width. 24 ITEM: COUNTY SHARE: NOTES: Concrete Curb & Gutter (new) 25% Concrete Curb & Gutter (replacement) 100% 100% if in serviceable condition, as determined by the County Engineer; otherwise negotiable. 100% of curb and gutter as part of median construction required for traffic channelization or to serve as a pedestrian refuge. Storm Sewer % Eligible for State Aid Culverts 100% Water Main Modification 100% 100%, if required for construction. 0% on betterments. Sanitary Sewer Modification 100% 100%, if required for construction. 0% on betterments Private Utility Relocation 0% Traffic Signals 100% of County Legs Traffic Signal construction is addressed in a separate policy (County Board Resolution 81-1001). Electrical power shall be paid by the municipality. 25 ITEM: COUNTY SHARE: NOTES: Roundabouts 100% of County Legs Retaining Walls 50% 50% when retaining walls are constructed in lieu of right of way acquisition or to mitigate impacts; by negotiation when necessitated by design parameters. Grading Outside of Curb 100% 100% of area required for road construction. 50% of grading required specifically for sidewalks, trails, or other amenities. Medians 100% 100% of a standard concrete median design, including curb and gutter; municipalities shall pay for the additional cost of any decorative or aesthetic treatments. Sidewalks (new) 50% Includes grading, aggregate base, surfacing, and pedestrian ramps. Sidewalks (replacement) 100% 100% if in serviceable condition, as determined by the County Engineer; otherwise negotiable. Bituminous Trail (new) 50% Includes grading, aggregate base, surfacing, and pedestrian ramps. Bituminous Trail (replacement) 100% 100% if in serviceable condition, as determined by the County Engineer; otherwise negotiable. 26 ITEM: COUNTY SHARE: NOTES: Trail/Sidewalk Grade Separation 0% to 50%, by negotiation Bridge or underpass construction. Street Lighting 0% Street Lighting as part of a traffic signal shall be paid 100% by County. Electrical power shall be paid by the municipality. Replacement Trees 100% 100%, if 1:1 replacement; 50%, if greater than 1:1 Fence 100% 100% if serviceable; 0% if in County R/W Turf Restoration 100% Amenities and Aesthetics 0% Special surface treatments, ground covers, or plantings, ornamental railings, etc. Driveway Replacement 100% Stormwater Treatment % eligible for State Aid Maintenance shall be based on contributing flows. 27 ITEM: COUNTY SHARE: NOTES: Preliminary/Design Engineering % of Participation Construction Engineering % of Participation 28 All County participation is subject to the availability of funds. On Federal Aid Projects, the federal funds shall be applied to all eligible items before cost participation is calculated. Federal participation is typically 50-80% of the total project cost. Right of Way (ROW) acquisition continues to grow in cost and complexity. Setting the County Cost share at 50% is intended to make the County an equal partner with the municipality(s), regardless of funding source(s) secured for a project. Early creation of a cooperative partnership helps ensure project scoping and alternatives analysis are comprehensive and consider all benefits and costs -- including right of way cost and impacts. Joint efforts can also identify specific locations where extraordinary ROW impacts are likely. In those cases, the County and City(s) can revisit available options or consider appropriate design changes. Timely recognition of unavoidable impacts can provide additional time for all parties to secure their respective funding sources. Redevelopment and/or future land use changes may also provide an opportunity to reduce conflicts with programmed improvements. Individual parcels which present exceptional challenges may justify an unequal distribution of City/County cost shares for consideration and approval of the County Board. Retaining Walls are generally constructed to reduce right of way impacts or to protect environmental resources such as wetlands or wooded areas. County cost participation will be at the 50% level for those wall installations similar to ROW cost participation. In situations where wall options are locally preferred or part of a community's aesthetic design goals, County participation will be reduced or eliminated. Resulting County contributions will be limited to benefits reducing impacts to adjoining properties or environmental resources. Trail/Sidewalk Grade Separations are desirable bike and pedestrian features but can be cost prohibitive in many settings. ADA compliance and mitigating access/safety issues often add substantial construction costs to otherwise straightforward structures - particularly in locations where space is limited. Design options can also vary from simple box culvert underpasses to elaborate bridge structures. The intent of a negotiated cost participation level of 0-50% is an acknowledgement of the enormous range in costs that may be proposed. It is important County participation adhere to sound benefit/cost considerations. County participation levels may also consider the availability of federal or other outside funding sources that materially reduce County and local shares.  ƉƉĞŶĚŝdž,  ĞŶĞĨŝƚŝŶŐWƌŽƉĞƌƚŝĞƐDĂƉ               LEXINGTON AVENUE (CSAH 51)3780 LEXINGTON AVENUE N SHOREVIEW, MN 55126-2916 263023320014 GREY FOX RD RED FOX RD TARGET RD 3833 LEXINGTON AVENUE N ARDEN HILLS, MN 55126-2937 273023410023 3787 LEXINGTON AVENUE N ARDEN HILLS, MN 55126-2937 273023410024 3757 LEXINGTON AVENUE N ARDEN HILLS, MN 55126-2937 273023410020 3751 LEXINGTON AVENUE N ARDEN HILLS, MN 55126-2937 273023410021 3800 LEXINGTON AVENUE N SHOREVIEW, MN 55126-2916 263023320013 3845 LEXINGTON AVENUE N ARDEN HILLS, MN 55112 273023410022 PROPOSED TRAFFIC SIGNAL TRAFFIC SIGNAL SYSTEM LEXINGTON AVENUE AT TARGET ROAD BENEFITING PROPERTIES ƉƉĞŶĚŝdž/  WƌĞůŝŵŝŶĂƌLJƐƐĞƐƐŵĞŶƚZŽůůƐ;WĞŶĚŝŶŐͿ                                     ƉƉĞŶĚŝdž:  ŝƚLJŽĨƌĚĞŶ,ŝůůƐƐƐĞƐƐŵĞŶƚWŽůŝĐLJ             City of Arden Hills 2004 Assessment Policy Index Page General Information............................................................................................1 Part I – Assessment Policy for Existing Streets..................................................1 Street Reconstruction..............................................................................3 Mill and Overlay Improvements.............................................................4 Alley .....................................................................................................5 Appurtenances.........................................................................................5 Maintenance/Rehabilitation Projects ......................................................6 Definitions and General Provisions ........................................................6 Assessment Units ..................................................................................10 Hardship Deferrals ................................................................................11 Appeals Process ....................................................................................12 Part II – Policy for New Developments............................................................13 Sanitary Sewer ......................................................................................14 Water Distribution System....................................................................16 Storm Sewer..........................................................................................20 Additional Definitions and General Provisions ....................................22 2004 Assessment Policy – Page 1 City of Arden Hills 2004 Assessment Policy General Information The City of Arden Hills has adopted a revised Assessment Policy for its existing streets that are part of the Pavement Management Program (PMP )).. The PMP is a long-term, multi-year plan that consists of proposed reconstruction and repair of the city’s streets. The goal and intent of this policy revision was to simplify and make the process easy to understand and implement. The Policy was drafted by a group of local citizens who served on the City’s 2004 Assessment Policy Task Force. This Policy document is divided into two parts. Part I deals with existing streets and Part II deals with new developments. Part I – Assessment Policy for Existing Streets The purpose of this assessment policy manual is to establish procedures to be utilized by the City of Arden Hills when preparing assessment rolls, so as to assure uniform and consistent treatment of the affected properties. Minnesota State Law, Chapter 429 provides that a municipality shall have the power to make public improvements such as sanitary sewers, storm sewers, water source and distribution facilities, street improvements including grading, curb and gutter, surfacing, sidewalks, street lighting and recreational facilities, etc. The various procedures that the municipality must follow including reports, notices and public hearings are well defined within the law. The Statute further defines that the cost of any improvement may be assessed upon property benefited by the improvement based upon the benefits received whether or not the property abuts on the improvement and whether or not any part of the cost of the improvement is paid from other funding sources. The law is not specific on how these benefits are to be measured or how the costs are to be apportioned, but rather makes it incumbent upon the municipality to determine with assistance of the City Engineer, City Attorney, appraisers or other qualified personnel, a fair and equitable method of cost-sharing among the properties involved. Throughout this policy manual, the total cost of an improvement shall include the construction cost, plus all associated overhead costs. The total cost of the associated overhead for a public improvement project would typically include the following as a percentage of the construction costs: 2004 Assessment Policy – Page 2 City Administration 2.5% Design Engineering Construction Engineering 10.0% 10.0% Legal 2.0% Fiscal 3.0% Interest During Construction 4.5% Assessment Roll Preparation 1.0% Contingencies 4.0% TOTAL 37.0% These overhead costs are estimates however; they are used to calculate actual assessments. The initiation of public improvement projects may happen utilizing two (2) different methods. The first method is by a petition of the affected property owners. The petition must be signed by not less than thirty-five percent (35%) of the owners of the frontage of the real property abutting the proposed improvements .. It should be noted that the City Council retains the right to review the merits of each project or improvement and establishes the priority as it deems proper. The second method is to initiate the proceedings by City Council direction, in which case no petition is needed. Any reference to land zoning in this policy manual shall mean the most current approved City Zoning Map available at the time. It should be emphasized that the special assessment methods and policies summarized herein cannot be considered as all-inclusive and that unusual circumstances may at times justify special consideration. Also, any fixed cost data and rates presented herein will be adjusted from year to year so as to reflect current costs. The City Council shall retain the right to review each project on its own merit and to deviate from any portion of this Assessment Policy Manual, as it deems proper. These deviations may occur in unique situations or where application of the policy produces unfair or undesirable results. The City of Arden Hills utilizes a Unit Cost methodology for the assessment of existing residential homes on a per-lot unit basis, with a lot unit being defined as a platted single- family residential lot or equivalent, which, according to current Arden Hills Municipal Code cannot be further subdivided for R-1 and R-2 residential use. The City will assess fifty percent (50%) of the total charges, as assessment, to the residents for existing roadways. Generally, no assessments are made to the residents for sanitary sewer, water, and storm water that are part of the PMP. 2004 Assessment Policy – Page 3 Street Reconstruction A. Residential Equivalent Assessment Rate All R-1 and R-2 residentially zoned properties with frontage abutting a street that is reconstructed shall be assessed on a per unit basis at the residential equivalent assessment rate. This rate shall apply, regardless of the street's classification (local, collector, arterial, trunk highway); designation (County State-Aid Highway, Municipal State-Aid Street); or jurisdiction (State, County or City). The residential equivalent assessment rate shall be based on fifty percent (50%) of the total cost of street reconstruction, including all associated overhead costs for a typical residential street section. This residential equivalent assessment rate shall be determined by the City Council. B. Commercial Equivalent Assessment Rate/All Other Zoning Classifications Assessment Rate Commercial properties with frontage abutting a street that is reconstructed shall be assessed on a per unit basis at the commercial/industrial equivalent assessment rate. The per unit basis is calculated based on the average neighborhood unit size, particularly in a mixed (residential and commercial) neighborhood. Larger sized commercial lots may be sub-divided into smaller units for assessment purposes and to ensure equity. This rate shall apply, regardless of the street's classification (local, collector, arterial, trunk highway); designation (County State-Aid Highway, Municipal State-Aid Street); or jurisdiction (State, County or City). The commercial/industrial equivalent assessment rate shall be based on seventy percent (70%) of the cost of street reconstruction plus all associated overhead costs for a typical commercial street section. This commercial/industrial equivalent assessment rate shall be determined by the City Council. C. Tax Exempt (non-profits, churches, schools, organizations, groups) Equivalent Assessment Rate The tax exempt equivalent assessment rate shall be based on one hundred percent (100%) of the total cost of street reconstruction, including all associated overhead costs for a typical residential street 2004 Assessment Policy – Page 4 section. This assessment rate shall be determined by the City Council. All properties with frontage abutting a street that is reconstructed shall be assessed on a per unit basis at the tax exempt equivalent assessment rate. This rate shall apply, regardless of the street's classification (local, collector, arterial, trunk highway); designation (County State-Aid Highway, Municipal State-Aid Street); or jurisdiction (State, County or City). Mill and Overlay Improvements Mill and overlay improvements are placed as a cost-effective measure to extend the useful street life of a particular roadway and to delay street reconstruction needs. As bituminous mill and overlays are constructed as long-term rehabilitation improvements, the cost of these improvements shall be assessed as described below. From time to time, however, the City's Operations and Maintenance Department may determine that small street areas need immediate bituminous overlay improvements for short- term maintenance purposes. These types of bituminous overlays, determined to be "stop gap" maintenance needs rather than long-term street rehabilitation improvements, shall not be assessed to abutting properties and shall be funded by the City. A. Residential Equivalent Assessment Rate All R-1 and R-2 residentially zoned properties with frontage abutting a street that is overlaid with bituminous surfacing shall be assessed on a per unit basis at the residential equivalent assessment rate. This rate shall apply, regardless of the street's classification (local, collector, arterial, trunk highway); designation (County State-Aid Highway, Municipal State-Aid Street); or jurisdiction (State, County or City). The residential equivalent assessment rate shall be based on fifty percent (50%) of the cost of bituminous overlay plus all associated overhead costs for a typical residential street section. This residential equivalent assessment rate shall be determined by the City Council. B. Comme rcial/Industrial Equivalent Assessment Rate All commercially or industrially zoned properties with frontage abutting a street that is overlaid with bituminous surfacing shall be assessed on a unit basis at the commercial/industrial equivalent assessment rate. 2004 Assessment Policy – Page 5 This rate shall apply, regardless of the street's classification (local, collector, arterial, trunk highway); designation (County State-Aid Highway, Municipal State-Aid Street); or jurisdiction (State, County or City). The commercial/industrial equivalent assessment rate shall be based on seventy percent (70%) of the cost of a bituminous overlay plus all associated overhead costs for a typical commercial street section. This commercial/industrial equivalent assessment rate shall be determined by the City Council. C. Tax Exempt (non-profits, churches, schools, organizations, groups) Equivalent Assessment Rate All tax exempt properties with frontage abutting a street that is overlaid with bituminous surfacing shall be assessed on a per unit basis at the tax exempt equivalent assessment rate. This rate shall apply, regardless of the street's classification (local, collector, arterial, trunk highway); designation (County State-Aid Highway, Municipal State-Aid Street); or jurisdiction (State, County or City). The tax exempt equivalent assessment rate shall be based on one hundred percent (100%) of the cost of bituminous overlay plus all associated overhead costs for a typical residential street section. This tax exempt equivalent assessment rate shall be determined by the City Council. Alley All reconstruction shall be assessed 50% to the abutting properties. The assessment shall be on a per unit basis for the property frontage on the alley. Appurtenances Appurtenances such as sidewalks, street lighting, trees, or other landscaping features are often encountered during street improvement projects. Appurtenances to new street construction, street reconstruction, or bituminous overlay improvements that are either existing or needed by the City shall be included in the cost of the street improvement project. Appurtenances constructed or provided in areas along an improvement project where they do not currently exist, shall be one hundred percent (100%) assessed to the benefiting properties on a per unit basis. The cost of these appurtenances shall be separated from the cost of the street improvement project. All costs of ornamental street lighting and/or any lighting shall be one hundred percent (100%) assessed to the benefiting properties on a per unit basis. 2004 Assessment Policy – Page 6 Maintenance/Rehabilitation Projects Concrete Pavement Restoration – Concrete pavement restoration is a maintenance procedure funded by the City. Crack Sealing – Crack sealing is a maintenance procedure funded by the city. Bituminous Seal Coating – Bituminous seal coating is a maintenance procedure funded by the City. Bituminous Surface Patching – Bituminous surfacing patching is a maintenance procedure funded by the City. Definitions & General Provisions A. Assessment Rate The assessment rate for any special assessment district is computed by dividing the total assessable costs of such improvement by the total number of assessment units. Residential Example: Roadway Project Cost $601,000 Drainage Improvements $205,000 Sanitary Improvements $245,000 Water Main Improvements $38,000 Total Project Cost: $1,089,000 Assessed to Property Owners: Roadway Project Cost $601,000 50% assessed $300,500 Number of units in the neighborhood 60 Per Unit Assessment: $300,500 divided by 60 equals $5,008 B. Assessable Costs The assessable cost of an improvement shall be defined as those costs that, in the opinion of the City Council, are attributable to the need for service in the area served by the improvement. 2004 Assessment Policy – Page 7 C. Petition Petition shall mean a written document presented to the City Council for purpose of initiating a public improvement project. The address of each signatory, the date of the signature and a printing of each signatory's name shall accompany all signatures. D. Total Project Cost Total project cost shall mean the total estimated construction cost plus all associated overhead costs. Overhead costs shall include, but not be limited to, City administration, engineering, legal, fiscal, and interest during construction and land acquisition. E. Assessment Period The length of payment period of various types of improvement projects shall be as follows: ? Mill and Overlay = 5 years ? Street Reconstruction = 10 years In the case where several areas of the improvements listed above are included in the same project, the assessment period shall be determined by the City Council. In no event shall an assessment period exceed ten (10) years. F. Municipal State-Aid Streets Municipal State-Aid Streets are routes designated by the City Council and approved by the Commissioner of Transportation for inclusion in the City's State-Aid system. All routes typically begin and end on another municipal state-aid road, county state-aid road, or trunk highway. The criteria used in selecting such routes are as follows: ? The route is projected to carry a relatively heavier traffic volume or is functionally classified as collector or arterial as identified on the City's functional plan as approved by the City Council; and, ? The route connects the points of a major traffic interest within the City; and, ? The route provides an integrated street system affording, within practical limits, a state-aid street network consistent with projected traffic demands. 2004 Assessment Policy – Page 8 G. Municipal State-Aid Construction Funds Municipal State-Aid construction funds are monies apportioned to the City from the State to be used for the construction of routes designated on the Municipal State-Aid system. All construction funded with these monies must be in accordance with the Minnesota Department of Transportation (MnDOT) Office of State-Aid design criteria. Municipal State Aid (MSA) Funds will be utilized to offset the city’s portion of the project cost. H. Interest Rate on Unpaid Balance The interest rate used for the assessment shall be designated at the prime rate plus two (2) percentage points, fixed for the duration of the outstanding balance. The effective date of the interest shall be the date the Council approval of the assessment role. I. Land Not Included in Assessment The City may reserve the right to delete land within the assessable area from the assessment roles if, in its opinion, the land cannot be developed and/or the improvement does not provide benefit. No development of that property shall be permitted, nor shall any physical connection to the City's utility or drainage facilities be made by any development on that property until the assessment or connection fees are paid. J. Service District A service district is the area, as determined by the City Engineer and approved by the City Council, which will receive benefit from a proposed improvement project. This type of approach for assessment purposes is typically used for trunk and subtrunk sanitary sewer projects; trunk, subtrunk, source, storage and treatment water projects; and trunk storm sewer projects. K. Certification of Assessment Roll At the time the assessment rolls are adopted by the City Council by resolution (refer to Appendix for a sample resolution), the property owner may pay the entire assessment against their property in full at Arden Hills City Hall, 1245 W. Highway 96, within thirty (30) days without interest charge. Beyond thirty (30) days, but prior to certification to the County, payment (principal plus interest from the assessment roll date) can be made at the City Hall. After the certification of assessment to the County is made, a resident may make a payment directly at the Ramsey County Government Center, 50 Kellogg Boulevard, St. Paul. Interest 2004 Assessment Policy – Page 9 charges apply effective from the date of Council approval of the assessment role. It should be noted that the certification is made to the County in early September. A property owner may pay the total assessment against their property with accrued interest at any time during the life of the project assessment period. If paid before November 15th, interest is calculated to December 31st of the year the payment is made. If paid after November 15th, interest will be calculated through December 31st of the next year. Once the assessments are certified to the County, it is the responsibility of the County staff to calculate the interest charges and include them in the annual property tax payment schedule. Example: Assessment Amount $4,500 No. of years assessed 10 Interest Rate 6% Assessment Roll Approval Date 5/1/2005 Est. Total Interest over the life $1665 Schedule of Payments: Interest Principal Total Balance Year 1* $ 450.00 $ 450.00 $ 900.00 $4,050.00 Year 2 $ 243.00 $ 450.00 $ 693.00 $3,600.00 Year 3 $ 216.00 $ 450.00 $ 666.00 $3,150.00 Year 4 $ 189.00 $ 450.00 $ 639.00 $2,700.00 Year 5 $ 162.00 $ 450.00 $ 612.00 $2,250.00 Year 6 $ 135.00 $ 450.00 $ 585.00 $1,800.00 Year 7 $ 108.00 $ 450.00 $ 558.00 $1,350.00 Year 8 $ 81.00 $ 450.00 $ 531.00 $ 900.00 Year 9 $ 54.00 $ 450.00 $ 504.00 $ 450.00 Year 10 $ 27.00 $ 450.00 $ 477.00 $ - $1,665.00 $4,500.00 $6,165.00 * Note: Interest in year 1 is for twenty (20) months (May 1 ,2005 – December 31, 2006). 1. Ad Valorem Tax The City Council may, at their discretion, utilize ad valorem taxes to fund portions of the project cost of any public improvement. This shall be done in accordance with the appropriate Minnesota State Statutes. 2004 Assessment Policy – Page 10 2. Petition for Non-Programmed Projects The City of Arden Hills has established a formal capital improvement program for street reconstruction and rehabilitation projects. It is the intent of the City to generally follow this established program. The Arden Hills City Council will accept petitions from property owners requesting non- programmed projects. Generally, the assessment rate for non-programmed improvement projects initiated by petition of the affected property owners, and approved by the Council, shall be one-hundred percent (100%) of the total project cost. 3. Improvements to Roadways Not Under City Jurisdiction The City may assess properties that abut roadways not under City jurisdiction, but receiving reconstruction or bituminous overlay improvements. The assessment rate levied against these properties shall be the same as those established for City reconstruction or bituminous overlay projects. Assessment Units The City shall levy special assessments on adjacent benefiting properties for street improvement projects. The assessment rate shall be computed on a per-lot unit basis, with a lot unit being defined as a platted single-family residential lot or equivalent, which, according to current Arden Hills Municipal Code cannot be further subdivided for R-1 and R-2 residential use. If a property has been assessed on a lot unit basis for a public improvement, and subsequently a property division is made creating additional lot units, then a supplemental charge shall be made to the property at the same rate which applied under the original assessments. All tax exempt status properties shall be subdivided to determine the assessable lot units or part thereof. Corner lots shall be assessed on the street that is used for the mailing address. If a street improvement project is requested to be constructed to a greater width and/or thickness than the standard by the abutting property owners, the excess cost above that of the standard reconstruction cost shall be assessed one hundred percent (100%) to those properties. All properties with tax exempt status and abutting new street reconstruction, street reconstruction, or bituminous overlay improvements shall be assessed at one hundred percent (100%) of the cost of the improvement. 2004 Assessment Policy – Page 11 The assessment process shall be carried out in accordance with Minnesota Statutes Chapter 429. The assessment rate shall be on a per-lot unit basis and shall be calculated and processed in accordance with the current Arden Hills Pavement Management Program and Assessment Policy. Hardship Deferrals Minnesota Statute No. 435.193 allows the City, at its own discretion, to defer the payment of any assessment for any homestead property, that is a primary place of residence, owned by a person sixty-five (65) years of age or older, or retired by virtue of a permanent and total disability for which it would be a hardship to make the payments. Under the hardship criteria, no payment amount is reduced or eliminated, but deferred to a future date. Eventually, a payment in full with interest will be due to the City/County. The person filing for a senior deferment must be sixty-five (65) of age on or before December 31st of the assessment year. In order to receive such a deferment, the affected person must establish the economic hardship that would be incurred to the reasonable satisfaction of the Arden Hills City Council by providing documentation showing an annual gross income less than fifty percent (50%) of the Ramsey County median household income as determined by the most recent census. The deferral will last for a period of not more than ten (10) years, and will terminate before ten (10) years if any one of the following conditions is present: ? The owner of the property dies and the spouse is not eligible for a deferment; ? The property is sold; ? The property is no longer homestead; ? The City Council determines that there is no longer hardship incurred in immediately requiring either full or partial payment of the assessment. The City reserves the right to periodically request verification of continued eligibility for a hardship deferral. It should be noted that during the term of the deferral, interest will accrue. At the termination of the deferral period, interest and principal will be due in a lump sum amount. An application for deferment of special assessments is available at the City Offices. It is the responsibility of the resident to submit a completed deferral form, along with tax documents, to the Finance Director for approval. This application must be filed within 30 days of the assessment role. The submission of a deferral form to the City does not automatically qualify a resident for the deferral. If a resident is approved for the deferral, the City staff will notify the resident of the approval. The City staff on a periodic basis may request the resident to verify their eligibility. 2004 Assessment Policy – Page 12 Appeals Process An owner of the property has the opportunity to appeal the assessment amount at various stages of the assessment process. The first stage is when the assessment amount is initially estimated by staff based on the interpretation of the existing Assessment Policy. If the estimate was based on inaccurate or incomplete information, the owner may work directly with staff to clarify or rectify the situation. If the owner is not satisfied with the outcome at this stage, known as the first stage, they may file a formal appeal with the City Council, prior to the adoption of the assessment roll. This is known as the second stage of the appeal’s process. If the appeal is denied by the City Council, the owner may appeal to the district court pursuant to Minnesota Statutes, Section 429.081, by serving notice of the appeal to the Mayor or the City Administrator within thirty (30) days after the adoption of the assessment. 2004 Assessment Policy – Page 13 Part II – Policy for New Developments The assessment policy for anyone who wishes to make public improvements within the City of Arden Hills, as part of a proposed development shall conform to the policies established herein and as modified below. It is the responsibility of the developer to assume total costs (100%) for all new road and street construction including, lights, sanitary sewer, water, and storm water. Prior to any action on the part of the City to determine the feasibility of providing public improvements, the developer shall deposit such amount as determined by the City Administrator to adequately reimburse the City for all engineering, legal and planning, and other consultant fees for work performed in regard to such improvements. In addition, the developer shall be required prior to the City ordering the installation of any City financed improvements, to enter into a Development Contract insuring compliance with the policies set out herein and all subdivision requirements of the City. The developer shall also be required to post all cash deposits, and/or letters of credit prior to such action by the City Council. In all projects that the City constructs and finances, the following security provisions shall apply. A. For single family, two family or townhouse residential developments, the developer shall deposit with the City a cash escrow or an irrevocable letter of credit of not less than one hundred twenty-five percent (125%) of the estimated project cost as determined by the City Engineer. If the estimated project cost, as determined after receipt of bids for construction, exceeds the Engineer's estimate by ten percent (10%) or more, the deposit shall be increased proportionately. The total project costs shall be assessed in equal annual installments according to the assessment period. B. In the case where the improvements benefit not only the property being developed, but other areas within the City, the developer shall provide to the City a security deposit in accordance with paragraphs described above for the portion of the estimated project costs that represent the benefit to the proposed development. Such portion shall be assessed against the properties benefited. For all other types of development, the developer shall deposit with the City a cash escrow or irrevocable letter of credit of not less than one hundred twenty-five percent (125%) of the estimated project cost as determined by the City Engineer. If the estimated project cost as determined after receipt of bids for construction exceeds the Engineer's estimate by ten percent (10%) or more, the deposit shall be increased proportionately. The total project costs shall be assessed in equal annual installments according to the assessment period. The security deposit shall be irrevocable for the full term of any assessments for which given. The agreement shall be so conditioned as to guarantee payment of the 2004 Assessment Policy – Page 14 assessments as due or to pay for the cost of all improvements that the developer agreed to install. The required security deposit may consist of a cash escrow deposit or irrevocable letter of credit, in form acceptable to the City Attorney, and with firms authorized to do business in the State of Minnesota. Sanitary Sewer A. Definitions and General Provisions 1. Sanitary Sewer Interceptors A network of relatively large diameter, deep sewer pipe and associated pumping stations and appurtenances. The interceptors are designed as collectors for large areas within the sanitary sewer service area. 2. Sanitary Sewer Trunks and Subtrunks Sanitary sewer pumping stations, including associated forcemain and/or a network of gravity pipes ranging in size generally from ten inch (10") through eighteen inch (18") and extending away from respective interceptor mains. Pumping station, forcemains, trunks and subtrunks are designed as collectors for areas usually less than three hundred (300) acres. Because sewer lines flow by gravity, the pipes can become quite deep at some locations and very costly to install. A trunk or subtrunk assessment is, in certain cases, utilized so that costs due to extra depth (and/or oversizing) will be spread over the entire service district rather than becoming a burden on just those properties abutting that portion of the pipe network constructed. 3. Sanitary Sewer Laterals A network of pipes, usually eight inch (8") in size that are installed eight (8) to twenty (20) feet deep and are designed to serve those buildings abutting a given street or easement. The laterals drain to trunks, subtrunks or directly to interceptors. 4. Sanitary Sewer Building Services Those pipes, usually four-inch (4") or six-inch (6") in size leading from laterals (or sometimes from trunks, subtrunks and interceptors) that serve individual buildings. The services are plugged at the property line until such time that a building is connected to the sewer system. The property owner must make arrangements with a licensed, bonded plumber to complete the service connection. 2004 Assessment Policy – Page 15 5. Sanitary Sewer Availability Charge (SAC) This is a charge billed to all properties at the time of connection to the sanitary sewer system. The charge is the individual property share of the cost of the interceptor trunk and treatment facilities that make sewer service available. The charge is based on an equivalent unit basis. The method used to calculate the total number of units for any specific property and the current unit charge are based on the Metropolitan Council Environmental Services (MCES) for expected sewage flow from various dwellings or businesses. A listing of the MCES sewer availability charges is available on the Metropolitan Council website: www.metrocouncil.org. This charge may not be assessed against the property. 6. Sanitary Sewer Lateral Benefits Lateral benefit may be provided by connection to trunk, subtrunk or lateral pipes. The calculation of lateral benefit from a trunk or subtrunk pipe will be based on the cost of an eight inch (8") pipe along the same alignment at a depth adequate to provide services to the abutting properties. 7. Infrastructure Rehabilitation Projects Any project or portion of a project that reconstructs an existing sanitary sewer facility. A rehabilitation project may occur on the existing alignment of the sewer line or on a new alignment, thus allowing the existing line to be abandoned or its status downgraded (i.e., trunk or subtrunk to lateral). B. Determining Sanitary Sewer Assessment Rates 1. Sanitary Sewer Interceptor Rates All properties that lie within the approved Service District shall bear the cost of sanitary sewer interceptor projects. The costs shall be spread equally, based on a gross area basis within the Service District, and will be known as an interceptor assessment. 2. Sanitary Sewer Trunk/Subtrunk Rates The lateral and building service assessments described below will be deducted from the total improvement cost to be assessed. The amount remaining after said deductions will be assessed on a gross area basis to all propertied within the Service District, and will be known as a trunk assessment and/or subtrunk assessment. 2004 Assessment Policy – Page 16 3. Sanitary Sewer Lateral Rates The building service assessments described below will be deducted from the total improvement cost to be assessed. The amount remaining after said deductions will be assessed by the following method. The resulting assessment will be known as a lateral benefit assessment. Each assessable unit shall be assessed as follows: ? R-1 and R-2 residential lots at 100% of the total project cost ? All other land uses at 100% of the total project cost 4, Sanitary Sewer Building Service The assessment rate for each size of building service; four inch (4"), six inch (6"), or eight inch (8") shall be determined by adding all the costs associated with each size of service and dividing by the total number of services constructed. Each unit will be assessed at the determined rate for each size and number of services installed. This will be known as the building service assessment. Water Distribution System A. Definitions and General Provisions 1. Water Source and Treatment Facilities The City of Arden Hills purchases water from the City of Roseville to supply the water distribution system. Water enters the system at three (3) separate meter stations. The water purchased from Roseville is treated, and Arden Hill does not add any water treatment to the distribution system. 2. Water Storage Facilities The City of Arden Hills has a total water storage capacity of 1.5 million gallons comprised by two (2) elevated storage tanks. One tank has a capacity of 1.0 million gallons and is located south of I-694 along Red Fox Road. The other storage tank has a capacity of 0.5 million gallons and is located north of I-694 along Fernwood Avenue. 2004 Assessment Policy – Page 17 3. Water Trunk and Subtrunk Distribution Mains A network of pipes and related appurtenances usually in the size range of ten inch (10") to sixteen inch (16"). These pipes are designed to carry large volumes of water and interconnect various point sources of water supply and storage reservoirs. Appurtenances to these facilities would include valves and fittings, but not fire hydrants. 4. Water Main Laterals A network of water pipes and related appurtenances usually six inches (6") or eight inches (8") in size that are installed with approximately eight feet (8') of ground cover to retard freezing and are designed to serve those buildings abutting a given street or easement. Lateral mains are "looped" wherever possible to balance pressures and to provide water from at least two (2) directions so that continuous water service is maintained for most people during a water main break. Looping of lateral mains eliminates dead end water mains that cause a variety of distribution and stagnation problems. Appurtenances to these facilities would include valves, fittings and fire hydrants. 5. Water Main Building Service These pipes lead from laterals (or sometimes from trunk and subtrunk mains) and serve individual buildings abutting thereon. The size of the service usually ranges from three-quarter inch (3/4") to six-inch (6"), depending upon the type of building served. The lines terminate at the property line with a shut off valve and are plugged until such time that the building is connected to the water system. The property owner must make arrangements with a licensed, bonded plumber to complete the service connection. 6. Water Connection Charge This is a charge billed to all properties at the time of connection to the water system. The charge is the individual property share of the cost of the trunk, source, and storage facilities that make water service available. The charge is based on the size of the connection, plus the material and installation cost of a water meter. The current charges are outlined in the City Fee Schedule. Neither of these charges may be assessed against the property. 2004 Assessment Policy – Page 18 7. Water Main Lateral Benefits The benefit resulting to a property abutting or utilizing a water main where a direct connection to that water main via a building service is reasonably possible without additional lateral pipes. Lateral benefit may be provided by connection to trunk, subtrunk or lateral pipes. The calculation of lateral benefit from a trunk or subtrunk pipe will be based on the cost of an eight inch (8") pipe along the same alignment for commercial or industrial zoned property and a six inch (6") pipe for all other areas. 8. Infrastructure Rehabilitation Projects Any project or portion of a project that reconstructs an existing water system facility. A rehabilitation project may occur on the existing alignment of the water line or on a new alignment, thus allowing the existing line to be abandoned or its status downgraded (i.e., trunk or subtrunk to lateral). B. Determining Water Main Assessment Rates 1. Trunk, Subtrunk, Storage and Treatment Facility Rates Any lateral and building service assessments described below will be deducted from the total improvement cost to be assessed. The remaining costs shall be spread equally to all properties that lie within the approved Service District. The costs shall be spread on a gross area basis and will be known as all or any of the following as appropriate: trunk, subtrunk, source, storage, and treatment assessment. 2. Water Main Lateral Rates The building service assessments described below will be deducted from the total improvement cost to be assessed. The amount remaining after said deductions will be assessed by the following method. ? R-1 and R-2 residential lots at 100% of the total project cost ? All other land uses at 100% of the total project cost 3. Water Main Building Service The assessment rate for each size of building service three-quarter inch (3/4") to eight inch (8") inch shall be determined by adding all the costs associated with each size of service and dividing by the total number of services 2004 Assessment Policy – Page 19 constructed. Each unit will be assessed at the determined rate for each size and number of services installed. This will be known as the building service assessment. Storm Sewer A. Definitions and General Provisions 1. Storm Sewer Improvement District The City Council may, at its discretion, construct and finance storm sewer improvements by utilizing a storm sewer tax district, pursuant to Minnesota Statute 444.16 through 444.21. 2. Storm Sewer Trunk Facilities a. Ponds A basin or wetland constructed or naturally located within a permanent easement for the purpose of containing storm runoff. May be a retention (permanent) pond; detention (temporary) pond; or a combination of both. Arden Hills is within the Rice Creek Watershed District (RCWD), which may require additional improvement to control flow discharge from the ponds. The RCWD has a formal permitting process governing pond construction. b. Pipe Network A network of pipes ranging in size generally from thirty inches (30") through seventy-two inches (72"). The trunk pipe networks are designed to collect stormwater runoff from an area generally larger than forty (40) acres. 3. Channels, Ditches and Swales Conveyance network constructed within permanent easements for the purposes of transporting stormwater runoff. 4. Storm Sewer Lateral Facilities A network of pipes ranging in size generally from twelve inches (12") to twenty-seven inches (27") designed to collect stormwater runoff from a specified small area to a trunk facility. The lateral facilities also include street 2004 Assessment Policy – Page 20 overland flow and inlet structures such as catch basins, manholes and flared end sections. 5. Storm Sewer Taxing District A drainage area determined by using topographical maps and surveys that mutually benefit from storm sewer improvements in conformance with Minnesota Statute, Section 444.16 through 444.21 6. Watershed District A formally established area and Board that protects and controls the water management aspects of subdivisions and developments within the region. B. Determining Storm Sewer Assessment Rates 1. Storm Sewer Trunk Rates Design and estimate the total improvement cost of the ultimate trunk system needed to provide complete service to each property in the Service District considered. Also, include the total cost of any existing facilities and/or previous storm sewer assessments to be credited. Determine the base assessment rate by dividing the ultimate system cost described above by the sum total of the following: ? Gross area of low-density residential properties times 1.0. ? Gross area of medium and high density residential, church and school properties times 1.25. ? Gross area of commercial property times 1.5. ? Gross area of industrial property times 2.0. Assessment rates would be set as follows: ? The base rate shall apply to low density residential properties. ? The base rate times 1.25 shall apply to medium and high- density residential, church and school properties. ? The base rate times 1.5 shall apply to commercial property. ? The base rate times 2.0 shall apply to industrial property. Credits may be given for previous storm sewer assessments, existing systems and any future additional construction that may be necessary as determined by 2004 Assessment Policy – Page 21 the City Engineer for complete service to each property. Credit rates for future construction shall be based on current prices. The City may determine that storm sewer trunk cost be assessed to all properties within a respective storm sewer taxing district under Minnesota Statute 444.16 through 444.21 2. Storm Sewer Lateral Rates The lateral storm sewer project costs will be assessed by one of the following methods as determined by the City Council after the project feasibility study. 3. Lot/Equivalent Lot Basis Determine the total number of lots and equivalent lot units receiving lateral benefit and divide the project cost equally among them. ? R-1 and R-2 residential lots at 100% of the total project cost ? All other land uses at 100% of the total project cost B. Municipal State-Aid Construction Fund Contributions When a Municipal State-Aid Street project includes either trunk or lateral storm sewer, which the Minnesota Department of Transportation (MnDOT) determines may be funded by Municipal State-Aid construction funds, the amount determined to be actually funded by MnDOT may be deducted from the total improvement costs to be assessed. C. Infrastructure Reconstruction Projects Any project or portion of a project that reconstructs an existing storm sewer system facility. A reconstruction project may occur in the existing alignment of the storm sewer pipe or on a new alignment, thus allowing the existing line to be abandoned or its status downgraded (i.e., trunk to lateral). All properties with tax exempt status and abutting new street reconstruction, street reconstruction, or bituminous overlay improvements shall be assessed at one hundred percent (100%) of the cost of the improvement. 2004 Assessment Policy – Page 22 Additional Definitions and General Provisions A. Federal, State and County Highways These streets are classified as expressways, freeways, and principal arterials constructed and maintained by the State or County Highway Departments. They will carry large volumes of traffic at peak loading times. B. Minnesota State-Aid (MSA) Streets These are termed collector streets that interconnect other collector streets, State or County highways, or with Minnesota State-Aid streets in the municipality. Municipal State-Aid funds, apportioned from the gasoline tax, are used to help finance the cost of Minnesota State-Aid Street. The design for a Minnesota State-Aid road is dependent on traffic volumes and the urban setting. C. Commercial/Industrial Streets These are streets that generally serve commercial/industrial property. They would typically have a projected traffic volume higher than a residential street. A typical design would be thirty-six feet (36') wide with concrete curb and gutter, and nine (9) tone design in accordance with current MnDOT standards. D. Residential Streets Primarily serve adjoining residents with little or no through traffic. Almost all trips have either an origin or destination on that street. (18.5 miles throughout the City) Street width: Minimum of 28 feet. E. Neighborhood Streets Provide access to residences on that street and provide a route through neighborhood for residents on other streets. A large proportion of trips have neither an origin nor destination on that street. (4.5 miles throughout the City) Street width: Minimum of 30 feet. F. Community Street Provide access to the residences, institutions and businesses on that street, providing a route through the neighborhood or business district for residents of other neighborhoods. (6.0 miles throughout the City) Street width: Case specific, 32 foot minimum. 2004 Assessment Policy – Page 23 G. Special Cases Streets which do not fir into any of the above descriptions and have a very low usage, (1-3 residences); streets which provide secondary access (i.e. alleys); or, streets defined by extreme limitations due to narrow right-of-way, topography, etc. H. Appurtenances 1. Sidewalks The City may require sidewalks or trails on or adjacent to selected streets or in selected subdivisions. 2. Street Lighting The City has a separate plan that indicates where lights are typically installed. Additional street lights or ornamental lights may be installed at the written request of the abutting property owners. 3. Trees Trees and other types of landscaping may be required on selected streets. 4. Seeding/Sod Boulevard restoration by seeding/sodding may be required to prevent erosion. 5. Existing Street Reconstruction Projects Projects that reconstruct existing City streets shall be to the minimum applicable standards for the type of street classification, consistent with the Arden Hills Pavement Management Program (PMP) (as found in the Appendix) 6. Maintenance/Rehabilitation Projects a. Cold in Place Recycling and Repaving (CIR/Repaving) 2004 Assessment Policy – Page 24 Recycling of existing deteriorated pavements by pulverizing, mixing with new asphaltic oils and compacting in place. New paving materials are then placed over the cold recycled pavement similar to a standard overlay. b. Bituminous Overlay Placement of an additional bituminous layer, generally one inch (1") to two inches (2") thick, over an existing bituminous surfaced street. c. Concrete Pavement Restoration Replacement of existing concrete panels that have deteriorated, mudjacking panels to improve rideability, and the filling of joints and cracks with petroleum based material to eliminate flow water to the base below the surface. d. Crack Sealing Placement of petroleum based material in the cracks of a bituminous surfaced street for the purpose of eliminating the flow of water from the surface to the aggregate base material blow. e. Bituminous Seal Coating Placement of petroleum based material and aggregate on an existing bituminous surfaced street for the purpose of filling cracks and covering mild wear. f. Bituminous Surfacing Patching Repair or replacement of existing bituminous surfacing that has deteriorated. \\Earth\Finance\FinanceDirector\APTF\2004Assessment Policy: Revised 9/1/04 2004 Assessment Policy – Page 25 The City of Arden Hills appreciates and acknowledges all the contributions made by the Assessment Policy Task Force in the drafting of this document. The City acknowledges the following individuals who served on the Task Force: Gerald Garski Bill Gillies Jim Holden Andy Holewa Raymond McGraw Charles Stoddard David Grant (Council Liaison) Gregg Larson (Council Liaison) Murtuza Siddiqui, Finance Director (staff liaison) Tom Moore, Operations and Maintenance Director (staff liaison) ________________________________________________________________________________________________________ Page 1 of 3 PUBLIC HEARING – 8C MEMORANDUM DATE: August 23, 2021 TO: Honorable Mayor and City Councilmembers Dave Perrault, City Administrator FROM: Jessica Jagoe, Senior Planner SUBJECT: Planning Case # 21-017 – Public Hearing Required Applicant: ISD #621 – Mounds View Public Schools Property Location: 1900 and 1901 Lake Valentine Road Request: Planned Unit Development Amendment Budgeted Amount: Actual Amount: Funding Source: N/A N/A N/A Council Should Consider the Following: Hold the required public hearing for Planning Case 21-017 for application for a Planned Unit Development Amendment for an extension for the timing of construction of road and safety improvements as it relates to the alignment of Lake Valentine Road at 1900 and 1901 Lake Valentine Road. The City Council will be asked to make a formal decision regarding the application under Agenda Item 9C. Background 1. Planned Unit Development At the May 22, 2019 and subsequently amended on April 27, 2020, the City Council approved Planning Case 18-014 for a Planned Unit Development with Mounds View Public Schools for Mounds View High School. The amendment added 14 additional conditions to the existing Planned Unit Development to address existing traffic and pedestrian safety issues based on the findings contained within the study report, an evaluation of existing site conditions, and the Planned Unit Development Agreement. The terms of the PUD approval requires the School District to implement safety improvements on Lake Valentine Road to address traffic and increased pedestrian crossings between the school building and the north parking lot, including installation of turn lanes and other access improvements, trail and sidewalk improvements, pedestrian signal, signage and striping modifications, and drainage and utility improvements. The Applicant originally proposed two separate phases of traffic and pedestrian safety improvements for Lake Valentine Road. Phase 1 safety improvements, installed in 2020, which Page 2 of 3 included installation of a pedestrian traffic signal system, crosswalk markings, temporary painted center median, curb ramps and sidewalk pedestrian routes to the front of the school. The Phase 2 traffic and pedestrian safety improvements were scheduled for construction in 2021 in order to allow the School District to acquire additional property from the State of Minnesota. This additional property would allow the relocation of the west entrance to the north parking lot to align with the drop-off/pick-up lot on the south side of Lake Valentine Road. Additional improvements include construction of a center median at the crosswalk, modifications to the south boundary of the north parking lot, and the construction of dedicated right turn lanes for westbound traffic accessing the east parking lot entrance and for the eastbound traffic accessing the drop- off/pick-up lot. 2. Overview of Request The Applicant has been working with the State of Minnesota for nearly two years on purchasing property, but has been unsuccessful in obtaining an easement or acquisition of land. The State has indicated they are at least another year out in considering the sale of this land. The Applicant believes this option is no longer feasible and is preparing an alternate design. The City Council reviewed this issue at the May 17, 2021, work session (Attachment D). The Council noted the use of the State property is preferred; however, they understand there is no guarantee the school district will be able to purchase that land. Safety is the most important factor. The Applicant will submit an application for the revised improvements to the City later this year. The current schedule in the approved PUD does not allow the School District sufficient time for completion in 2021 due to design changes for realignment on school district land. The Applicant is requesting the City Council consider an extension of the deadline to 2022. The Applicant has provided the following as a proposed extended schedule: • October 2021 – City Submittal • January 2022 – Issue Construction Documents • June 2022 – Begin Construction • Mid-August 2022 – Substantial Completion This extension will allow further review and examination of vehicle counts and flows to develop a more-refined plan for the safety improvements. In addition, the School District plans to take into account the feedback of the City Council with regards to the Mounds View High School pick-up and drop-off operations before and after school. Application Review 1. 1355.04 Procedural Requirements for Specific Applications A public hearing for a PUD Amendment request is required before the request can be brought before the City Council. The applicant or its representative shall be given the opportunity to appear before the Planning Commission to answer questions or give explanations regarding the proposal. Upon completion of the public hearing and its study and consideration of the application, the Planning Commission shall submit its written report, containing its findings, conclusions, and recommendations as to the application, to the City Council. Page 3 of 3 Under Section 1355.06 subd.4, an application for an amendment shall be administered in the same manner as required for a new application. Any structural alteration, enlargement or intensification change in site plan, or similar change not specially permitted, shall require City Council action and all procedures shall apply as if a new application were being requested; provided, however, that when such changes are deemed to be insignificant by the Zoning Administrator, the requirements of a public hearing may be waived. Public Notice and Comments A Notice was published in the Pioneer Press on August 12, 2021. Notice and website was prepared by the City and mailed to property owners within 1,000 feet of the subject property. As of August 17, 2021, Staff has not received any public comment regarding this case following this notice. The Planning Commission received one public comment in advance of the public hearing (Attachment E). Attachments A. Land Use Application B. Location Map C. Narrative D. May 17, 2021 City Council Work Session Minutes E. PC Public Hearing Comment F. Planning Commission Memo G. Draft Planning Commission Minutes H. Presentation Disclaimer: This map is intended for reference purposes only and is not a legally recorded map or survey. The City of Arden Hills shall not be liable for any damages or claims that arise due to accuracy, availability, use or misuse of the information herein pursuant to MN Statute 466.03 Subd 21. Interstate 694 Lake Vale n t i n e R o a d Venus A v e n u e Gramsie Road Glenview AvenueFairview Avenue NorthCrystal Avenue Janet Court NB I35W To EB I694 Dellview AvenueValentine Crest Road WB I694 To N B I 3 5 W Rolling Hills RoadInterstate 694 Fairview Avenue NorthSubject Parcel Park and Open Space Location Map §¨¦35W §¨¦694 £¤10Lexington Ave. N± $WWDFKPHQW% ARDEN HILLS CITY COUNCIL WORK SESSION – MAY 17, 2021 5 Mayor Grant would also like to see the concrete sidewalk. Mayor Grant recapped that they were good with parking, setback line, probably OK with windows, concerns about building materials, and they’d like to see a concrete sidewalk. Councilmember Scott added that he’d be thrilled to see a business relocate from downtown. Further discussion ensued regarding parking spaces. B. MVHS PUD Update/Crossing Light Planning Consultant Kansier stated that Mounds View High School is asking for input on a potential amendment to the Lake Valentine Road layout and to the timing of construction. A PUD was approved in 2019, in order to develop property on the north side of Lake Valentine Road in conjunction with the high school remodeling. Most of the parking was moved to the north parking lot. There was a lot of discussion about traffic and pedestrian issues and the improvements that needed to be made. The pedestrian signals were installed last year. The final piece is changes to the road configuration. Originally the access road was to be moved to the west to provide a better alignment. The School District has been working with the State on the property purchase, the State has indicated they are at another year out in considering the sale of this land. In light of that, the School District would like to discuss a revised layout for the Lake Valentine Road improvements. The current timing, for either the approved or revised alignment, does not allow the School District to complete this construction in 2021. The applicant is also requesting the Council consider extending this deadline to 2022. Councilmember Holmes wondered if they were trying to move the parent drop off farther east to line up with the parking lot exit. Wold Architects Partner Aplikowski said the primary revision is the access to the turnaround on the south side of the road to be relocated about 70 feet to the east to line up with the driveway on the north. He noted that the process of buying the land from the State is going so slow that they are fearful that if they wait another year they still won’t get answers. Mr. Aplikowski explained that the only real changes from the last plan that was approved was that the driveway on the parking lot side was going to move west, and the existing driveway would stay where it was. The new version brings both of those driveways to the east. Alignment across the street was always a concern and they hope to facilitate that within the property the school district owns. The driveway on the school district property will be a little steeper, but manageable and stacking headed west will get shortened slightly. Councilmember Holmes wondered if they realized there was still a crosswalk painted on the road and people are crossing there. She felt people were crossing there and not crossing at the light. Mounds View School District Director of Facilities Paquette said he has no problem working with contractors to get the crosswalk blacked out. Mounds View School District Representative Schwartz said they currently have two dismissal times, and the majority of kids leave the building at 2:45, and cross at the light. He reviewed the ARDEN HILLS CITY COUNCIL WORK SESSION – MAY 17, 2021 6 numbers of people he counted crossing at the light during different time periods and felt most students cross at the light. Councilmember Scott agreed the old crosswalk markings should be removed. Councilmember Holden suggested they make removal of the old crosswalk a part of the approval. Mr. Paquette said he could have it removed right away. Mayor Grant asked how they could stop students parking on the west side from crossing where they want. Mr. Schwartz replied that it takes time and training but the kids will do what they tell them. Unfortunately, it’s more adults that cross there than students. He can get more firm with them. Mr. Paquette added that at the last meeting they had with the State they thought it would be another nine to 12 months before they would review it, and couldn’t guarantee there would be a sale. The school district would like to get the rest of the project done within their own property, along with reroofing and residing the former bus garage and the parking lot cleaned up. Councilmember Holden asked for an explanation of how much safer completing the project this way would be versus with the State property. Bolton and Menk Traffic Engineer Bongard said the average queue westbound into the site during site observations was one or two vehicles and the maximum was five. From what they see it is functioning well and the patrol officer on site is optimistic about how traffic is moving. Relocating the access further to the west on the State site was the preferred option, but with the current locations with the driveways offset makes for a little uncomfortableness for people trying to turn left from the west to east because of the overlap. Eastbound into the site will be cleaner with dedicated right and left turn lanes. After revisiting options after receiving the news on the State site they feel the current proposal is the best option. Councilmember Holden wondered if it was worth making this change now or wait until they acquire the State property and do it right for the long term. Mayor Grant said if they could educate the kids to use the appropriate crossing, then why would they not wait to buy the property from the State. Mr. Paquette responded that there is no guarantee that they get the property, so they would be back at square one. They would like to get the turn lane changes done, so if the City accepts the plan they are putting forth they could stop pursuing the State land. Mayor Grant asked if they would be losing parking stalls in the general area. Bolton & Menk Traffic Engineer Bongard said he didn’t have an exact answer but he will quantify the parking counts when they come back with a full plan. ARDEN HILLS CITY COUNCIL WORK SESSION – MAY 17, 2021 7 Councilmember Holden would like to stipulate that if they get the State property they have no left hand turns out of the parking lot as they exist now. Mr. Paquette clarified that if the Council approves the solution being presented they won’t pursue the State property. Councilmember McClung said his preference would be to get the State land, but he would begrudgingly agree that this is probably the best alternative, although not as safe. Councilmember Holmes asked if traffic was held and stopped for all the buses to leave, and asked for clarification. Mr. Schwartz said in the morning the buses drop and go, and in the afternoon they depart at approximately 3:14, are out in 90 seconds. If buses are queued in the morning they will stop traffic to let them in. They don’t have room to back up so they all have to leave at the same time in the afternoon. Mayor Grant summarized that some want to evaluate this further when it comes forward but have concerns. Several would have liked to see the State property be used. Pedestrian safety is still the goal, along with traffic flow. Mr. Schwartz said the timeline is a problem, they want to get it completed by the end of next summer, and go one more year as is. C. Speed Limit on City Streets HR Green Regional Transportation Director Morast explained that the Minnesota Legislature changed the local road speed limit rules in August, 2019. In the new process, Cities now can lower speed limits only on City streets. Cities must develop procedures to set limits based on safey, engineering and traffic analysis. Surrounding cities have made some changes, the biggest being St. Anthony Village. They changed to 25 mph right away, Public Works made and installed the signs. Falcon Heights is looking at changing or reducing speed limits. Other cities are waiting for a variety of reasons. The City of Minneapolis decided in March, 2020, reduced speed limits in November and launched a Slower is Safer campaign. St. Paul essentially did the same, passing their ordinance in October 2019. The Minnesota Local Road Research Board (LRRB) has two studies underway. They are studying guidelines for determining speed limits on municipal roadways, and the impact of speed limit changes on urban streets. Arden Hills can choose to do nothing and make no changes, reduce City speed limits to 25 mph, wait for the LRRB study results, wait for other cities to act, do safety, engineering and traffic analysis or develop procedures to reduce speed limits. Councilmember Holden wondered why the City would need a safety, engineering and traffic study. Mr. Morast replied that the analysis was required in the Statute. Not all streets would need to be lowered, the analysis would help with determining that. Councilmember Holmes asked when the studies will be completed. $WWDFKPHQW( Page 1 of 4 PC Agenda Item – 3B MEMORANDUM DATE: August 4, 2021 TO: Planning Commission Chair and Commissioners FROM: Jessica Jagoe, Senior Planner SUBJECT: Planning Case #21-017 – Public Hearing Required Applicant: ISD #621: Mounds View Public Schools Property Location: 1900 and 1901 Lake Valentine Road Request: PUD Amendment Requested Action Mounds View Public Schools (“The Applicant”) the applicant is requesting a Planned Unit Development (PUD) Amendment for an extension for the timing of construction of road and safety improvements as it relates to the alignment of Lake Valentine Road at 1900 and 1901 Lake Valentine Road. Background 1. Planned Unit Development At their May 22, 2019 and subsequently amended on April 27, 2020, the City Council approved Planning Case 18-014 for a Planned Unit Development with Mounds View Public Schools for Mounds View High School. The amendment added 14 additional conditions to the existing Planned Unit Development to address existing traffic and pedestrian safety issues based on the findings contained within the study report, an evaluation of existing site conditions, and the Planned Unit Development Agreement. The terms of the PUD approval requires the School District to implement safety improvements on Lake Valentine Road to address traffic and increased pedestrian crossings between the school building and the north parking lot, including installation of turn lanes and other access improvements, trail and sidewalk improvements, pedestrian signal, signage and striping modifications, and drainage and utility improvements. The Applicant originally proposed two separate phases of traffic and pedestrian safety improvements for Lake Valentine Road. Phase 1 safety improvements, installed in 2020, which included installation of a pedestrian traffic signal system, crosswalk markings, temporary painted center median, curb ramps and sidewalk pedestrian routes to the front of the school. Page 2 of 4 The Phase 2 traffic and pedestrian safety improvements were scheduled for construction in 2021 in order to allow the School District to acquire additional property from the State of Minnesota. This additional property would allow the relocation of the west entrance to the north parking lot to align with the drop-off/pick-up lot on the south side of Lake Valentine Road. Additional improvements include construction of a center median at the crosswalk, modifications to the south boundary of the north parking lot, and the construction of dedicated right turn lanes for westbound traffic accessing the east parking lot entrance and for the eastbound traffic accessing the drop - off/pick-up lot. 2. Overview of Request The Applicant has been working with the State of Minnesota for nearly two years on purchasing property, but has been unsuccessful in obtaining an easement or acquisition of land. The State has indicated they are at least another year out in considering the sale of this land. The Applicant believes this option is no longer feasible and is preparing an alternate design. The City Council reviewed this issue at their May 17, 2021, workshop. The Council noted the use of the State property is preferred; however, they understand there is no guarantee the school district will be able to purchase that land. Safety is the most important factor. The applicant will submit an application for the revised improvements to the City later this year. The current schedule in the approved PUD does not allow the School District sufficient time for completion in 2021 due to design changes for realignment on school district land. The Applicant is requesting the Planning Commission consider an extension of the deadline to 2022. The Applicant has provided the following as a proposed extended schedule:  October 2021 – City Submittal  January 2022 – Issue Construction Documents  June 2022 – Begin Construction  Mid-August 2022 – Substantial Completion This extension will allow further review and examination of vehicle counts and flows to develop a more-refined plan for the safety improvements. In addition, the School District plans to take into account the feedback of the City Council with regards to the Mounds View High School pick -up and drop-off operations before and after school. Application Review 1. 1355.04 Procedural Requirements for Specific Applications A public hearing for a PUD Amendment request is required before the request can be brought before the City Council. The applicant or its representative shall be given the opportunity to appear before the Planning Commission to answer questions or give explanations regarding the proposal. Upon completion of the public hearing and its study and consideration of the application, the Planning Commission shall submit its written report, containing its findings, conclusions, and recommendations as to the application, to the City Council. Page 3 of 4 Under Section 1355.06 subd.4, an application for an amendment shall be administered in the same manner as required for a new application. Any structural alteration, enlargement or intensification change in site plan, or similar change not specially permitted, shall require City Council action and all procedures shall apply as if a new application were being requested; provided, however, that when such changes are deemed to be insignificant by the Zoning Administrator, the requirements of a public hearing may be waived. Findings of Fact The Planning Commission must make a finding as to whether or not the proposed application would adversely affect the surrounding neighborhood or the community as a whole based on the aforementioned factors. Staff offers the following findings for consideration: 1. The properties located at 1900 and 1901 Lake Valentine Road are located in the R-1 Single Family Residential District. 2. The proposed conditions when implemented will create a safer environment for pedestrian movement across Lake Valentine Road. 3. The proposed roadway improvements will improve traffic flow through the road section adjacent to the school. 4. With the applied conditions, the application is not anticipated to create a negative impact on the immediate area or the community as a whole. 5. The traffic and pedestrian study was reviewed as part of the April 2020 Amended PUD application by City and School District staff. 6. The City and School District staff concur on the proposed conditions and recommended improvements. Proposed Motion Language Staff has provided the following options and motion language for this case. 1. Recommend Approval with Conditions: Motion to recommend approval of Planning Case 21- 017 for an Amended PUD at 1900 and 1901 Lake Valentine Road, based on the findings of fact, as amended by the conditions in the August 4, 2021, Report to the Planning Commission: a) Extension on timeline for construction and realignment of the west parking lot entrance to align with the west school site entrance on the south side of Lake Valentine Road (Pick-up / Drop-off Access) to be completed prior to the start of the 2022-2023 school year. The School District shall submit a revised design and layout for the road and safety improvements on existing school property Site Plan Review and approval no later than December 31, 2021. b) All other conditions of the original Planned Unit Development and Amended Planned Unit Development shall remain in full force and effect. 2. Recommend Approval without Conditions: Motion to recommend approval of Planning Case 21-017 for an Amended PUD at 1900 and 1901 Lake Valentine Road, based on the findings of fact and recommendations based on the recommendations contained within the traffic study. Page 4 of 4 3. Recommend Denial: Motion to recommend denial of Planning Case 21-017 for an Amended PUD at 1900 and 1901 Lake Valentine Road, based on the following findings of fact: findings to deny should specifically reference the reasons for denial and why those reasons cannot be mitigated. 4. Table: Motion to table Planning Case 21-017 for an Amended PUD at 1900 and 1901 Lake Valentine Road for the following reasons: a specific reason and/or information request should be included with a motion to table. Public Notice and Comments Notice was published in the Pioneer Press on July 22, 2021. Notice and website was prepared by the City and mailed to property owners within 1,000 feet of the subject property. Deadline for Agency Actions The City of Arden Hills received the completed application for this request on July 13, 2021. Pursuant to Minnesota State Statute, the City must act on this request by September 11, 2021 (60 days), unless the City provides the petitioner with written reasons for an additional 60-day review period. With consent of the applicant, the City may extend the review period beyond the initial 120 days. Attachments A. Land Use Application B. Location Map C. Narrative D. Minutes ARDEN HILLS PLANNING COMMISSION –August 4, 2021 5 Commissioner Wicklund moved and Commissioner Weber seconded a motion to recommend approval of Planning Case 21-016 for Site Plan Review at 3900 Bethel Drive based on the findings of fact and the submitted plans, as amended by the conditions in the August 4, 2021, report to the Planning Commission. A roll call vote was taken. The motion carried unanimously (5-0). B. Planning Case 21-017; Mounds View Public Schools –Amendment to the Approved Planned Unit Development –Public Hearing Senior Planner Jagoe stated Mounds View Public Schools (“The Applicant”) the Applicant is requesting a Planned Unit Development (PUD) Amendment for an extension for the timing of construction of road and safety improvements as it relates to the alignment of Lake Valentine Road at 1900 and 1901 Lake Valentine Road. Senior Planner Jagoe explained at their May 22, 2019 and subsequently amended on April 27, 2020, the City Council approved Planning Case 18-014 for a Planned Unit Development with Mounds View Public Schools for Mounds View High School. The amendment added 14 additional conditions to the existing Planned Unit Development to address existing traffic and pedestrian safety issues based on the findings contained within the study report, an evaluation of existing site conditions, and the Planned Unit Development Agreement. The terms of the PUD approval requires the School District to implement safety improvements on Lake Valentine Road to address traffic and increased pedestrian crossings between the school building and the north parking lot, including installation of turn lanes and other access improvements, trail and sidewalk improvements, pedestrian signal, signage and striping modifications, and drainage and utility improvements. Senior Planner Jagoe reported the Applicant originally proposed two separate phases of traffic and pedestrian safety improvements for Lake Valentine Road. Phase 1 safety improvements, installed in 2020, which included installation of a pedestrian traffic signal system, crosswalk markings, temporary painted center median, curb ramps and sidewalk pedestrian routes to the front of the school. Senior Planner Jagoe commented the Phase 2 traffic and pedestrian safety improvements were scheduled for construction in 2021 in order to allow the School District to acquire additional property from the State of Minnesota. This additional property would allow the relocation of the west entrance to the north parking lot to align with the drop-off/pick-up lot on the south side of Lake Valentine Road. Additional improvements include construction of a center median at the crosswalk, modifications to the south boundary of the north parking lot, and the construction of dedicated right turn lanes for westbound traffic accessing the east parking lot entrance and for the eastbound traffic accessing the drop-off/pick-up lot. The current schedule in the approved PUD does not allow the School District sufficient time for completion in 2021 due to design changes for realignment on school district land. Senior Planner Jagoe reviewed the surrounding area, the Plan Evaluation and provided the Findings of Fact for review:DRAFTApplicantApplica an extension foan exte the alignment of Lathe alignm 9 and subsequently amended on9 and subsequently amended --014 for a Planned Unit Deve014 for a Planned Unit Deve iew High School. The amendw High School Unit Development to address evelopmen ngs contained within the study rngs contained within d Unit Development AgreemenUnit Development Agre to implement safety improvemeplement safety improvem edestrian crosscrosings between thegs between th on of turn lanes and other accesson of turn lanes and other access ignal, signage and striping moignal, signage and stri goe reported the Applicant origeported the Applicant orig safety improvements for Lake afety improvemen 020, which included installatio020, which included in temporary painted center meditemporary painted center me he school.he sc er Jagoeer Jag commentemmen onstructiononstruction in in tate of Mtate of M oror Planning Case 21-017;Mounds View Public Schools –Amendment to the Approved Planned Unit Development –Public Hearing $WWDFKPHQW* ARDEN HILLS PLANNING COMMISSION –August 4, 2021 6 1. The properties located at 1900 and 1901 Lake Valentine Road are located in the R-1 Single Family Residential District. 2. The proposed conditions when implemented will create a safer environment for pedestrian movement across Lake Valentine Road. 3. The proposed roadway improvements will improve traffic flow through the road section adjacent to the school. 4. With the applied conditions, the application is not anticipated to create a negative impact on the immediate area or the community as a whole. 5. The traffic and pedestrian study was reviewed as part of the April 2020 Amended PUD application by City and School District staff. 6. The City and School District staff concur on the proposed conditions and recommended improvements. Senior Planner Jagoe stated staff recommends approval of Planning Case 21- 017 for an Amended PUD at 1900 and 1901 Lake Valentine Road, based on the findings of fact, as amended by the conditions in the August 4, 2021, Report to the Planning Commission: a) Extension on timeline for construction and realignment of the west parking lot entrance to align with the west school site entrance on the south side of Lake Valentine Road (Pick- up / Drop-off Access) to be completed prior to the start of the 2022-2023 school year. The School District shall submit a revised design and layout for the road and safety improvements on existing school property Site Plan Review and approval no later than December 31, 2021. b) All other conditions of the original Planned Unit Development and Amended Planned Unit Development shall remain in full force and effect. Senior Planner Jagoe reviewed the options available to the Planning Commission on this matter: 1. Recommend Approval with Conditions 2. Recommend Approval as Submitted 3. Recommend Denial 4. Table Chair Vijums opened the floor to Commissioner comments. Commissioner Zimmerman stated he was happy to see this project being completed and he hoped this would address the concerns he has had with pedestrian and student safety. Commissioner Weber questioned if the plans change because the school district is unable to acquire the land from the State if this item would come back to the City. Senior Planner Jagoe explained this timing was addressed in the recommended conditions for approval and noted revised plans would have to come back to the City. Chair Vijums requested comment from the school district regarding this matter.DRAFTnditions nditio of Planning Case 21of Planning Ca -0 ad, based on the findings of ad, based on the find rt to the Planning Commission:rt to the Planning Commissio d realignment of the west parkinealignment of th e on the south side of Lake Va south sid ed prior to the start of the 2022ed prior to the start o revised design and layout frevised design and lay hool property Site Plan Reviewproperty Site Plan Review the original Planned Unit Devthe original Planned Unit Dev all remain in full force and effeall remain in full force ee reviewed the oreviewed the options availaptions avail mmend Approval with Conditionmmend Approval with C commend Approval as Submittecommend Approval as Submi Recommend DenialRecom bleble penedpened the flooe floo erer ARDEN HILLS PLANNING COMMISSION –August 4, 2021 7 Paul Apilkowski, Wold Architects and Engineers, stated he was a representative for the school district. He reported he was asking for an extension and noted the project could not be completed in 30 days. He explained initial sketches have been submitted to staff and the basic concept was the school district does not believe they will get the land in a timely manner. He commented the plan was to align the driveways within school district land. Commissioner Jefferys thanked the school district for this explanation. She asked what the State’s explanation was for not responding to the school district’s request. Chris Pawket, Mounds View Public Schools, stated he has had several representatives speak with the State over the past two years. He indicated the State keeps pushing the school district off and there was no guarantee the school district could acquire the land. Commissioner Jefferys commented she was glad this project was moving forward but wondered if the school district should move forward on a dual track, in order to continue pursuing the State land, if this was the best option. Chair Vijums stated he supported the extension and understood the State does not appear to want to move forward with the land sale. He looked forward to seeing the new plans at some point in the future. Chair Vijums opened the public hearing at 7:14 p.m. Chair Vijums invited anyone for or against the application to come forward and make comment. There being no comment Chair Vijums closed the public hearing at 7:14 p.m. Commissioner Wicklund moved and Commissioner Zimmerman seconded a motion to recommend approval of Planning Case 21-017 for an Amended Planned Unit Development at 1900 and 1901 Lake Valentine Road based on the findings of fact and the submitted plans, as amended by the conditions in the August 4, 2021, report to the Planning Commission. A roll call vote was taken. The motion carried unanimously (5-0). C. Planning Case 21-018; Zoning Code Amendment to Section 1355 (Shoreland) Regarding Classification of Lakes –Public Hearing Senior Planner Jagoe stated the City of Arden Hills is proposing an amendment to the language Section 1330.02 Subd. 1 of the Arden Hills City Code to amend the lake classification for Little Johanna from a Recreational Development Lake to a General Development Lake. The lake reclassification will amend ordinance language to be consistent with Resolution 85-22 passed by the City Council. The ordinance amendment is an administrative action in accordance with previous approval by the City Council that will clean up lake classification designation. Senior Planner Jagoe explained lake classification is used to determine lot size, setbacks and, to a certain degree, land uses on adjacent land. The classification does not pertain to surface water use of boats or motors, hunting or fishing or fish management. Those are governed by other regulations. Minnesota Rule 6120.3000 Subp. 1a. identifies the types of public water classes with DRAFTral ral ushing theushing d. d. ct was moving forward but ct was moving for , in order to continue pursuing , in order to continue pu n and understood the State doand understood e looked forward to seeing the forward t ring at 7:t 7:141 p.m.p.m. for or against the application to cfor or against the application to c Chair VijumsChair Vijums closed the publicclosed the pu cklund nd moved and Commismoved and Commis DRproval of Planning Case roval of Planning 21-01 DR1901 Lake Valentine Road 1901 Lake Valentine b DRamended by the conditionsamended by the conditionDRsion. sion. A roll call vote was takote was takDanning anning Case 2121--001 rding Classifrding Classif •Planning Case #21-017 –Public Hearing Required •Applicant: ISD #621 –Mounds View Public Schools •Request: Planned Unit Development Amendment •Planning Case 18-014 –Planned Unit Development Approved May 22, 2019 & Amended April 27, 2020. •PUD requires the safety improvements on Lake Valentine Road to address traffic and increased pedestrian crossings between the school building and the north parking lot to be completed prior to the 2021-2022 school year. •Phase 1 safety improvements, installed in 2020, included installation of a pedestrian traffic signal system, crosswalk markings, temporary painted center median, curb ramps and sidewalk pedestrian routes to the front of the school. •Phase 2 was scheduled for construction in 2021 in order to provide time to potentially acquire additional property from the State of Minnesota. •The School District has been unsuccessful the past 2 years in obtaining an easement or acquisition of land. The Applicant believes this option is no longer feasible and is preparing an alternate design. Background October 2021 –City Submittal January 2022 –Issue Construction Documents June 2022 –Begin Construction Mid-August –Substantial Completion Proposed Extended Schedule Public Notices - •A Notice was published in the Pioneer Press on August 12, 2021. Notice and website was prepared by the City and mailed to property owners within 1,000 feet of the subject property. •No public comment has been received following this notice. •The Planning Commission received one public comment in advance of the public hearing. “Unfortunately I will be out of town and unable to attend, but wanted to share how thankful I am to you and the planning commission to continue to advance this project forward.In living on Lake Valentine Road for the past six years, I have watched countless kids walk to Moundsview high school in all sorts of weather trying to make sure that they don't get hit by traffic.I've also seen runners from Bethel and Moundsview almost get hit trying to make their way on the road.I'm very excited for this project and thank you for all your work on it.” Planning Case 21-017 –Mounds View Public Schools PUD Amendment Questions? Page 1 of 3 PUBLIC HEARING – 8D MEMORANDUM DATE: August 23, 2021 TO: Honorable Mayor and City Councilmembers Dave Perrault, City Administrator FROM: Jessica Jagoe, Senior Planner SUBJECT: Planning Case #21-018 – Public Hearing Required Applicant: City of Arden Hills Request: Zoning Code Amendment – Chapter 13 – Section 1330.02 Subd. 1 Budgeted Amount: Actual Amount: Funding Source: N/A N/A N/A Council Should Consider • Hold the required public hearing for Planning Case 21-018, an application for an amendment to the language in Section 1330.02 Subd. 1 of the Arden Hills City Code to amend the lake classification for Little Johanna from a Recreational Development Lake to a General Development Lake. The City Council will be asked to make a formal decision regarding the application under Agenda Item 9D. Background Earlier this year, the City Council had reviewed a variance request to construct an accessory structure near the shoreline along Lake Johanna and amended the Shoreland Regulations to permit accessory structures within the required structure setback from the ordinary high water level of up to 100 square feet in size and 8 feet in height. During those planning case reviews it was discovered that there was a discrepancy between the City’s shoreland lake classification for Lake Johanna and Little Johanna from the designation of the Minnesota Department of Natural Resources (DNR). Upon further research it was determined that action the City Council had taken in May 1985 approving Resolution 85-22 (Attachment A) was never formally processed and approved by the DNR. This resolution had either not been submitted to the DNR or was misplaced in processing on their end. The formal request of Resolution 85-22 to the DNR was for shoreland reclassification of Lake Johanna, Little Johanna Lake, and Karth Lake from Recreational Development to General Development. Page 2 of 3 This past month City Staff contacted Dan Scollan, East Metro Area Hydrologist with the DNR, regarding next steps and available options for proceeding with Resolution 85-22. Mr. Scollan had indicated that the DNR had reviewed the 1984/85 documentation and would proceed with approval of Resolution 85-22 as submitted. Their decision in support of the reclassifications is the result of the lake classification factors having not appreciably changed since 1985. Looking at all of the classification criteria holistically, the DNR still agreed with the City’s reasoning presented in 1985 and concurred that the area development is still consistent with the 1985 Council request as outlined. At the June 7, 2021, City Council Special Work Session, staff was given direction to submit Resolution 85-22 to the DNR as approved on May 13, 1985. This action necessitated an ordinance amendment to Section 1330.02 Subd. 1, Classification of Lakes to classify Little Johanna as General Development. The City received approval of Resolution 85-22 by the DNR on June 23, 2021 (Attachment B). Shoreland Ordinance Background The City’s first ordinance adoption for shoreland requirements was in September 1985, Ordinance No. 237, which was previously referred to as “Arden Hills Shoreland Management Ordinance”. This ordinance incorporated the language and lake classifications as recommended in the May 1985 resolution. The most substantive update of the shoreland ordinance occurred in February 2010. This ordinance review was intended to address a number of holes that still remained unaddressed after an earlier update in 2002. During this process the City conducted an extensive review of development regulations including, but not exclusive to, exceptions to OHW setbacks, wetland setbacks, accessory structure allowances, additional definitions, removal of vegetation and grading and filling standards in order to gain a greater consistency with the DNR guidelines. This research did not involve discussion of lake classifications. However, incorporated into this ordinance amendment Little Johanna was shifted to a Recreational Development Lake. It is suspected that the inconsistency in lake classification was caught as part of that review and amended to reflect DNR categorization. Again, the inconsistency between the City and DNR was due to the failure to finalize processing of Resolution 85-22. Discussion As a result of previous discussions, Staff has drafted the following language amending Section 1330.02 Subd. 1. under the Arden Hills City Code (Attachment C). This language reclassifies Little Johanna from a Recreational Development Lake to a General Development Lake consistent with Resolution 85-22 passed by the City Council. Page 3 of 3 Public Notice and Comments A Zoning Code Amendment requires a public hearing. A public hearing notice for this planning case was published in the Pioneer Press on August 12, 2021. Notice and website was prepared by the City and mailed to property owners within 1,000 feet of the subject waterbody. As of August 17, 2021, Staff has not received any public comments regarding this case. A preliminary request for comment of shoreland ordinance amendment was sent to the DNR on July 26, 2021. The City received a conditional approval on July 28, 2021 (Attachment D). City staff would submit for final approval upon adoption of the ordinance amendment. Attachments A. Resolution 85-22 B. DNR Shoreland Reclassification Letter C. Draft Ordinance 2021-007 D. DNR Comments E. Planning Commission Memo F. Draft Planning Commission Minutes G. Presentation Page 1 June 23, 2021 Jessica Jagoe City of Arden Hills Senior Planner 1245 W Highway 96 Arden Hills, MN 55112 RE: Shoreland Classification Status of Johanna, Little Johanna, and Karth Lakes Dear Ms. Jagoe, The City of Arden Hills and the DNR have been in periodic communication concerning the classifications of lakes Johanna (Lake ID Number 62007800), Little Johanna (62005800), and Karth (62007200) since 1984. At that time, the City requested that the shoreland classification for Lake Johanna, as well as Little Johanna Lake (62005800) and Karth Lake (62007200), be changed from their original Recreational Development (RD) classifications to General Development (GD). The City presented evidence and justification in support of the reclassifications to GD. DNR agreed with the City’s reasoning, and responded with a letter to the City informing them that the request would be approved when DNR received notice of a resolution from the City requesting the reclassification, as required by Minnesota Rule Part 6120.3000 Subpart 3. DNR still concurs with the reasoning supporting the requested reclassifications of these three lakes made in 1984 and is ready to officially adopt the new classifications. The DNR considers the recent City Council actions, as well as the provision of the original resolution passed in 1985 (Resolution 85-22), to be sufficient official acknowledgement of the City’s request. Therefore, the DNR now considers these lakes to be officially reclassified: Lake Name Lake ID Number Old DNR Classification New DNR Classification Johanna 62007800 Recreational Development General Development Little Johanna 62005800 Recreational Development General Development Karth 62007200 Recreational Development General Development A shoreland ordinance is an important land use regulation that helps to protect surface water quality, near shore habitat, and shoreland aesthetics of Minnesota's public waters. We appreciate your efforts to protect these resources for all present and future Minnesotans. Area Hydrologist Dan Scollan is available to assist with shoreland ordinance technical guidance and to consult you on other land and water-related projects. Page 2 Sincerely, Dan Lais Regional Manager, Ecological & Water Resources Division Attachments: Resolution No. 85-22, 05/13/1985 Wehrman Counsultants Associated Inc. to DNR, 12/26/1984 c: Dan Scollan, DNR East Metro Area Hydrologist John (Jack) Gleason, DNR Hydrologist Supervisor Kathy Metzker, DNR Land Use Program Hydrologist Dan Petrik, DNR Land Use Program Specialist Page 1 of 2 ORDINANCE NO. 2021-007 CITY OF ARDEN HILLS RAMSEY COUNTY, MINNESOTA AN ORDINANCE AMENDING CHAPTER 13, ZONING CODE, SECTION 1330, SUBSECTION 1330.02, SUBD. 1 OF THE ARDEN HILLS CITY CODE THE CITY COUNCIL OF THE CITY OF ARDEN HILLS, MINNESOTA, ORDAINS: SECTION 1. Chapter 13, Zoning Code, Section 1330.02, Shoreland Management Districts and Uses, Subd. 1, is hereby amended by deleting strikethrough language and adding the underlined language as follows: 1330.02 Shoreland Management Districts and Uses. Subd. 1. Classification of Lakes. (revised 8/23/21) DNR I.D. No. General Development Lakes: Josephine 62-57 Johanna 62-78 Karth 62-72 Little Johanna 62-58 Recreational Development Lakes: Little Johanna 62-58 Round Lake 62-70 Natural Environmental Lakes: Sunfish 62-65 Valentine 62-71 SECTION 2. This Ordinance shall become effective the day following its publication. Attachment C Page 2 of 2 To view the final document, access adopted Ordinances via Arden Hills Public Laserfiche Weblink by visiting cityofardenhills.org and clicking on Archived Documents under Helpful Links on our main webpage. PASSED and ADOPTED this 23rd day of August, 2021, by the City Council of the City of Arden Hills, Minnesota. CITY OF ARDEN HILLS By _______________________________ David Grant, Mayor ATTEST: _____________________________ Julie Hanson, City Clerk Published in the St. Paul Pioneer Press on August 26, 2021. 1 July 28, 2021 Jessica Jagoe Senior Planner 1245 West Highway 96 Arden Hills, MN 55112 Re: Conditional Approval of Arden Hills Shoreland Ordinance Amendment Dear Ms. Jagoe: Thank you for sending your proposed shoreland ordinance amendment to the DNR for conditional approval review. I am pleased to inform you that the proposed amendment is substantially compliant with the statewide rules and hereby approved, provided all of the conditions of approval in this letter are met. Ordinance Evaluation We have reviewed the following sections that you propose to amend in your draft ordinance received on July 26, 2021 for compliance with state shoreland rules (MR 6120.2500 – 6120.3900). We specifically reviewed City Code Section 1330.02, subd. 1. Our conditional approval only applies to the specific section. Conditions of Approval The following conditions must be met before the DNR will issue final approval: 1. Return the attached “Ordinance Processing Checklist” and documents identified on the checklist. Next Steps Following are the steps for completing and receiving final DNR approval for your amendment: 1. Revise the amendment based on the conditions listed above under conditional approval. 2. The city council adopts the amendment revised according to the listed conditions. 3. Email the completed Ordinance Processing Checklist (attached) and the documents identified on the checklist within 10 days of city council) adoption to: a. Dan Scollan, East Metro Area Hydrologist (daniel.scollan@state.mn.us) b. Ordinance.review.dnr@state.mn.us 4. We will review the amendment adopted by the city council for consistency with the above conditions. 5. If the adopted amendments are consistent with the conditions, I will send you a “final approval” letter. State rules require DNR final approval of shoreland ordinances and amendments for those ordinances to be effective. Attachment D 2 A shoreland ordinance is an important land use regulation that helps to protect surface water quality, near shore habitat, and shoreland aesthetics of Minnesota’s public waters. We appreciate your efforts to protect these resources for all present and future Minnesotans. Dan Scollan is available to assist with ordinance technical guidance and to consult with you on other land and water-related projects. Sincerely, Tim Crocker District Manager, Ecological & Water Resources Division Attachments: Proposed Ordinance Amendment Ordinance Processing Checklist c: Dan Scollan, DNR East Metro Area Hydrologist John (Jack) Gleason, DNR Hydrologist Supervisor Ordinance.review.dnr@state.mn.us City RI$UGHQ+LOOVƒ:HVW+LJKZD\ƒ$UGHQ+LOOV0LQQHVRWD 3KRQHƒ)D[ƒZZZFLW\RIDUGHQKLOOVRUJ -XO\ 0LQQHVRWD'150HWUR(DVW$UHD+\GURORJLVW Attn: 'DQLHO6FROODQ :DUQHU5RDG 6W3DXO01 5( '15 5HVSRQVHWR6KRUHODQG5HJXODWLRQVAmendment $33/,&$17 City of Arden Hills &$6(12 PC - 6KRUHODQG2UGLQDQFH$PHQGPHQW 7KH&LW\RI$UGHQ+LOOVLVSURSRVLQJDWH[WDPHQGPHQWWRWKH$UGHQ+LOOV&LW\&RGH7KHSURSRVHG DPHQGPHQWZLOOUHFODVVLI\/LWWOH-RKDQQDIURPD5HFUHDWLRQDO'HYHORSPHQW/DNHWRD*HQHUDO 'HYHORSPHQW/DNH7KHODNHUHFODVVLILFDWLRQZLOODPHQGRUGLQDQFHODQJXDJHWREHFRQVLVWHQWZLWK 5HVROXWLRQ-SDVVHGE\WKH&LW\&RXQFLO ,QRUGHUWRIDFLOLWDWHWKHUHYLHZE\$UGHQ+LOOV3ODQQLQJ&RPPLVVLRQDQG&LW\&RXQFLOZHUHVSHFWIXOO\ UHTXHVWWKDW\RXSURYLGHXVZULWWHQIHHGEDFNDVVRRQDVSRVVLEOH &KHFN$SSOLFDEOH%R[ տ 7KHDPHQGPHQWDOLJQVZLWKWKHJRDOVDQGUHTXLUHPHQWVRIWKH 0LQQHVRWD'15 1RFRPPHQWV RQWKHSURSRVHGDPHQGPHQW ZLOOEHIRUWKFRPLQJ տ 7KH0LQQHVRWD'15 ZLOOVXEPLWZULWWHQFRPPHQWVRQWKHSURSRVHGDSSOLFDWLRQ City RI$UGHQ+LOOVƒ:HVW+LJKZD\ƒ$UGHQ+LOOV0LQQHVRWD 3KRQHƒ)D[ƒZZZFLW\RIDUGHQKLOOVRUJ ; 2WKHU '15 ZLOOVXEPLWDFRQGLWLRQDODSSURYDOletter IRUWKLVVKRUHODQGRUGLQDQFH DPHQGPHQW _____________________________________ ____________________________________ 1DPH SULQW 7LWOH _____________________________________ ____________________________________ 1DPH VLJQDWXUH 'DWH Dan Scollan DNR East Metro Area Hydrologist 2021-07-26 1DPH SULQW ______________________ ORDINANCE PROCESSING CHECKLIST Please complete, sign and return this checklist and all required documents by email to the DNR: Ordinance.review.dnr@state.mn.us, and your Area Hydrologist 1. _______________ Date(s) of published public hearing notice(s). Email the notice with this checklist. _______________ 2. _______________ Date(s) of public hearing(s). _______________ 3. _______________ Date of ordinance adoption. Email the adopted ordinance/ amendment with the signature of the chief elected official in PDF format with this checklist. 4. _______________ Date of newspaper publication of adopted ordinance/ amendment or ordinance amendment summary. 5. Email a zoning map showing the “district” corresponding to the adopted ordinance at the time of adoption, if one exists, and the underlying zoning districts if the adopted ordinance refers to them. _______________________________________________ Signature of Clerk/Auditor _______________________________________________ Name of Community Page 1 of 4 PC AGENDA ITEM – 3C MEMORANDUM DATE: August 4, 2021 TO: Planning Commission Chair and Commissioners FROM: Jessica Jagoe, Senior Planner SUBJECT: Planning Case #21-018 – Public Hearing Required Applicant: City of Arden Hills Request: Zoning Code Amendment – Chapter 13 – Section 1330.02 Subd. 1 Requested Action The City of Arden Hills is proposing an amendment to the language Section 1330.02 Subd. 1 of the Arden Hills City Code to amend the lake classification for Little Johanna from a Recreational Development Lake to a General Development Lake. The lake reclassification will amend ordinance language to be consistent with Resolution 85-22 passed by the City Council. The ordinance amendment is an administrative action in accordance with previous approval by the City Council that will clean up lake classification designation. Lake Classification Lake classification is used to determine lot size, setbacks and, to a certain degree, land uses on adjacent land. The classification does not pertain to surface water use of boats or motors, hunting or fishing or fish management. Those are governed by other regulations. Minnesota Rule 6120.3000 Subp. 1a. identifies the types of public water classes with a general description of each class. Staff has provided below the descriptions for waterbody classifications specific to the reclassification discussion as defined by State Statute: A. Natural environment lakes are generally small, often shallow lakes with limited capacities for assimilating the impacts of development and recreational use. They often have adjacent lands with substantial constraints for development such as high water tables, exposed bedrock, and unsuitable soils. These lakes, particularly in rural areas, usually do not have much existing development or recreational use. B. Recreational development lakes are generally medium-sized lakes of varying depths and shapes with a variety of landform, soil, and groundwater situations on Page 2 of 4 the lands around them. They often are characterized by moderate levels of recreational use and existing development. Development consists mainly of seasonal and year-round residences and recreationally-oriented commercial uses. Many of these lakes have capacities for accommodating additional development and use. C. General development lakes are generally large, deep lakes or lakes of varying sizes and depths with high levels and mixes of existing development. These lakes often are extensively used for recreation and, except for the very large lakes, are heavily developed around the shore. Second and third tiers of development are fairly common. The larger examples in this class can accommodate additional development and use. The Minnesota Department of Natural Resources (DNR) provides information on their website on the data points used in determination of lake classifications as noted below: Natural Environment Lakes – Natural Environment Lakes usually have less than 150 total acres, less than 60 acres per mile of shoreline, and less than three dwellings per mile of shoreline. They may have some winter kill of fish; may have shallow, swampy shoreline; and are less than 15 feet deep. Recreational Development Lakes – Recreational Development Lakes usually have between 60 and 225 acres of water per mile of shoreline, between 3 and 25 dwellings per mile of shoreline, and are more than 15 feet deep. General Development Lakes – General Development Lakes usually have more than 225 acres of water per mile of shoreline and 25 dwellings per mile of shoreline, and are more than 15 feet deep. In addition to lake size, shoreline, and depth, the DNR also considers existing development, crowing potential, ecological classification, soil, slope, and vegetation as part of their aggregate assessment. Ordinance Background In 1969, the State of Minnesota passed the Shoreland Management Act which directed the DNR to develop rules and oversee programs for shoreland management for Cities and Counties. The DNR adopted Shoreland rules for Cities in 1976. In response to the adoption of State rules, the City in 1984 studied the differences between our existing zoning controls and the State Shoreland Management Standards. On December 26, 1984, the City submitted a preliminary request to the DNR for comment prior to submittal of the formal request (Attachment B). This letter included a summary of City comments for seeking the lake reclassification of several lakes, and relaxation of lot area and lot coverage requirements. The City received a response from the DNR of a willingness to accept all of the requested changes. Based on that direction, the City Council passed Resolution 85-22, Lake Reclassification and Zoning Provision Modifications on May 13, 1985 to request official approval from the DNR (Attachment C). It was recently discovered that between 1985 and 2021, this resolution was either never sent or lost on the part of the DNR. Page 3 of 4 The City’s first ordinance adoption for shoreland requirements was in September 1985, Ordinance No. 237, which was previously referred to as “Arden Hills Shoreland Management Ordinance”. This ordinance incorporated the language and lake classifications as recommended in the May 1985 resolution. The most substantive update of the shoreland ordinance occurred in February 2010. This ordinance review was intended to address a number of holes that still remained unaddressed after an earlier update in 2002. During this process the City conducted an extensive review of development regulations including, but not exclusive to, exceptions to OHW setbacks, wetland setbacks, accessory structure allowances, additional definitions, removal of vegetation and grading and filling standards in order to gain a greater consistency with the DNR guidelines. This research did not involve discussion of lake classifications. However, incorporated into this ordinance amendment Little Johanna was shifted to a Recreational Development Lake. It is suspected that the inconsistency in lake classification was caught as part of that review and amended to reflect DNR categorization. Again, the inconsistency between the City and DNR was due to the failure to finalize processing of Resolution 85-22. This past month City staff contacted Dan Scollan, East Metro Area Hydrologist with the DNR, regarding next steps and available options for proceeding with Resolution 85-22. Mr. Scollan had indicated that the DNR had reviewed the 1984/85 documentation and would proceed with approval of Resolution 85-22 as submitted. Their decision in support of the reclassifications is the result of the lake classification factors having not appreciably changed since 1985. Looking at all of the classification criteria holistically, the DNR still agreed with the City’s reasoning presented in 1985 and concurred that the area development is still consistent with the 1985 Council request as outlined. At the June 7, 2021, City Council Special Work Session, staff was given direction to submit Resolution 85-22 to the DNR as approved on May 13, 1985. This action necessitated an ordinance amendment to Section 1330.02 Subd. 1, Classification of Lakes to classify Little Johanna as General Development. The City received approval of Resolution 85-22 by the DNR on June 23, 2021 (Attachment D). Additional Review Minnesota Department of Natural Resources approved Shoreland Classifications as stated in Resolution 85-22 on June 23, 2021. Preliminary request for comment of shoreland ordinance amendment was sent to the DNR on July 26, 2021. Findings of Fact The Planning Commission must make a finding as to whether or not the proposed application would adversely affect the surrounding neighborhood or the community as a whole based on the aforementioned factors. Staff offers the following findings for consideration: General Findings: 1. The City of Arden Hills is proposing amendments to the language of Chapter 13 – Zoning Code of the City Code. 2. The City of Arden Hills is proposing to classify Little Johanna as a General Development Lake. Page 4 of 4 3. Amendments to the Shoreland Regulations require approval from the Minnesota DNR. 4. Amendments to the Zoning Code regulations require a public hearing prior to action by the City Council. Options and Motion Language Staff has provided the following options and motion language for this case. • Recommend Approval: Motion to recommend approval of Planning Case 21-018 for a Zoning Code Amendment to Chapter 13 of the Arden Hills City Code to reclassify Little Johanna as a General Development Lake as presented in the August 4, 2021 Report to the Planning Commission. • Recommend Denial: Motion to recommend denial of Planning Case 21-018 for a Zoning Code Amendment to Chapter 13 of the Arden Hills City Code to reclassify Little Johanna as a General Development Lake: findings to deny should specifically reference the reasons for denial. • Table: Motion to table Planning Case 21-018 for a Zoning Code Amendment to Chapter 13 of the Arden Hills City Code to reclassify Little Johanna as a General Development Lake: the Planning Commission should identify a specific reason and/or information request should be included with a motion to table. Public Notices A Zoning Code Amendment requires a public hearing. Notice was published in the Pioneer Press on July 22, 2021. Notice and website was prepared by the City and mailed to property owners within 1,000 feet of the subject property. The City has not received any public comments regarding this case. Attachments A. Draft Ordinance Amendment 2021-XXX B. City Preliminary Request Letter C. Resolution 85-22 D. DNR Shoreland Reclassification Letter E. Minutes ARDEN HILLS PLANNING COMMISSION –August 4, 2021 7 Paul Apilkowski, Wold Architects and Engineers, stated he was a representative for the school district. He reported he was asking for an extension and noted the project could not be completed in 30 days. He explained initial sketches have been submitted to staff and the basic concept was the school district does not believe they will get the land in a timely manner. He commented the plan was to align the driveways within school district land. Commissioner Jefferys thanked the school district for this explanation. She asked what the State’s explanation was for not responding to the school district’s request. Chris Pawket, Mounds View Public Schools, stated he has had several representatives speak with the State over the past two years. He indicated the State keeps pushing the school district off and there was no guarantee the school district could acquire the land. Commissioner Jefferys commented she was glad this project was moving forward but wondered if the school district should move forward on a dual track, in order to continue pursuing the State land, if this was the best option. Chair Vijums stated he supported the extension and understood the State does not appear to want to move forward with the land sale. He looked forward to seeing the new plans at some point in the future. Chair Vijums opened the public hearing at 7:14 p.m. Chair Vijums invited anyone for or against the application to come forward and make comment. There being no comment Chair Vijums closed the public hearing at 7:14 p.m. Commissioner Wicklund moved and Commissioner Zimmerman seconded a motion to recommend approval of Planning Case 21-017 for an Amended Planned Unit Development at 1900 and 1901 Lake Valentine Road based on the findings of fact and the submitted plans, as amended by the conditions in the August 4, 2021, report to the Planning Commission. A roll call vote was taken. The motion carried unanimously (5-0). C. Planning Case 21-018; Zoning Code Amendment to Section 1355 (Shoreland) Regarding Classification of Lakes –Public Hearing Senior Planner Jagoe stated the City of Arden Hills is proposing an amendment to the language Section 1330.02 Subd. 1 of the Arden Hills City Code to amend the lake classification for Little Johanna from a Recreational Development Lake to a General Development Lake. The lake reclassification will amend ordinance language to be consistent with Resolution 85-22 passed by the City Council. The ordinance amendment is an administrative action in accordance with previous approval by the City Council that will clean up lake classification designation. Senior Planner Jagoe explained lake classification is used to determine lot size, setbacks and, to a certain degree, land uses on adjacent land. The classification does not pertain to surface water use of boats or motors, hunting or fishing or fish management. Those are governed by other regulations. Minnesota Rule 6120.3000 Subp. 1a. identifies the types of public water classes with DRAFTshing shing d. d. t was moving forward bwas moving f in order to continue pursuingin order to continue n and understood the State doand understood looked forward to seeing thed forward t ing at 7:t 7:1414 p.m.p.m. or or against the application to or or against the application to Chair VijumsChair Vijums closed the publicclosed the pu cklund d moved and Commismoved and Commis DRroval of Planning Case roval of Planning 21-0 DR1901 Lake Valentine Road 1901 Lake Valentine R DRamended by the conditionamended by the conditionDRon. on. A roll call vote was takA roll call vote wDning ning C2121 ng Classing Classi Plannin -018;Zoning Code Amendment to Section 1355 (Shoreland) Dning ning Case 21Case 21--00 Regarding Classification of Lakes –Public Hearing ng Classing Classi Attachment F ARDEN HILLS PLANNING COMMISSION –August 4, 2021 8 a general description of each class. Staff has provided below the descriptions for waterbody classifications specific to the reclassification discussion as defined by State Statute: A. Natural environment lakes are generally small, often shallow lakes with limited capacities for assimilating the impacts of development and recreational use. They often have adjacent lands with substantial constraints for development such as high water tables, exposed bedrock, and unsuitable soils. These lakes, particularly in rural areas, usually do not have much existing development or recreational use. B. Recreational development lakes are generally medium-sized lakes of varying depths and shapes with a variety of landform, soil, and groundwater situations on the lands around them. They often are characterized by moderate levels of recreational use and existing development. Development consists mainly of seasonal and year-round residences and recreationally-oriented commercial uses. Many of these lakes have capacities for accommodating additional development and use. C. General development lakes are generally large, deep lakes or lakes of varying sizes and depths with high levels and mixes of existing development. These lakes often are extensively used for recreation and, except for the very large lakes, are heavily developed around the shore. Second and third tiers of development are fairly common. The larger examples in this class can accommodate additional development and use. Senior Planner Jagoe provided further comment on the Ordinance background and provided the following Findings of Fact: 1. The City of Arden Hills is proposing amendments to the language of Chapter 13 –Zoning Code of the City Code. 2. The City of Arden Hills is proposing to classify Little Johanna as a General Development Lake. 3. Amendments to the Shoreland Regulations require approval from the Minnesota DNR. 4. Amendments to the Zoning Code regulations require a public hearing prior to action by the City Council. Senior Planner Jagoe stated staff recommended approval of a Zoning Code Amendment to Chapter 13 of the Arden Hills City Code to reclassify Little Johanna as a General Development Lake as presented in the August 4, 2021 Report to the Planning Commission. Senior Planner Jagoe reviewed the options available to the Planning Commission on this matter: 1. Recommend Approval with Conditions 2. Recommend Approval as Submitted 3. Recommend Denial 4. Table Chair Vijums opened the floor to Commissioner comments.DRAFTcreatiocreati nd yearnd yea -rou hese lakes have hese lak ep lakes or lakes of varyingep lakes or lakes of ng development. These lakesng development. These or the very or the v large lakes, are heavarge lakes, are hea of development are fairly comf development a e additional development and uional develo er comment on the Ordinancemment on the Ordinance lls is proposing amendments tolls is proposing amend ode. ode. den Hills is proposing to classifn Hills is proposing to classi ents to the Shoreland Regulationts to the Shorelan dments to the Zoning Code regdments to the Zoning Co City Council.City C ner Jagoener Ja stated d staffs he Arden Hills Che Arden Hills C n the Augun the Augu ARDEN HILLS PLANNING COMMISSION –August 4, 2021 9 Commissioner Zimmerman stated this was a long overdue administrative issue that had to be taken care of. Chair Vijums commented he found it strange that the classification has been shifted back to recreational on February 10, 2021. Senior Planner Jagoe explained this was done after completing a broader review of shoreland ordinances to be consistent with the DNR. Chair Vijums questioned if the reclassification will help with the permit for the new storage shed. Senior Planner Jagoe reported Lake Johanna was already classified as a general development lake, so there would be no impacts or changes to that request. She explained the only change being proposed was to Little Johanna. Chair Vijums opened the public hearing at 7:23 p.m. Chair Vijums invited anyone for or against the application to come forward and make comment. David Short, 3156 Shorewood Drive, questioned what the difference was between general development and recreational lakes. Senior Planner Jagoe explained general development lakes are more developed, smaller lot sizes with deeper bodies of water. She indicated recreational lakes have larger lots and less development. She stated a natural environment lakes are the least dense and have further setbacks with more of a buffer between development and the shoreline. There being no additional comment Chair Vijums closed the public hearing at 7:26 p.m. Commissioner Weber reported nothing was changing for the lakes except for the classification of Little Johanna. Senior Planner Jagoe discussed how the City would not be creating any non-conforming lots with the proposed change because the setback from OHW would be changing from 75 feet to 50 feet. Chair Vijums moved and Commissioner Zimmerman seconded a motion to recommend approval of Planning Case 21-018 for a Zoning Code Amendment to Chapter 13 of the Arden Hills City Code to reclassify Little Johanna as a General Development Lake as presented in the August 4, 2021 Report to the Planning Commission. A roll call vote was taken. The motion carried unanimously (5-0). UNFINISHED AND NEW BUSINESS None. ssified as a generssified a est. She explained the est. She expla m.m. e application tcation to come forward o co questioned what the differequestioned what the di ned general development lakeed general development lake f water. She indicated recreatf water. She indicated d a natural environment laked a natural environment l a buffer between development buffer between development dditional ditional comment mment Chair Vijum ner Weberner W reported nothing ported nothing hanna.hanna JagoeJagoe discussescusse hange bechange bec •Planning Case #21-018 –Public Hearing Required •Applicant: City of Arden Hills •Request: Zoning Code Amendment Chapter 13, Zoning Code Shoreland Amendment is an administrative action to clean up ordinance language to reclassify Little Johanna from a Recreational Development Lake to a General Development Lake. Resolution 85-22 Lake Johanna Little Johanna Karth Lake from Recreational Development to General Development Historical Information •1969 -State of Minnesota passed the Shoreland Management Act due to concerns over rapid development, crowding, and declining water quality and recreational value of the State’s lakes and rivers. •1976 -DNR adopts Shoreland rules for Cities. These Shoreland rules are MN Rules Chapter 6120, Shoreland and Floodplain Management. •1984 –City studies existing controls and State Shoreland Management Standards and submits preliminary request to DNR for Lake Reclassifications. •May 1985 –City Council passes Resolution 85-22 as official request for lake reclassifications. •September 1985 –City adopts 1st shoreland ordinance consistent with resolution. •Between 1985 –2021 –The resolution was either never sent or lost on the part of the DNR. •February 2010 -Little Johanna was shifted to Recreational Development with other updates in the Shoreland Ordinance. Section 1330.01 Subd. 1, Classification of Lakes •June 7, 2021 -City Council Special Work Session, staff was given direction to submit Resolution 85-22 to the DNR as approved on May 13, 1985. •June 23, 2021 -DNR approves Lake Reclassifications of Resolution 85-22. •August 5, 2021 –The Planning Commission voted unanimously to recommend approval of ordinance amendment. Redlined Ordinance Amendment - Public Notices - •Notice was published in the Pioneer Press on August 12, 2021. Notice and website was prepared by the City and mailed to property owners within 1,000 feet of the subject waterbody. •No public comments received. •DNR granted conditional approval on July 28, 2021. Planning Case 21-018 –Shoreland Ordinance Amendment Questions? ________________________________________________________________________________________________________ Page 1 of 5 PUBLIC HEARING – 8E MEMORANDUM DATE: August 23, 2021 TO: Honorable Mayor and City Councilmembers Dave Perrault, City Administrator FROM: Jessica Jagoe, Senior Planner SUBJECT: Planning Case # 21-016 – No Public Hearing Required Applicant: Bolton & Menk Property Location: 3900 Bethel Drive Request: Site Plan Review Budgeted Amount: Actual Amount: Funding Source: N/A N/A N/A Council Should Consider the Following: A public hearing is not required for Site Plan Review. The Council shall consider holding a public hearing to allow an opportunity for comment on Planning Case 21-016 for Site Plan Review for Bethel University to update the scoreboard and sound system adjacent to the stadium field and track located in the southern quadrant of the Bethel University Campus. The City Council will be asked to make a formal decision regarding the application under Agenda Item 9E. Approval of a Site Plan Review requires an affirmative vote of three councilmembers. Background 1. Overview of Request Bethel University was approved a Conditional Use Permit Amendment on May 3, 2021 for stadium field upgrades which included the addition of a new track around it and practice fields to be converted into multi-purpose fields in the southern quadrant of their main campus at 3900 Bethel Drive. The CUP Amendment application noted that Bethel University was proposing changes to the scoreboard. Conditions of the CUP Amendment approval were that a separate permit shall be required for the scoreboard and that prior to replacement of sound system, Bethel University would be required to submit new sound system plans to the City Council for approval. The Applicant is proposing to convert the existing electronic scoreboard to a LED/Video capable scoreboard with a sound system fully contained within the accessory structure. Page 2 of 5 2. Site Data Future Land Use Plan: Public and Institutional Existing Land Use: Public and Institutional Zoning: INST – Institutional District Size: 191.32 Acres (Including main campus, athletic complex, and part of Lake Valentine) Topography: Varied topography across campus Plan Evaluation Chapter 13, Zoning Regulations Review 1. District Requirements Chart (INST Institutional District) – Section 1320.06 Under the 2040 Comprehensive Plan, the Bethel University campus is guided as Public & Institutional on the land use plan. The main Bethel University campus is located in the Institutional Zoning District. Higher education campus uses, including but not limited to classrooms and laboratories, are allowed conditional uses in this district. The proposed changes to the accessory structure that the Applicant proposes to add are complementary to the use of the Subject Property as an educational institution. 2. General Requirements - Sections 1325.01 and 1325.05 A. Permanent Accessory Structures – Meets Requirements The Applicant is proposing to replace the existing electronic scoreboard with an LED/Video capable scoreboard as an accessory structure which is allowed in the INST District. Permanent accessory structures in any district, except residential, shall be subject to Council approval. The exterior finish of accessory structures shall be compatible in appearance and material used with the principal structure served by the accessory structure. In this case, the Applicant is proposing enhanced aesthetic features which include the steel beams being encased with a brick and stucco solid base of the structure to match the brick appearance of the existing university buildings. The steel support columns around the scoreboard will be painted. The base design has been modified from the Planning Commission review. These same aesthetic materials will be visible in view of the backside of the scoreboard. In addition, the Applicant has provided an exhibit of the scoreboard surface and electrical components as visible from the backside. B. Height – Meets Requirements Accessory structures in all other Zoning Districts, except residential, shall not exceed the height of the principal structure to which it is accessory. The current accessory structure has 308 square feet of scoreboard area (14’ x 22’) and is 26 feet tall. The Applicant is proposing to replace with a larger accessory structure that will consist of approximately 560 square feet of scoreboard area (approx. 17’ x 31’) and at a height of 31’9”. The maximum height requirement in the INST District is 35 feet. The Applicant notes the height of the pressbox adjacent to the stadium field is approximately 40 feet. The proposed accessory structure for Bethel University will stay in compliance with district height requirements. C. Setbacks – Meets Requirements Setbacks in the INST District are 50 feet in the front yard, 20 feet in the rear yard, and 10 feet in the side yard. Structures must be located a minimum of 100 feet from abutting residential Page 3 of 5 property. There are currently no structures within 100 feet of abutting residential properties. The proposed scoreboard will be moved southwest of the existing scoreboard location and remains approximately 135 feet from the south property line. The Applicant is not proposing any structures within the 100 feet setback. D. Lighting – Meets Requirements As part of the CUP Amendment, the Applicant was approved stadium lighting around the football field and track subject to providing photometric calculations for lighting at the property lines of all adjacent residential properties indicating the plan meets ordinance requirements. The Applicant is not proposing any new lighting as part of this application. Section 1325.05 Subd. 3 requires lighting in all districts to direct light away from adjoining lots and public streets. Direct or sky-reflected glare, from floodlights or high temperature processes such as combustion or welding, shall not be directed at any adjoining lots or public streets. In addition, Section 1325.05 Subd. 3 also requires the source of illumination to be hooded, concealed or controlled in a manner so as to direct the lighting pattern only on the site to which the lighting is intended. The proposed scoreboard will be a full color approximately 21’ tall by 31’ wide LED video display. The Applicant has provided a photometric plan which includes the LED/Video scoreboard display with illumination levels. The plan illustrates the scoreboard will not output additional lighting beyond the intensity of the approved lighting fixtures for the stadium. The proposed location of the LED/Video capable scoreboard in the SW corner of the stadium is positioned in a manner to direct the light pattern towards the stadium. Any light or combination of lights shall not cast light that exceeds a meter reading of one foot candle on the travel lanes of adjoining public streets or 0.4 foot candles on adjoining residential property. The maximum illumination shown on the Applicant’s photometric plan is 1.28 foot candles on the north side of the proposed new scoreboard location. The light levels at the Railroad ROW are less than 0.43 foot candles. Light levels will be less at adjoining residential property. E. Building and Landscaping Coverage – Meets Requirements The Zoning Code requirements for the INST District allow a maximum building footprint of 35% and a minimum landscape area of 25%. Landscaping is defined as all plantings, including trees, grass, and shrubs. The proposed scoreboard would not result in much of any additional structure coverage on the Subject Property since the replacing an existing structure. The Applicant is not proposing any changes to landscape. The approved CUP for the campus limits the total lot coverage of impervious surfaces to 25% and requires a minimum landscape lot area of 75%. As proposed, the replacement accessory structure would not exceed the lot coverage requirements for the campus. F. Noise – Meets Requirements As a condition of the CUP Amendment, the Applicant is required to submit new sound system plans to the City Council for approval. The proposed sound system model will be SP-1000 Stadium Pro Sound from Nevco. The Applicant is proposing a fully embedded sound cabinet within the scoreboard accessory structure. The sound cabinet is approximately 4’ tall by 6’ wide located atop of the LED screen. The sound cabinet is completely surrounded by a 1” thick acoustic foam. The purpose of the foam is to reduce sound wave vibrations to the mechanical structure of the scoreboard display products, but also dampens the sound waves leaving the rear of the display. Page 4 of 5 There are no other sound system amplification or speakers proposed as part of the stadium upgrades. Previous review and discussion included speakers attached to lighting, but that has been eliminated. The sound cabinet will feature two speakers and one subwoofer. The Applicant has indicated that the existing scoreboard current PA system is max upper 70 dB’s at the property line and as you move closer to the pressbox will climb to the mid 80’s. Levels standing on the bleachers in front of the speakers did reach 90 dB, but never reached 100 dB. The SP-1000 enclosure is noted to be in the lower frequency levels of 70-80 dB’s. In addition, the SP- 1000 speakers are directional speakers. The Applicant intends to aim the speakers at the home bleachers, so that sound travels away from the adjacent residences. The new scoreboard location in the SW corner of the stadium field is positioned to further direct sound towards the home bleachers. Both of those changes with the new sound system are intended to be an improvement over the old system. Included with the submission is an example of sound modeling to illustrate scoreboard sound system dB levels with the projected levels at distances within the field. 3. Signage Requirements – Section 1250 A. Section 1250.05 - Meets Requirements In Section 1250.05, Permanent Scoreboard Signs for Athletic Fields at Mounds View High School, Bethel University, and Northwestern College it states that athletic fields may be permitted signage that is clearly secondary to the overall appearance of the scoreboard. Such signage shall face the field of play so that the impact of the signage is directed only to those utilizing the field or watching the sporting event, and not surrounding property owners. The content of scoreboard signage shall comply with the sponsorship sign regulations as established by Bethel University. The Applicant Decibel levels of common noise sources from the Minnesota Pollution Control Agency: Page 5 of 5 has indicated the video capable scoreboard will be used for game-related activities and will not be used for advertising or sponsorship. B. Section 1250.06 – Meets Requirements In Section 1250.06, Permanent Signs for Athletic at Mounds View High School, Bethel University, and Northwestern College is permitted as an entrance gate style sign, affixed to a pressbox/grandstand, or signage included on the scoreboard. Such signage shall not be lit by a direct lighting source and constructed of durable materials (finished metal, finished wood, plastic). Under Subd. 1, Sign Area, the scoreboard field naming signage shall not exceed 40% of the total scoreboard area. The Applicant is not proposing signage that will be visible from a public roadway or from outside Bethel University. The scoreboard will feature a 4’ x 31’ field naming placard constructed of finished metal that is not illuminated. The “Bethel University” signage calculates to be approximately 22% of the total scoreboard area. Application Review 1355.04 Procedural Requirements for Specific Applications Section 1355.04, Subd. 5 of the Arden Hills Zoning Code states that a public hearing is not required for Site Plan Review, but neighboring property owners shall be notified. Notification was prepared in accordance with City policy. Public Notice and Comments A Notice was published in the Pioneer Press on August 12, 2021. Notice and website was prepared by the City and mailed to property owners within 500 feet of the subject property. As of August 18, 2021, Staff has not received any public comment regarding this case. Staff had received two inquiries for information on scoreboard size and lighting prior to the Planning Commission meeting. The application materials were provided for further review of request. No public comments were submitted in advance of the Planning Commission meeting. Attachments A. Land Use Application B. Location Map C. Narrative D. Site Plans E. Existing Scoreboard F. Proposed Scoreboard G. Sound System H. Lighting Photometric Exhibits I. Planning Commission Memo J. Draft Planning Commission Minutes K. Presentation   )0>?423B,D =/09477> 4990>:?,  &070;3:90    ,C    BBB.4?D:1,=/093477>:=2 %( )$"- #7,99492,>0!:  %@-84??,7,?0 ;;74.,?4:9:8;70?0/,?0 ..0;?0/-D $0.04;?!@8-0= :@9.470.4>4:9 :@9.470.4>4:9,?0       &&" $* $%(#* %$ ;;74.,9? //=0>> &070;3:90!: "?30= ,C!: 8,47//=0>> (%&(*- $%(#* %$ #=:;0=?D"B90= "B90=//=0>> "B90=&070;3:90!: "?30= //=0>>:1#=:;0=?D9A:7A0/ 02,70>.=4;?4:9 #=:;0=?D!: &D;0:1'>0 *:90 #=:;0=?D.=0,20 -&%'+)* ‰:8;=0309>4A0#7,9809/809?00  >.=:B   ‰:9/4?4:9,7'>0:=9?0=48'>0#0=84? '#:='# 809/809?00 >.=:B   ‰#=074849,=D#7,?00 >.=:B ‰49,7#7,?00 >.=:B ‰:9.0;?#7,9$0A40B00 >.=:B  ‰ ,>?0=#7,990/'94?0A07:;809?:= ,>?0=%;0.4,70A07:;809?#7,900 >.=:B   ‰49,7#7,990/'94?0A07:;809?:=49,7%;0.4,70A07:;809?#7,900  >.=:B  ‰#7,990/'94?0A07:;809?809/809?:=%;0.4,70A07:;809?#7,9809/809?00 >.=:B   ‰%4?0#7,9$0A40B00 >.=:B   ‰$0E:9492:=&#$02@7,?492#7,9809/809?00 >.=:B   ‰*:9492:/0:=&#$0/0A07:;809?:/0809/809?00 >.=:B   ‰4?D:/0809/809?00  >.=:B   ‰:?%;74? 49:=%@-/4A4>4:9$ ,9/$ 4>?=4.?> "97D00  >.=:B  ‰(,=4,9.0:=#0=84??0//5@>?809?00  >.=:B   ‰(,.,?4:9:1,>0809?:=$423?:1),D00  >.=:B   ‰;;0,7:1/8494>?=,?4A00.4>4:900  >.=:B   ‰,9/'>0$0<@0>?>F!:?7=0,/D%;0.4140/00  >.=:B  'DQ5HERN%ROWRQ 0HQN *ROGHQ9DOOH\5RDG6XLWH0LQQHDSROLV01    GDQUHERN#EROWRQPHQNFRP %HWKHO8QLYHUVLW\ %HWKHO'ULYH$UGHQ+LOOV01    %HWKHO'ULYH$UGHQ+LOOV01 SOHDVHUHIHUWRDWWDFKHG  3ULYDWH8QLYHUVLW\  Attachment A   =4010>.=4;?4:9:1$0<@0>?;70,>0,7>:49.7@/0,?D;0//0?,470/70??0=0C;7,49492?30;=:50.? " $ $%(#* %$'+ (#$*) &304?D=0<@0>?>?3,? D:@8,60,;=0,;;74.,?4:9800?492B4?3?304?D#7,990=?:/4>.@>>?30,;;74.,?4:9 ;=:.0>>=0<@4=0809?>,9//0,/7490>'970>>B,4A0/-D?304?D#7,990=:=#7,99492:884>>4:9,.0=?4140/ >@=A0D:1?30;=:;0=?D4>=0<@4=0/1:=,77,;;74.,?4:9>.30.674>?B4?3,//4?4:9,7,;;74.,?4:9=0<@4=0809?>.,9-0 1:@9/,?BBB.4?D:1,=/093477>:=2 7,9/@>0,;;74.,?4:9> %#&"* $%#&"*&&" * %$) '9/0= 4990>:?, %?,?@?0 3,;?0=  .4?40> 3,A0  -@>490>> /,D> ?: =0A40B ,77 ;7,9> ,9/ ,;;74.,?4:9 8,?0=4,7>?:09>@=0?30D>,?4>1D4?D=0<@4=0809?>@=492?30 /,D=0A40B;0=4:/;7,99492>?,11B477;=:A4/0 B=4??09.:8809?>:9?30,;;74.,?4:9 ,9/8,D=0<@0>?;7,9=0A4>4:9>1?30,;;74.,?4:94>/0?0=8490/?:-0 .:8;70?0 4990>:?,%?,?0%?,?@?0?309=0<@4=0>?304?D?:,;;=:A0:=/09D?30,;;74.,?4:9B4?349 /,D>@; ?:  /,D> 1 9:? .:8;70?0 ?30 4?D 8,D =0<@4=0 ;7,9 =0A4>4:9> ,9/ := ,//4?4:9,7 491:=8,?4:9 -01:=0 ?30 ,;;74.,?4:9 4> >.30/@70/ 1:= #7,99492 :884>>4:9 =0A40B ,9/ :=4?D :@9.47 ,.?4:9  #=:50.? B477 9:? -0 >.30/@70/1:=,9D800?492@9?47?30,;;74.,?4:9>@-84??,74>1:@9/?:-0.:8;70?0-D?304?D#7,990= -#$*% )$ )(%,) &30@9/0=>4290/,.69:B70/20>?3,?>30 30@9/0=>?,9/>?3,?-01:=0,7,9/@>0,;;74.,?4:9.,9-0/0080/ .:8;70?0,77=0<@4=0/100>,9/0>.=:B>8@>?-0;,4/?:?304?D&30,;;74.,9?4>=0>;:9>4-701:=,77.:>?> 49.@==0/ -D ?30 4?D =07,?0/ ?: ?30 ;=:.0>>492 :1 ?34> ,;;74.,?4:9 ,.3 >0;,=,?0 7,9/ @>0 =0<@0>? >3,77 -0 .3,=20/,>0;,=,?0,/8494>?=,?4A0100,9/0>.=:B0A0941>@-84??0/:9?30>,80,;;74.,?4:9:>?>0C;09/0/49 =0A40B492,9/ ;=:.0>>492 ,9 ,;;74.,?4:9 B477-0.3,=20/,2,49>??30.,>30>.=:B,9/.=0/4?0/?:?304?D 3,=20>?:?300>.=:B8,D49.7@/0;7,99492,9/0924900=492>?,11?4804?D??:=90D,9/.:9>@7?492100>,9/ 8,47492.:>?>1,?,9D?480,=0<@4=0/.,>30>.=:B4>/0;70?0/?:70>>?3,9 ;0=.09?:14?>:=4249,7,8:@9? ?30,;;74.,9?>3,77/0;:>4?,//4?4:9,71@9/>49?30.,>30>.=:B,..:@9?,>/0?0=8490/-D?304?D&304?D8,D B4?33:7/149,7,.?4:9:9,7,9/@>0,;;74.,?4:9B4?33:7/-@47/492;0=84?>,9/ :==0>.49/;=4:=,.?4:9@9?47,77100> 3,A0-009;,4/'9@>0/;:=?4:9>:1,90>.=:B,=0=0?@=90/?:?30,;;74.,9?@;:9>@..0>>1@748;70809?,?4:9:1 ,9,;;=:A0/;7,9&300>.=:B8,D-0=0/@.0/:=49.=0,>0/-D?304?D#7,990=:9,;=:50.?-D;=:50.?-,>4> %* %* $**$$ 9 :=/0= 1:= ?30 #7,99492 :884>>4:9 ,9/ ?30 4?D :@9.47 ?: .:9>4/0= ,9D ,;;74.,?4:9 ?30 ,;;74.,9? := , /0>429,?0/=0;=0>09?,?4A08@>?-0;=0>09?,??30>.30/@70/800?49219:??308,??0=8,D-0?,-70/@9?47?30 90C?,A,47,-70,209/,   x 0=?,49,;;74.,?4:9>,=0>@-50.??:=0A40B,9/,;;=:A,7-D?30$4.0=006),?0=>30/ 4>?=4.?:9?,.?$)/4=0.?7D,?    1:=,//4?4:9,7491:=8,?4:9 x &307,9/@>0,;;74.,?4:9100>/:9:?.:A0=-@47/492>429:=:?30=;0=84?100>?3,? 8,D-0=0<@4=0/@;:9,;;=:A,7:1,7,9/@>0,;;74.,?4:9 x 77,;;74.,?4:9>B477-0>@-50.??:,//4?4:9,7100>1:==048-@=>0809?:1.:9>@7?,9?.:>?> ,>>:.4,?0/ B4?3 147492 =0A40B492 ,9/ ;=:.0>>492 :1 ,;;74.,?4:949?301:=8:1,9 0>.=:B?:?304?D                                   sound, materials, and location   * $+" #7,99492:884>>4:9800?492>,=0?D;4.,77D307/:9?3014=>?)0/90>/,D,1?0=?3014=>? :9/,D:10,.38:9?3,?  # ?3:@23;70,>0.:9?,.?4?D,77?:A0=41D?30800?492/,?0,9/?4804?D:@9.47800?492>,=0307/ ?D;4.,77D?307,>? :9/,D:1?30>,808:9?3,? #  00?492>,=0307/49?30:@9.473,8-0=>,??304?D :1=/09477> )0>?423B,D=/09477> 4990>:?, @970>>:?30=B4>0>?,?0/&30>.30/@70> -07:B ,=0 1:= =010=09.0 ;@=;:>0> :97D  #=:50.?B477 9:? -0 >.30/@70/ 1:= ,9D800?492 @9?47 ?30 ,;;74.,?4:9 >@-84??,74>1:@9/?:-0.:8;70?0-D?304?D#7,990= "$$ $%## )) %$$ *-%+$ "+"                     090=,77D307/:9?30 14=>?)0/90>/,D,1?0=?3014=>? :9/,D,? ;8              090=,77D307/:9?30 1:@=?3 :9/,D,? ;8 ,9@,=D ,9@,=D 0-=@,=D 0-=@,=D  ,=.3 ,=.3 ;=47 ;=47  ,D ,D  @90 @90  @7D @7D  @2@>?@2@>?  %0;?08-0= %0;?08-0=  ".?:-0=".?:-0=  !:A08-0= !:A08-0=  0.08-0= ,9@,=D   ,9@,=D  ,9@,=D   !$%,"#$*$ $*+( 30=0-D,;;7D1:=?30,-:A0.:9>4/0=,?4:9,9//0.7,=0?3,??30491:=8,?4:9,9/8,?0=4,7>>@-84??0/B4?3?34> ,;;74.,?4:9,=0.:8;70?0,9/,..@=,?0;0=.4?D.:/0,9/:=/49,9.0=0<@4=0809?>1@77D@9/0=>?,9/?3,?,8 =0>;:9>4-701:=,77.:>?>49.@==0/-D?304?D=07,?0/?:?30;=:.0>>492:1?34>,;;74.,?4:9 ++++++++++++++++++++++++++++++++++++++++++++++++++ ++++++++++++++++ #=:;0=?D"B90=%429,?@=0$0<@4=0/ ,?0 ++++++++++++++++++++++++++++++++++++++++++++++++ ++++++++++++++++ ;;74.,9?%429,?@=01/4110=09??3,9?30;=:;0=?D:B90= ,?0 #70,>0.:9?,.??304?D#7,990=,?    41D:@3,A0,9D<@0>?4:9>=02,=/492?34>,;;74.,?4:9                     ++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++ 4.,9?%429,?@=0 1 /4110=09??3,9 ?30 ;=:;0=?D :B9   ++++++++++++++++++++++ #=:;0=?D "B90= %429,?@=0 $0 6/29/21 Location Map Legend Municipal Boundary City Mask March 31, 2021 Map Powered By DataLink 1 in = 752 ft ± $WWDFKPHQW% Facilities Management 3900 Bethel Drive St. Paul, Minnesota 55112-6999 651.638.6200 July 15, 2021 Ms. Jessica Jagoe Senior Planner City of Arden Hills 1245 West Highway 96 Arden Hills MN 55112 Re: Bethel University Athletic Improvements- Scoreboard Dear Jessica, We appreciate your review of the Land Use Application we have submitted related to the replacement of our scoreboard at Royal Stadium. We look forward to meeting with the Planning Commission and City Council and receiving approval for the upgrades from the City on August 23rd. As you have seen, the new scoreboard we are proposing includes video capabilities, including a dynamic display, which will be utilized for game-related uses, e.g. player introductions, game updates and play back, and interactive fan-prompts. The display will not be used for sponsorship or advertising purposes. If you need any additional information or have questions, please to not hesitate to contact Michael Lindsey with Bethel University at 651-638-6346, email michael-lindsey@bethel.edu or Jay Pomeroy, Landscape Architect with Bolton & Menk at 763-544-7129, email jay.pomeroy@bolton-mnk.com. Again, we look forward to working with you and the Planning Commission and City Council on this exciting project! Respectfully, Glenn Hofer Director of Campus Maintenance, Construction & Operations Bethel University July 16, 2021 Ms. Jessica Jagoe, Sr. Planner City of Arden Hills 1245 West Highway 96 Arden Hills, MN 55112 Re: Bethel University Athletic Improvements- Scoreboard Dear Jessica, Related to the Land Use Application, we are pleased to provide information specifically related to the City’s “Permanent Scoreboard Sign” ordinances, described below. As a note, the height of the existing grandstand and press box, from pavement to top of press box, is 40’-6”, higher than the proposed scoreboard. Ordinance 1250.05: The proposed permanent scoreboard at Bethel University's stadium meets or satisfies the requirements of City Ordinance 1250.05 generally as follows: - The scoreboard will be utilized for game-related activities and not advertising or sponsorship (see letter from Bethel University attached as part of this submittal). - The scoreboard will face the field of play, away from the neighbors to the south/ west, and not visible from adjacent public roadways. - The scoreboard is similar to the scoreboards at Northwestern University and, more specifically, the digital display scoreboard at Mounds View High School stadium. Ordinance 1250.06: The proposed permanent scoreboard at Bethel University's stadium meets or satisfies the requirements of City Ordinance 1250.06 generally as follows: - The permanent scoreboard field naming placard at the top of the scoreboard will be constructed of finished metal and include the words "Bethel University". The naming placard does not exceed 40% of the scoreboard area: Total scoreboard size: 17'9" x 31'-6" = 559.125 square feet Proposed naming placard size: 4' x 31'-6" = 126 square feet (or 22.5% of total area) - The permanent scoreboard naming placard has no associated internal or external lighting. Sincerely, Bolton & Menk, Inc. Jay Pomeroy, PLA Principal Landscape Architect Carrie and Glenn – In review of the submittal documents for the Bethel University scoreboard, I have a few follow-up items that I’m hoping you can assist with: From the initial discussions, the City requested that the submission include decibel levels at the property line of current scoreboard and then what they will be with new scoreboard. Has this been verified? Please provide that data. New Scoreboard Engineer Response (NEVCO): “The area indicated on the drawing is behind the direction that the scoreboard will be facing. Stadium Pro sound systems are commonly installed in residential areas, so the design includes an enclosure that completely surrounds the speakers with a 1” thick acoustic foam. The purpose of this foam is to reduce sound wave vibrations to the mechanical structure of the scoreboard display products, but also to dampen the sound waves leaving the rear of the display (where we don’t want them). It’s difficult to predict the exact decibel level that will penetrate the driver enclosure, the SP-1000 enclosure, and the acoustic foam, but it will be primarily isolated to lower frequency levels coming from the subwoofer. My best estimate would be 70 - 80 db at most.” Bethel Response regarding Existing Scoreboard: “Decibel readings we took today –on the current PA system – max out at upper 70's at the property line, and then as you get closer to the audio source (press box) it climbs into the mid- to upper-80's. I didn't see 90's until I was standing on the bleachers almost right in front of the speakers / press box, and levels never reached 100dB. Again, I'm confident the new system (which will be aimed northeast from the scoreboard towards the home bleachers) will have less of an impact on the residents than our current system (which is aimed right at the Arden Oaks residents).” ·There was mentioned of a revised rendering more reflective of site foliage since the tree coverage is not as thick as shown in the illustration. With the rendering as submitted, please provide a few pictures that will illustrates view from adjacent parcels to scoreboard and scoreboard looking towards adjacent parcels. Bolton & Menk Response: We have provided an illustrative graphic (Scoreboard Views) showing views from Bethel into the neighboring properties. Based on the location of the scoreboard, it appears there is adequate existing tree cover to screen the scoreboard from the neighbor’s view. Ultimately, Bethel wants to be good neighbors and are willing to work with the city / neighbors. ·Will there be new light poles with sound attached? If so, please provide manufacturer information for light poles and update site plan to show location of light poles with speakers. I had written in my discussion notes that there was consideration of having four (4) directed towards home grandstand and two (2) on the visitor side. Bolton & Menk Response: No speakers are part of the new light poles. ·The speaker dispersion sheet shows the scoreboard located in the center of the field, do you have an updated dispersal plan with scoreboard location shifted to the SW corner as proposed? Bolton & Menk Response: The scoreboard is in a similar position to the sound dispersal graphic NEVCO has provided. NEVCO is not able to provide an updated graphic as this is a stock graphic, however the design team is confident the provided heat map graphic conveys the sound dispersal in a way that representative of the similar proposed scoreboard location. · Will there be brick or any other materials used as architectural elements for scoreboard (i.e. poles and/or scoreboard frame)? Bolton & Menk Response: The support columns of the bleacher are intended to be steel I-Beams encased in brick. We have attached an exhibit showing the artistic treatment for the brick scoreboard columns. Please note the following, there will be three brick columns instead of the two shown on the artistic graphic provided by others. · Do you have manufacturer information that explains the proposed SP-1000 Stadium Pro Sound system? Bolton & Menk Response: We are attaching a cut sheet with the SP1000 speaker information. I believe from our earlier discussions that the speakers were directional. It would be helpful as part of the submission for Bethel University to provide a narrative and any other supportive documentation that explains rational for new placement of scoreboard and positioning of speaker(s) as to the intended improvement or reduced impacts to neighbors as a result of the new system. Bolton & Menk Response: The SP1000 speakers are directional speakers. The intent is to aim the speakers at the home bleachers, so that sound travels away from the adjacent residences. Bethel and the design team expect this to be an improvement over the existing speakers which currently directs sound towards the residences. I would appreciate the above information being submitted by 4:30 on Thursday, July 8th for our continued evaluation of application completeness. If you have any additional questions, please let me know. Sincerely, Jessica Jagoe Senior Planner City of Arden Hills 1245 West Highway 96 Arden Hills, MN 55112 Office Phone: (651) 792-7810 Email: jjagoe@cityofardenhills.org Attachment D A’A’B’C’D’B’C’D’SCOREBOARDBETHEL UNIVERSITY - SCOREBOARD VIEWSAPPROXIMATESCOREBOARDLOCATION THIS ILLUSTRATION IS FORREFERENCE. IT DOESN'TACCURATELY DEPICT THEVEGETATION, DOESN'TSHOW THE NEIGHBORSHOMES, ROAD, RAILROADTRACKS, ETC. EXHIBIT E - EXISTING SCOREBOARD DIMENSIONS $WWDFKPHQW( Attachment F               XZVK?;^1l XZVJ?;^2l 9?^E?NlbSHd?Z\H^il &/l9?^E?Ml=ZHd?l7Z=?SlEHMM\lQSl &..&l ;NH?S^1l S?d;VlHS;l . *lZ7S;EVl9?ZS7Z=VlZ= l\bG^?l$+l \7Sl=H?CV l;7l/$ /.l XZVJ?;^P7S7C?Z6\bMN7e7li?SC;VPl XEVS?0l!.*.&!$* *l B7g0l .*.---&*&(l =7_?3l +$&$$"l ?SCGS??Z0l ?^l M7\_lZ?dH\?=3l ' kl            C?S?Z7MlSV^?\l !=@\HCSl;V=?1l H9;l$ .lPS9;l$$ ?M?d7^HVS $ =?\HCSlMV7=\3l 7\;?l-!+ &eHS=ld?MV;H^il !lPXEl ?gXV\bZ?l9l ZH\Ll;7_?CVZilHH (;VS;Z?_?l$*lX\HlPHSHPbP *eG=?lBN7SC?l\^??Nl 7\^Pl 7//$ lB4l*L\HlPHS +XZVdH=@lPGSl&l;N?7Zl;Vd@ZlVSl7MMl\^??Ml@P9@==@=lHSl;VS;Z?_? -l .l /l eE?Sl;7\^l7C7GS\^l\VHNl M7^?Z7Ml\VHMl9?7ZHSClX?ZlH9;l;M7\\l)l !*lX\BB^ l XZVdH=?lXZV^?;^HVSl7C7HS\^l=H\\HPHM7ZlP?^7M\l 7MMl=HP?S\HVS\l^Vl9?ld?ZHBH?=lXZHVZl^VlB79ZH;7^GVSl f ,h',l`jY l R8hlcT:[8<A>l OAUD`Fl5#%l O8`A[8Ol:[8<IUDl :jlWaFA[] l 35' MAX. HEIGHT3'10'SPEAKER SUB- WOOFERSPEAKER DESIGN HAS BEEN MODIFIED TO SOLID BRICK AND STUCCO BASE SCOREBOARD SOUND CABINET EMBEDED IN TOP 4' OF SCOREBOARD(SEE PHOTO) &YBNQMF*NBHFPG4DPSFCPBSE#BDLTJEF Stadium Pro 1000 Ease ModelingEXHIBIT G - SCOREBOARD SOUND SYSTEM (SPEAKERS) $WWDFKPHQW* INTEGRATED DISPLAY AND SCORING SOLUTIONS Stadium Pro™ 1000 Features BUILD YOUR OWN DISPLAY AND SCORING SYSTEM ONLINE AT: WWW.NEVCO.COM U.S. & CANADA: 800-851-4040 INTERNATIONAL: 618-664-0360 FAX: 618-664-0398 E-MAIL: INFO@NEVCO.COM • Custom designed for easy installation. • No additional power required at scoreboard results in faster installation, lower installation costs. • Speakers fully aimable to provide complete stadium coverage. • Subwoofer reinforces low frequency resulting in a “fuller sound”. • Best in market 5-year warranty on loudspeakers and custom designed speaker cabinet. • Control Room Package equipment included: • Power Amplifiers........................................2 • Power Sequencers.......................................1 • Equipment Rack.........................................1-14 Space • 12 Channel Mixer.......................................1 • Announcer Mic (+Stand) -Wired.................1 • All Required Cabling/Connectors.................Yes STADIUM PRO™ 1000 SPECIFICATIONS FREQUENCY RESPONSE (-10DB@1M) 35Hz to 22Khz LOW FREQUENCY POWER HANDLING RMS 2 x 600W FREQUENCY RESPONSE (+/-3DB@1M) 48Hz to 18Khz LOW FREQUENCY POWER HANDLING PROGRAM 2 x 1500W MAX SPL @ 1M 137dB MID FREQUENCY POWER HANDLING RMS 2 x 1500W MAX. SYSTEM COVERAGE-HORIZONTAL 100°H MID FREQUENCY POWER HANDLING PROGRAM 2 x 3000WMAX. SYSTEM COVERAGE-VERTICAL 40°V LOW FREQUENCY SPEAKER CONFIGURATION 2 x 15” Subwoofers HIGH FREQUENCY POWER HANDLING RMS 2 x 200W MID FREQUENCY CONFIGURATION 4 x 12” + 4 x 2” Mid Comp. Drivers HIGH FREQUENCY POWER HANDLING PROGRAM 2 x 400W HIGH FREQUENCY CONFIGURATION 2 x 1” HF Comp. Drivers LF AMPLIFIER OUTPUT 3200W @ 4 Ohms LOUDSPEAKER & CUSTOM DESIGNED SPEAKER CABINET WARRANTY 5 Year MF AMPLIFIER OUTPUT 2100W @ 4 Ohms HF AMPLIFIER OUTPUT 2100W @ 4 Ohms CUSTOM DESIGNED SPEAKER CABINET SPEAKERS (2) SUBWOOFER (1) GUARANTEE: TO VIEW OR RECEIVE THE MOST RECENT COPY OF OUR GUARANTEE, PLEASE VISIT: NEVCO.COM/WARRANTY-LIMITATION U.S. SERVICE: 1-800-851-4040 INTERNATIONAL SERVICE: 1-618-664-0360 CANADA SERVICE: 1-800-461-8550 *10 Gauge speaker wire maximum length: 650ft Attachment H MULTI-PURPOSESYNTHETIC FIELD19-LANE RUNNING TRACK2345678912345678912345678940 30 20 1040302010 50 403020104030201050STADIUMFIELDSTEEPLECHASE PITHIGHJUMPLONG/ TRIPLE JUMP/POLE VAULTSCOREBOARDRESIDENTIAL PROPERTY LINE70’ RAILROAD R/W Page 1 of 7 PC AGENDA ITEM – 3A MEMORANDUM DATE: August 4, 2021 TO: Planning Commission Chair and Commissioners FROM: Jessica Jagoe, Senior Planner SUBJECT: Planning Case #21-016 – No Public Hearing Required Applicant: Bolton & Menk Property Location: 3900 Bethel Drive Request: Site Plan Review Requested Action Bolton & Menk (“The Applicant”), on behalf of Bethel University, is requesting a Site Plan Review for a proposed project at 3900 Bethel Drive (“Subject Property”) to update the scoreboard and sound system adjacent to the stadium field and track located in the southern quadrant of the Bethel University Campus. Specific improvements include replacing the electronic scoreboard to an LED/Video capable scoreboard with sound system upgrade. Background 1. Overview of Request Bethel University was approved a Conditional Use Permit Amendment on May 3, 2021 for stadium field upgrades which included the addition of a new track around it and practice fields to be converted into multi-purpose fields in the southern quadrant of their main campus at 3900 Bethel Drive. The CUP Amendment application noted that Bethel University was proposing changes to the scoreboard. Conditions of the CUP Amendment approval were that a separate permit shall be required for the scoreboard and that prior to replacement of sound system, Bethel University would be required to submit new sound system plans to the City Council for approval. The Applicant is proposing to convert the existing electronic scoreboard to a LED/Video capable scoreboard with a sound system fully contained within the accessory structure. Page 2 of 7 2. Site Data Future Land Use Plan: Public and Institutional Existing Land Use: Public and Institutional Zoning: INST – Institutional District Size: 191.32 Acres (Including main campus, athletic complex, and part of Lake Valentine) Topography: Varied topography across campus Plan Evaluation Chapter 13, Zoning Regulations Review 1. District Requirements Chart (INST Institutional District) – Section 1320.06 Under the 2040 Comprehensive Plan, the Bethel University campus is guided as Public & Institutional on the land use plan. The main Bethel University campus is located in the Institutional Zoning District. Higher education campus uses, including but not limited to classrooms and laboratories, are allowed conditional uses in this district. The proposed changes to the accessory structure that the Applicant proposes to add are complementary to the use of the Subject Property as an educational institution. 2. General Requirements - Sections 1325.01 and 1325.05 A. Permanent Accessory Structures – Meets Requirements The Applicant is proposing to replace the existing electronic scoreboard with an LED/Video capable scoreboard as an accessory structure which is allowed in the INST District. Permanent accessory structures in any district, except residential, shall be subject to Council approval. The exterior finish of accessory structures shall be compatible in appearance and material used with the principal structure served by the accessory structure. In this case, the Applicant is proposing enhanced aesthetic features which include the steel beams being brick encased with three columns for the base of the structure and a one (1) foot wide stucco/kasota stone perimeter around the sides and top of the scoreboard to match the brick appearance of the existing university buildings. These same materials will be visible in view of the backside of the scoreboard. B. Height – Meets Requirements Accessory structures in all other Zoning Districts, except residential, shall not exceed the height of the principal structure to which it is accessory. The current accessory structure has 308 square feet of scoreboard area (14’ x 22’) and is 26 feet tall. The Applicant is proposing to replace with a larger accessory structure that will be 560 square feet of scoreboard area (approx. 17’ x 31’) and a maximum of 35 feet tall. The maximum height requirement in the INST District is 35 feet. The Applicant notes the height of the pressbox adjacent to the stadium field is approximately 40 feet. The proposed accessory structure for Bethel University will stay in compliance with district height requirements. Page 3 of 7 C. Setbacks – Meets Requirements Setbacks in the INST District are 50 feet in the front yard, 20 feet in the rear yard, and 10 feet in the side yard. Structures must be located a minimum of 100 feet from abutting residential property. There are currently no structures within 100 feet of abutting residential properties. The proposed scoreboard will be moved southwest of the existing scoreboard location and remains approximately 135 feet from the south property line. The Applicant is not proposing any structures within the 100 feet setback. D. Lighting – Meets Requirements As part of the CUP Amendment, the Applicant was approved stadium lighting around the football field and track subject to providing photometric calculations for lighting at the property lines of all adjacent residential properties indicating the plan meets ordinance requirements. The Applicant is not proposing any new lighting as part of this application. Section 1325.05 Subd. 3 requires lighting in all districts to direct light away from adjoining lots and public streets. Direct or sky-reflected glare, from floodlights or high temperature processes such as combustion or welding, shall not be directed at any adjoining lots or public streets. In addition, Section 1325.05 Subd. 3 also requires the source of illumination to be hooded, concealed or controlled in a manner so as to direct the lighting pattern only on the site to which the lighting is intended. The proposed scoreboard will be a full color approximately 17’ tall by 31’ wide LED video display. The Applicant has stated that the LED/Video scoreboard display is not anticipated to output additional lighting beyond the intensity of the approved lighting fixtures for the stadium. The proposed location of the LED/Video capable scoreboard in the SW corner of the stadium is positioned in a manner to direct the light pattern towards the stadium. The Applicant did not provide as part of this application a photometric plan with illumination levels including the LED/Video display. E. Building and Landscaping Coverage – Meets Requirements The Zoning Code requirements for the INST District allow a maximum building footprint of 35% and a minimum landscape area of 25 %. Landscaping is defined as all plantings, including trees, grass, and shrubs. The proposed scoreboard would not result in much of any additional structure coverage on the Subject Property since the replacing an existing structure. The Applicant is not proposing any changes to landscape. The approved CUP for the campus limits the total lot coverage of impervious surfaces to 25% and requires a minimum landscape lot area of 75%. As proposed, the replacement accessory structure would not exceed the lot coverage requirements for the campus. F. Noise – Meets Requirements As a condition of the CUP Amendment, the Applicant is required to submit new sound system plans to the City Council for approval. The proposed sound system model will be SP-1000 Stadium Pro Sound from Nevco. The Applicant is proposing a fully embedded sound cabinet within the scoreboard accessory structure. The sound cabinet is approximately 4’ tall by 6’ wide located atop of the LED screen. The sound cabinet is completely surrounded by a 1” thick acoustic foam. The purpose of the foam is to reduce sound wave vibrations to the mechanical structure of the scoreboard display products, but also dampens the sound waves leaving the rear of the display. There are no other sound system amplification or speakers proposed as part of the stadium Page 4 of 7 upgrades. Previous review and discussion included speakers attached to lighting, but that has been eliminated. The sound cabinet will feature two speakers and one subwoofer. The Applicant has indicated that the existing scoreboard current PA system is max upper 70 dB’s at the property line and as you move closer to the pressbox will climb to the mid 80’s. Levels standing on the bleachers in front of the speakers did reach 90 dB, but never reached 100 dB. It is anticipated the SP-1000 enclosure will be in the lower frequency levels of 70-80 dB’s. The SP- 1000 speakers are directional speakers. The Applicant intends to aim the speakers at the home bleachers, so that sound travels away from the adjacent residences. The new scoreboard location in the SW corner of the stadium field is positioned to further direct sound to wards the home bleachers. Included with the submission is an example of sound modeling to illustrate scoreboard sound system dB levels with the projected levels at distances within the field. 3. Signage Requirements – Section 1250 A. Section 1250.05 - Meets Requirements In Section 1250.05, Permanent Scoreboard Signs for Athletic Fields at Mounds View High School, Bethel University, and Northwestern College it states that athletic fields may be permitted signage that is clearly secondary to the overall appearance of the scoreboard. Such signage shall face the field of play so that the impact of the signage is directed only to those utilizing the field or watching the sporting event, and not surrounding property owners. The content of scoreboard signage shall comply with the sponsorship sign regulations as established by Bethel University. The Applicant Decibel levels of common noise sources from the Minnesota Pollution Control Agency: Page 5 of 7 has indicated the video capable scoreboard will be used for game-related activities and will not be used for advertising or sponsorship. B. Section 1250.06 – Meets Requirements In Section 1250.06, Permanent Signs for Athletic at Mounds View High School, Bethel University, and Northwestern College is permitted as an entrance gate style sign, affixed to a pressbox/grandstand, or signage included on the scoreboard. Such signage shall not be lit by a direct lighting source and constructed of durable materials (finished metal, finished wood, plastic). Under Subd. 1, Sign Area, the scoreboard field naming signage shall not exceed 40% of the total scoreboard area. The Applicant is not proposing signage that will be visible from a public roadway or from outside Bethel University. The scoreboard will feature a 4’ x 31’ field naming placard constructed of finished metal that is not illuminated. The “Bethel University” signage calculates to be approximately 22% of the total scoreboard area. 1355.04 Procedural Requirements for Specific Applications Section 1355.04, Subd. 5 of the Arden Hills Zoning Code states that a public hearing is not required for Site Plan Review, but neighboring property owners shall be notified. Notification was prepared in accordance with City policy. Findings of Fact The Planning Commission must make a finding as to whether or not the proposed application would adversely affect the surrounding neighborhood or the community as a whole based on the aforementioned factors. Staff offers the following findings for consideration: General Findings: 1. The Bethel University main campus at 3900 Bethel Drive is located in the Institutional Zoning District. 2. A Higher Education, College Campus is a Conditional Use in the Institutional District. 3. Bethel University operates under a Conditional Use Permit Master Plan. 4. Athletic fields and accessory equipment are permitted under the CUP Master and Amended Plan for Bethel University. 5. Bethel University has requested Site Plan Review approval for installation of a new scoreboard and sound system in the stadium fields and track area. 6. The accessory structure and lighting would be in compliance with all provisions of the Zoning Code. 7. A public hearing is not required for Site Plan Review. 8. The proposed application meets all setback requirements. Site Plan Review Evaluation Findings: 9. The proposed plan is not anticipated to have any impact on traffic or parking conditions because the additions do not include an increase in football field seating. 10. The proposed plan includes the addition of LED lights and will within a reasonable level increase illumination around the stadium fields. Page 6 of 7 11. The proposed project is reasonable because scoreboards considered an accessory structures are addressed in the Code as reasonable uses within educational athletic facilities. 12. The proposed plan will not produce any permanent noise, odors, vibration, smoke, dust, air pollution, heat, liquid, or solid waste, and other nuisance characteristics. 13. The proposed plan will impact drainage on the site. 14. The proposed plan will not impact school population density. 15. The proposed plan is not expected to have a visual impact on surrounding properties or on land use compatibility with uses and structures on surrounding land or adjoining land values because of distance and existing foliage the new accessory structure will not be easily visible from outside the Bethel University campus. 16. Park dedication requirements are not applicable. 17. The proposed plan does not conflict with the general purpose and intent of the Zoning Code or the Comprehensive Development Plan for the City. Proposed Motion Language Staff has provided the following options and motion language for this case. 1. Recommend Approval with Conditions: Motion to recommend approval of Planning Case 21- 016 for Site Plan Review at 3900 Bethel Drive, based on the findings of fact and the submitted plans, as amended by the conditions in the August 4, 2021, Report to the Planning Commission: a) All conditions of the original Conditional Use Permit and Amendments shall remain in full force and effect. b) That the project shall be completed in accordance with the plans submitted as amended by the conditions of approval. Any significant changes to these plans, as determined by the Senior Planner, shall require review and approval by the Planning Commission and City Council. c) The proposed structure shall conform to all other regulations in the City Code. d) A building permit shall be obtained for the proposed scoreboard. e) That all building and setback requirements shall be met. f) The scoreboard height shall not exceed 35 feet. g) That the sound system being installed within the scoreboard shall meet all applicable standards set by the EPA and MPCA. h) A separate sign permit shall be required and scoreboard signage must meet all requirements of City Code Section 1250. i) That the scoreboard shall not be used as a dynamic sign to display sponsorship advertising, messages or videos. j) A Bethel employee shall control the lighting and sound system at the football field. k) The use of the sound system and lights at the football field be capped at 10:00 PM, except on nights that have a Bethel University sponsored events. l) That an automatic dimmer module shall be installed to reduce the nighttime light output of the LED lighting of the scoreboard based on ambient light levels. m) That the applicant shall cooperate with all reasonable requests from the City to modify direction and intensity of light and sound emitted from the scoreboard to mitigate its impact. Page 7 of 7 n) The Applicant shall be required to provide photometric calculations for the stadium lighting including the LED lighting of the scoreboard at the property lines of all adjacent residential properties indicating the plan meets ordinance requirements. 2. Recommend Approval as Submitted: Motion to recommend approval of Planning Case 21- 016 for a Site Plan Review at 3900 Bethel Drive, based on the findings of fact and the submitted plans in the August 4, 2021 Report to the Planning Commission. 3. Recommend Denial: Motion to recommend denial of Planning Case 21-016 Site Plan Review at 3900 Bethel Drive, based on the following findings of fact: findings to deny should specifically reference the reasons for denial. 4. Table: Motion to table Planning Case 21-016 for Site Plan Review at 3900 Bethel Drive: a specific reason and/or information request should be included with a motion to table. Public Notice and Comments Staff published a notice in the Pioneer Press as per City procedure. Public notices were mailed out on July 22, 2021. The mailing was sent to neighbors within 500 feet of the subject parcel. Staff has received two inquiries for information regarding this application as of July 27, 2021. Deadline for Agency Actions The City of Arden Hills received the completed application for this request on July 20, 2021. Pursuant to Minnesota State Statute, the City must act on this request by September 18, 2021 (60 days), unless the City provides the petitioner with written reasons for an additional 60-day review period. With consent of the applicant, the City may extend the review period beyond the initial 120 days. Attachments A. Land Use Application B. Location Map C. Narrative D. Site Plans E. Existing Scoreboard F. Proposed Scoreboard G. Sound System Approved: CITY OF ARDEN HILLS, MINNESOTA PLANNING COMMISSION WEDNESDAY, AUGUST 4, 2021 6:30 P.M. - ARDEN HILLS CITY HALL CALL TO ORDER/ROLL CALL Pursuant to due call and notice thereof, Chair Paul Vijums called to order the regular Planning Commission meeting at 6:30 p.m. ROLL CALL Present were: Chair Paul Vijums and Commissioner Clayton Zimmerman (attending in person), Commissioners Marcie Jefferys (arrived via Zoom at 6:42 p.m.), Kurtis Weber and Jonathan Wicklund (attending via Zoom). Absent: Commissioners Steven Jones and Subbaya Subramanian. Also present were: Senior Planner Jessica Jagoe, Planning Consultant Jane Kansier and Councilmember Fran Holmes. APPROVAL OF AGENDA – AUGUST 4, 2021 Chair Vijums stated the agenda will stand as published. APPROVAL OF MINUTES June 9, 2021 – Planning Commission Regular Meeting Commissioner Zimmerman moved, seconded by Commissioner Wicklund, to approve the June 9, 2021, Planning Commission Regular Meeting as presented. A roll call vote was taken. The motion carried unanimously (4-0). PLANNING CASES A. Planning Case 21-016; 3900 Bethel Drive – Bolton & Menk on behalf of Bethel University – Site Plan Review of Scoreboard – No Public Hearing Senior Planner Jagoe stated Bolton & Menk (“The Applicant”), on behalf of Bethel University, is requesting a Site Plan Review for a proposed project at 3900 Bethel Drive (“Subject Property”) Planning Case 21-016; 3900 Bethel Drive –Bolton & Menk on behalf of Bethel University –Site Plan Review of Scoreboard –No Public Hearing Attachment J ARDEN HILLS PLANNING COMMISSION – August 4, 2021 2 to update the scoreboard and sound system adjacent to the stadium field and track located in the southern quadrant of the Bethel University Campus. Specific improvements include replacing the electronic scoreboard to an LED/Video capable scoreboard with sound system upgrade. Senior Planner Jagoe reported Bethel University was approved a Conditional Use Permit Amendment on May 3, 2021 for stadium field upgrades which included the addition of a new track around it and practice fields to be converted into multi-purpose fields in the southern quadrant of their main campus at 3900 Bethel Drive. The CUP Amendment application noted that Bethel University was proposing changes to the scoreboard. Conditions of the CUP Amendment approval were that a separate permit shall be required for the scoreboard and that prior to replacement of sound system, Bethel University would be required to submit new sound system plans to the City Council for approval. The Applicant is proposing to convert the existing electronic scoreboard to a LED/Video capable scoreboard with a sound system fully contained within the accessory structure. Senior Planner Jagoe reviewed the Site Data, the Plan Evaluation and provided the Findings of Fact for review: General Findings: 1. The Bethel University main campus at 3900 Bethel Drive is located in the Institutional Zoning District. 2. A Higher Education, College Campus is a Conditional Use in the Institutional District. 3. Bethel University operates under a Conditional Use Permit Master Plan. 4. Athletic fields and accessory equipment are permitted under the CUP Master and Amended Plan for Bethel University. 5. Bethel University has requested Site Plan Review approval for installation of a new scoreboard and sound system in the stadium fields and track area. 6. The accessory structure and lighting would be in compliance with all provisions of the Zoning Code. 7. A public hearing is not required for Site Plan Review. 8. The proposed application meets all setback requirements. Site Plan Review Evaluation Findings: 9. The proposed plan is not anticipated to have any impact on traffic or parking conditions because the additions do not include an increase in football field seating. 10. The proposed plan includes the addition of LED lights and will within a reasonable level increase illumination around the stadium fields. 11. The proposed project is reasonable because scoreboards considered an accessory structures are addressed in the Code as reasonable uses within educational athletic facilities. 12. The proposed plan will not produce any permanent noise, odors, vibration, smoke, dust, air pollution, heat, liquid, or solid waste, and other nuisance characteristics. 13. The proposed plan will impact drainage on the site. 14. The proposed plan will not impact school population density. 15. The proposed plan is not expected to have a visual impact on surrounding properties or on land use compatibility with uses and structures on surrounding land or adjoining land values because of distance and existing foliage the new accessory structure will not be easily visible from outside the Bethel University campus. 16. Park dedication requirements are not applicable. ARDEN HILLS PLANNING COMMISSION – August 4, 2021 3 17. The proposed plan does not conflict with the general purpose and intent of the Zoning Code or the Comprehensive Development Plan for the City. Senior Planner Jagoe stated staff recommends approval of Planning Case 21- 016 for Site Plan Review at 3900 Bethel Drive, based on the findings of fact and the submitted plans, as amended by the conditions in the August 4, 2021, Report to the Planning Commission: a) All conditions of the original Condition Use Permit and Amendments shall remain in full force and effect. b) That the project shall be completed in accordance with the plans submitted as amended by the conditions of approval. Any significant changes to these plans, as determined by the Senior Planner, shall require review and approval by the Planning Commission and City Council. c) The proposed structure shall conform to all other regulations in the City Code. d) A building permit shall be obtained for the proposed scoreboard. e) That all building and setback requirements shall be met. f) The scoreboard height shall not exceed 35 feet. g) That the sound system being installed within the scoreboard shall meet all applicable standards set by the EPA and MPCA. h) A separate sign permit shall be required and scoreboard signage must meet all requirements of City Code Section 1250. i) That the scoreboard shall not be used as a dynamic sign to display sponsorship advertising, messages or videos. j) A Bethel employee shall control the lighting and sound system at the football field. k) The use of the sound system and lights at the football field be capped at 10:00 PM, except on nights that have a Bethel University sponsored events. l) That an automatic dimmer module shall be installed to reduce the nighttime light output of the LED lighting of the scoreboard based on ambient light levels. m) That the applicant shall cooperate with all reasonable requests from the City to modify direction and intensity of light and sound emitted from the scoreboard to mitigate its impact. n) The Applicant shall be required to provide photometric calculations for the stadium lighting including the LED lighting of the scoreboard at the property lines of all adjacent residential properties indicating the plan meets ordinance requirements. Senior Planner Jagoe reviewed the options available to the Planning Commission on this matter: 1. Recommend Approval with Conditions 2. Recommend Approval as Submitted 3. Recommend Denial 4. Table Chair Vijums opened the floor to Commissioner comments. Commissioner Wicklund requested further information regarding Condition I. ARDEN HILLS PLANNING COMMISSION – August 4, 2021 4 Senior Planner Jagoe explained dynamic signs are not allowed in this zoning district, which meant the scoreboard LED display was to be used for game and Bethel related purposes only. Commissioner Wicklund questioned if the applicant supported the staff recommended conditions. Jay Pomeroy, Bolton & Menk representative, explained it was his hope the conditions were consistent with the remainder of the Site Plan approval. He reported the lights would stay on until 30 minutes after an event was done. He indicated the scoreboard illumination would be capped at 10:00 p.m. He stated this meeting was the first time he was seeing the conditions and Condition I had jumped out at him. Senior Planner Jagoe commented the language for use and time was not adjusted and was a condition from the CUP . Commissioner Jefferys asked why Bethel would have the sound and lights on until 10:00 p.m. if there was not a sponsored event in the stadium. Mr. Pomeroy stated the stadium sound and scoreboard would not be on unless there was a sponsored event in the stadium. Senior Planner Jagoe explained students or teams could be using the stadium for practice She reported this was the rationale behind Condition K. Chair Vijums commented this request met all City requirements and no variance was being requested. Senior Planner Jagoe stated this was the case. Chair Vijums asked what type of sponsored events would be held at the stadium. Mark Posner, Vice President of Facilities at Bethel University, reported athletic and sporting events, youth gatherings, and graduations could be held at the stadium. He indicated all events would be capped at 10:00 p.m. Councilmember Holmes explained the City Council wanted to ensure the lights and sound were used only for University sponsored events to and not for students using the field. Chair Vijums indicated the stadium already had an existing audio system and scoreboard and the City was simply approving the new LED Video scoreboard. Chair Vijums opened the public hearing at 7:01 p.m. Chair Vijums invited anyone for or against the application to come forward and make comment. There being no comment Chair Vijums closed the public hearing at 7:02 p.m. ARDEN HILLS PLANNING COMMISSION – August 4, 2021 5 Commissioner Wicklund moved and Commissioner Weber seconded a motion to recommend approval of Planning Case 21-016 for Site Plan Review at 3900 Bethel Drive based on the findings of fact and the submitted plans, as amended by the conditions in the August 4, 2021, report to the Planning Commission. A roll call vote was taken. The motion carried unanimously (5-0). B. Planning Case 21-017; Mounds View Public Schools – Amendment to the Approved Planned Unit Development – Public Hearing Senior Planner Jagoe stated Mounds View Public Schools (“The Applicant”) the Applicant is requesting a Planned Unit Development (PUD) Amendment for an extension for the timing of construction of road and safety improvements as it relates to the alignment of Lake Valentine Road at 1900 and 1901 Lake Valentine Road. Senior Planner Jagoe explained at their May 22, 2019 and subsequently amended on April 27, 2020, the City Council approved Planning Case 18-014 for a Planned Unit Development with Mounds View Public Schools for Mounds View High School. The amendment added 14 additional conditions to the existing Planned Unit Development to address existing traffic and pedestrian safety issues based on the findings contained within the study report, an evaluation of existing site conditions, and the Planned Unit Development Agreement. The terms of the PUD approval requires the School District to implement safety improvements on Lake Valentine Road to address traffic and increased pedestrian crossings between the school building and the north parking lot, including installation of turn lanes and other access improvements, trail and sidewalk improvements, pedestrian signal, signage and striping modifications, and drainage and utility improvements. Senior Planner Jagoe reported the Applicant originally proposed two separate phases of traffic and pedestrian safety improvements for Lake Valentine Road. Phase 1 safety improvements, installed in 2020, which included installation of a pedestrian traffic signal system, crosswalk markings, temporary painted center median, curb ramps and sidewalk pedestrian routes to the front of the school. Senior Planner Jagoe commented the Phase 2 traffic and pedestrian safety improvements were scheduled for construction in 2021 in order to allow the School District to acquire additional property from the State of Minnesota. This additional property would allow the relocation of the west entrance to the north parking lot to align with the drop-off/pick-up lot on the south side of Lake Valentine Road. Additional improvements include construction of a center median at the crosswalk, modifications to the south boundary of the north parking lot, and the construction of dedicated right turn lanes for westbound traffic accessing the east parking lot entrance and for the eastbound traffic accessing the drop-off/pick-up lot. The current schedule in the approved PUD does not allow the School District sufficient time for completion in 2021 due to design changes for realignment on school district land. Senior Planner Jagoe reviewed the surrounding area, the Plan Evaluation and provided the Findings of Fact for review: Planning Case #21-016 –No Public Hearing Required Applicant: Bethel University Property Location: 3900 Bethel Drive Request: Site Plan Review 1 Overview Request •May 2021 -Bethel University was approved a Conditional Use Permit (CUP) Amendment for stadium field upgrades and scoreboard. •Conditions of the CUP Amendment approval were that a separate permit shall be required for the scoreboard and that prior to replacement of sound system, Bethel University would be required to submit new sound system plans to the City Council for approval. •The Applicant is proposing to convert the existing electronic scoreboard to a LED/Video capable scoreboard with a sound system fully contained within the accessory structure. Plan Evaluation –District Requirements INST District Requirements Proposed Use Building Footprint 35%Maximum Replacement of Existing Accessory Structure Minimum Landscape Area 75% Minimum Meets Requirements –No Proposed Changes Height 35 feet Maximum Proposal Complies Setbacks 100 feet from Abutting Residential Properties No Structures within 100 feet of Abutting Residential Properties Existing Scoreboard Proposed Scoreboard Plan Evaluation – Permanent Accessory Structures •Proposal to replace existing electronic scoreboard with an LED/Video capable scoreboard as an accessory structure which is allowed in the INST District. •Permanent accessory structures in any district, except residential, shall be subject to Council approval. •Exterior finish shall be compatible in appearance and material used with the principal structure served by the accessory structure. •Aesthetic features will include: •Steel beams encased with brick and stucco solid base. •Same materials will be visible in view of the base backside of the scoreboard. •Support steel columns to be painted. Example Backside View Plan Evaluation –Height •Accessory structures in all other Zoning Districts, except residential, shall not exceed the height of the principal structure to which it is accessory. •Maximum height in the INST District is 35 feet. •Current accessory structure – •308 square feet of scoreboard area (14’ x 22’) and is 26’ tall. •Proposed accessory structure – •560 square feet of scoreboard area (approx. 17’ x 31’) and height of 31’9” tall. Plan Evaluation –Setbacks •Setbacks in the INST District are: •50 feet in the front yard •20 feet in the rear yard •10 feet in the side yard •Structures must be located a minimum of 100 feet from abutting residential property. •Proposed scoreboard will be moved southwest of the existing scoreboard location and will be approximately 135 feet from the south property line. Property Line 135’ Plan Evaluation – Lighting •Proposed scoreboard will be a full color approximately 17’ tall by 31’ wide LED video display. •A photometric plan with illumination levels including the LED/Video display was provided as part of this application. •The maximum illumination shown on the Applicant’s photometric plan is 1.28 foot candles on the north side of the proposed new scoreboard location. The light levels at the Railroad ROW are less than 0.43 foot candles. •The proposed location of the LED/Video capable scoreboard in the SW corner of the stadium is positioned in a manner to direct the light pattern towards the stadium. Plan Evaluation – Noise •CUP Amendment required to submit new sound system plans to the City Council for approval. •Proposed sound system -SP-1000 Stadium Pro Sound from Nevco. •Fully embedded sound cabinet within the scoreboard accessory structure. •4’ tall by 6’ wide located atop of the LED screen. •Surrounded by a 1” thick acoustic foam. •Foam is said to reduce sound wave vibrations to the mechanical structure, but also dampens the sound waves leaving the rear of the display. •There are no other sound system amplification or speakers proposed as part of the stadium upgrades. Previous review and discussion included speakers attached to lighting, but that has been eliminated. •Sound cabinet = 2 speakers and 1 subwoofer Plan Evaluation – Noise •Existing scoreboard current PA system is max upper 70 dB’s at the property line. •Closer to the pressbox will climb to the mid 80’s. •Levels standing on the bleachers in front of the speakers did reach 90 dB, but never reached 100 dB. •SP-1000 enclosure will be in the lower frequency levels of 70-80 dB’s. Plan Evaluation –Noise •SP-1000 speakers are directional speakers. Aimed at the home bleachers. Not proposed scoreboard location. Will be SW corner. Plan Evaluation –Signage Section 1250.05, Permanent Scoreboard Signs for Athletic Fields at Mounds View High School, Bethel University, and Northwestern College •Athletic fields may be permitted signage that is clearly secondary to the overall appearance of the scoreboard. Such signage shall face the field of play so that the impact of the signage is directed only to those utilizing the field or watching the sporting event, and not surrounding property owners.The content of scoreboard signage shall comply with the sponsorship sign regulations as established by Bethel University. •The Applicant has indicated the video capable scoreboard will be used for game -related activities and will not be used for advertising or sponsorship. Plan Evaluation –Signage Section 1250.06, Permanent Signs for Athletic at Mounds View High School, Bethel University, and Northwestern College •Permitted as an entrance gate style sign, affixed to a pressbox/grandstand, or signage included on the scoreboard. Such signage shall not be lit by a direct lighting source and constructed of durable materials (finished metal, finished wood, plastic). Under Subd. 1, Sign Area, the scoreboard field naming signage shall not exceed 40% of the total scoreboard area. •The scoreboard will feature a 4’ x 31’ field naming placard constructed of finished metal that is not illuminated. The “Bethel University” signage calculates to be approximately 22% of the total scoreboard area. Public Notice •Notice was published in the Pioneer Press on August 12, 2021. Notice was prepared by the City and mailed to property owners within 500 feet of the subject property. •No comments received as of August 18th. Planning Case 21-016 –Bethel University Site Plan Review 16 Questions? Page 1 of 2 NEW BUSINESS – 9A MEMORANDUM DATE: August 23, 2021 TO: Honorable Mayor and City Councilmembers Dave Perrault, City Administrator FROM: David Swearingen, Interim Public Works Director SUBJECT: Resolution 2021-046 Ordering Improvement and Preparation of Plans and Specifications for the Arden Oaks Street Improvements Project Budgeted Amount: Actual Amount: Funding Source: $827,000 $583,000 PIR, Surface Water, Sanitary, (Estimated) Water, Special Assessments Council Should Consider Motion to approve, table, or deny the following: • Adopting Resolution 2021-046 Ordering Improvement and Preparation of Plans and Specifications for the Arden Oaks Street Improvements Project. All items need a simple majority for action unless otherwise noted. Background/Discussion Following the public hearing under agenda item No. 8A, the next step in the project delivery process is to approve a resolution ordering the improvements and the preparation of plans and specifications for the Arden Oaks Street Improvements Project. The resolution document provided in Attachment A would order the improvements and plans in accordance with the recommendations provided in the project feasibility report. Attachments Attachment A: Resolution 2021-046 To view the final document, access adopted Resolutions via Arden Hills Public Laserfiche Weblink by visiting cityofardenhills.org and clicking on Archived Documents under Helpful Links on our main webpage. CITY OF ARDEN HILLS COUNTY OF RAMSEY STATE OF MINNESOTA RESOLUTION NO. 2021-046 A RESOLUTION ORDERING IMPROVEMENT AND PREPARATION OF PLANS AND SPECIFICATIONS FOR THE ARDEN OAKS STREET IMPROVEMENTS PROJECT WHEREAS, on July 26, 2021, the City Council adopted Resolution 2021-042, ordering a public hearing on the proposed improvement of the following streets: Arden Oaks Drive from Snelling Avenue North to County Road E Arden Oaks Court from Arden Oaks Drive to the west termini and; WHEREAS, ten days mailed notice and two weeks published notice of the hearing was given, and the hearing was held on August 23, 2021, at which time all persons desiring to be heard were given an opportunity to be heard thereon. NOW THEREFORE, BE IT RESOLVED BY THE CITY COUNCIL OF ARDEN HILLS, MINNESOTA: 1. Such improvement is necessary, cost-effective, and feasible as detailed in the feasibility report. 2. Such improvements are hereby ordered as proposed in the Council resolution adopted July 26, 2021 and recommended in the project feasibility report. 3. The City of Arden Hills Engineering Department, with assistance from the City’s selected consultant engineer, is hereby designated as the engineer for this improvement. The engineers shall prepare plans and specifications for the making of such improvement. ADOPTED BY THE CITY COUNCIL OF THE CITY OF ARDEN HILLS THIS 23rd DAY OF AUGUST, 2021. ____________________________________ David Grant, Mayor ATTEST: ______________________________________ Julie Hanson, City Clerk Page 1 of 2 NEW BUSINESS – 9B MEMORANDUM DATE: August 23, 2021 TO: Honorable Mayor and City Councilmembers Dave Perrault, City Administrator FROM: David Swearingen, Interim Public Works Director SUBJECT: Resolution 2021-047 Ordering Improvement and Preparation of Plans and Specifications for the Lexington Avenue and Target Rd Traffic Signal System Improvements Budgeted Amount: Actual Amount: Funding Source: $323,000 $198,916.75 Special Assessments Per current CIP estimate Street light portion Council Should Consider Motion to approve, table, or deny the following: • Adopt Resolution 2021-047 Ordering Improvement and Preparation of Plans and Specifications for the Lexington Avenue and Target Rd Traffic Signal System Improvements All items need a simple majority for action unless otherwise noted. Background/Discussion Following the public hearing under agenda item No. 8B, this next step in the project delivery process is to approve a resolution ordering the improvements and the preparation of plans and specifications for Lexington Avenue and Target Rd Traffic Signal System Improvements. The resolution document provided in Attachment A would order the improvements and plans in accordance with the recommendations provided in the project feasibility report. Attachments Attachment A: Resolution 2021-047 To view the final document, access adopted Resolutions via Arden Hills Public Laserfiche Weblink by visiting cityofardenhills.org and clicking on Archived Documents under Helpful Links on our main webpage. CITY OF ARDEN HILLS COUNTY OF RAMSEY STATE OF MINNESOTA RESOLUTION NO. 2021-047 A RESOLUTION ORDERING IMPROVEMENT AND PREPARATION OF PLANS AND SPECIFICATIONS FOR THE LEXINGTON AVENUE AND TARGET ROAD TRAFFIC SIGNAL SYSTEM IMPROVEMENTS WHEREAS, on AUGUST 9, 2021, the City Council adopted Resolution 2021-044, ordering a public hearing on the proposed improvement at the intersection of Lexington Avenue North and Target Road. and; WHEREAS, ten days mailed notice and two weeks published notice of the hearing was given, and the hearing was held on August 23, 2021, at which time all persons desiring to be heard were given an opportunity to be heard thereon. NOW THEREFORE, BE IT RESOLVED BY THE CITY COUNCIL OF ARDEN HILLS, MINNESOTA: 1. Such improvement is necessary, cost-effective, and feasible as detailed in the feasibility report. 2. Such improvements are hereby ordered as proposed in the Council resolution adopted August 9, 2021 and recommended in the project feasibility report. 3. The City of Arden Hills Engineering Department is hereby designated as the engineer for this improvement. The engineer shall prepare plans and specifications for the making of such improvement. ADOPTED BY THE CITY COUNCIL OF THE CITY OF ARDEN HILLS THIS 23rd DAY OF AUGUST, 2021. ____________________________________ David Grant, Mayor ATTEST: ______________________________________ Julie Hanson, City Clerk ________________________________________________________________________________________________________ Page 1 of 3 NEW BUSINESS – 9C MEMORANDUM DATE: August 23, 2021 TO: Honorable Mayor and City Councilmembers Dave Perrault, City Administrator FROM: Jessica Jagoe, Senior Planner SUBJECT: Planning Case # 21-017 Applicant: ISD #621 – Mounds View Public Schools Property Location: 1900 and 1901 Lake Valentine Road Request: Planned Unit Development Amendment Budgeted Amount: Actual Amount: Funding Source: N/A N/A N/A Council Should Consider the Following: Motions to approve, table, or deny the following: • Planning Case 21-017 for a Planned Unit Development Amendment for Mounds View Public Schools for an extension for the timing of construction of road and safety improvements. Approval of an amended PUD requires an affirmative vote of four councilmembers. Background The City Council approved Planning Case 18-014 for a Planned Unit Development with Mounds View Public Schools for Mounds View High School in 2019 and subsequently amended in 2020. The amendment added 14 additional conditions to the existing Planned Unit Development to address existing traffic and pedestrian safety issues based on the findings contained within the study report, an evaluation of existing site conditions, and the Planned Unit Development Agreement. The terms of the PUD approval requires the School District to implement safety improvements on Lake Valentine Road in two phases to address traffic and increased pedestrian crossings between the school building and the north parking lot, including installation of turn lanes and other access improvements, trail and sidewalk improvements, pedestrian signal, signage and striping modifications, and drainage and utility improvements. The current schedule in the approved PUD does not allow the School District sufficient time for completion in 2021 due to design changes for realignment on school district land. The Applicant is requesting the City Council consider an extension of the deadline to 2022. Page 2 of 3 The City Council was asked to hold the required public hearing for Planning Case 21-017 under Agenda Item 8C. A full evaluation of the proposed amendment and supporting attachments are included in the staff report under Agenda Item XX. The remainder of this memo focuses on the requested approvals, findings of fact and the staff recommended conditions if a motion to approve is made. Suggested Findings of Fact: The Planning Commission reviewed this application at their August 4, 2021, meeting and have offered the following findings of fact for your consideration: 1. The properties located at 1900 and 1901 Lake Valentine Road are located in the R-1 Single Family Residential District. 2. The proposed conditions when implemented will create a safer environment for pedestrian movement across Lake Valentine Road. 3. The proposed roadway improvements will improve traffic flow through the road section adjacent to the school. 4. With the applied conditions, the application is not anticipated to create a negative impact on the immediate area or the community as a whole. 5. The traffic and pedestrian study was reviewed as part of the April 2020 Amended PUD application by City and School District staff. 6. The City and School District staff concur on the proposed conditions and recommended improvements. 7. A public hearing for a PUD Amendment request is required before the request can be brought before the City Council. 8. The Planning Commission conducted a public hearing on August 4, 2021. Options and Motion Language The Planning Commission reviewed this application at their August 4, 2021 meeting. At that time, they recommended approval of the Mounds View Public Schools application for a Planned Unit Development Amendment by a 5-0 vote. The following are motion language options for the City Council to consider. Approval with Conditions: Motion to approve Planning Case 21-017, for a PUD Amendment for Mounds View Public Schools based on the findings of fact, submitted plans, and the August 23, 2021 Report to the City Council, subject to the following conditions: 1. Extension on timeline for construction and realignment of the west parking lot entrance to align with the west school site entrance on the south side of Lake Valentine Road (Pick-up / Drop-off Access) to be completed prior to the start of the 2022-2023 school year. The School District shall submit a revised design and layout for the road and safety improvements on existing school property Site Plan Review and approval no later than December 31, 2021. 2. All other conditions of the original Planned Unit Development and Amended Planned Unit Development shall remain in full force and effect. Page 3 of 3 Approval without Conditions: Motion to approve Planning Case 21-017 for a PUD Amendment for Mounds View Public Schools based on the findings of fact, submitted plans, and the August 23, 2021 Report to the City Council. Denial: Motion to deny Planning Case 21-017 for a PUD Amendment for Mounds View Public Schools based on the following findings of fact: the City Council should identify findings to deny should specifically reference the reasons for denial and why those reasons cannot be mitigated. Table: Motion to table Planning Case 21-017 for a PUD Amendment for Mounds View Public Schools for the following reasons: the City Council should identify a specific reason and/or information request should be included with a motion to table. Deadline for Agency Action The City of Arden Hills received the completed application for this request on July 13, 2021. Pursuant to Minnesota State Statute, the City must act on this request by September 11, 2021 (60 days), unless the City provides the petitioner with written reasons for an additional 60-day review period. With consent of the applicant, the City may extend the review period beyond the initial 120 days. Budget Impact NA Attachment A. Presentation •Planning Case #21-017 –Public Hearing Required •Applicant: ISD #621 –Mounds View Public Schools •Request: Planned Unit Development Amendment Background •Planning Case 18-014 –Planned Unit Development Approved May 22, 2019 & Amended April 27, 2020. •PUD requires the safety improvements on Lake Valentine Road to address traffic and increased pedestrian crossings between the school building and the north parking lot to be completed prior to the 2021-2022 school year. •Phase 1 safety improvements, installed in 2020, included installation of a pedestrian traffic signal system, crosswalk markings, temporary painted center median, curb ramps and sidewalk pedestrian routes to the front of the school. •Phase 2 was scheduled for construction in 2021 in order to provide time to potentially acquire additional property from the State of Minnesota. •The School District has been unsuccessful the past 2 years in obtaining an easement or acquisition of land. The Applicant believes this option is no longer feasible and is preparing an alternate design. Deadline for Agency Action •The City of Arden Hills received the completed application for this request on July 13, 2021. Pursuant to Minnesota State Statute, the City must act on this request by September 11, 2021 (60 days), unless the City provides the petitioner with written reasons for an additional 60-day review period. With consent of the applicant, the City may extend the review period beyond the initial 120 days. Options and Motion Language - •Approval with Conditions:Motion to approve Planning Case 21-017, for a PUD Amendment for Mounds View Public Schools based on the findings of fact, submitted plans, and the August 23, 2021 Report to the City Council, subject to the following conditions: •Extension on timeline for construction and realignment of the west parking lot entrance to align with the west school site entrance on the south side of Lake Valentine Road (Pick-up / Drop-off Access) to be completed prior to the start of the 2022-2023 school year. The School District shall submit a revised design and layout for the road and safety improvements on existing school property Site Plan Review and approval no later than December 31, 2021. •All other conditions of the original Planned Unit Development and Amended Planned Unit Development shall remain in full force and effect. •Approval without Conditions: Motion to approve Planning Case 21-017 for a PUD Amendment for Mounds View Public Schools based on the findings of fact, submitted plans, and the August 23, 2021 Report to the City Council. •Denial:Motion to deny Planning Case 21-017 for a PUD Amendment for Mounds View Public Schools based on the following findings of fact: the City Council should identify findings to deny should specifically reference the reasons for denial and why those reasons cannot be mitigated. •Table:Motion to table Planning Case 21-017 for a PUD Amendment for Mounds View Public Schools for the following reasons: the City Council should identify a specific reason and/or information request should be included with a motion to table. Planning Case 21-017 –Mounds View Public Schools PUD Amendment Questions? Page 1 of 2 NEW BUSINESS – 9D MEMORANDUM DATE: August 23, 2021 TO: Honorable Mayor and City Councilmembers Dave Perrault, City Administrator FROM: Jessica Jagoe, Senior Planner SUBJECT: Planning Case #21-018 – Public Hearing Required Applicant: City of Arden Hills Request: Zoning Code Amendment – Chapter 13 – Section 1330.02 Subd. 1 Budgeted Amount: Actual Amount: Funding Source: N/A N/A N/A Council Should Consider Motions to approve, table, or deny the following: • Planning Case 21-018 for an amendment to the language Section 1330.02 Subd. 1, of the Arden Hills City Code to amend the lake classification for Little Johanna from a Recreational Development Lake to a General Development Lake. Approval of a Zoning Code Amendment requires an affirmative vote of three councilmembers. Background The City Council was asked to hold the required public hearing for Planning Case 21-018 under Agenda Item 8D. A full evaluation of the proposed amendment and supporting attachments are included in the staff report under Agenda Item 8D. The remainder of this memo focuses on the requested approvals, findings of fact and the staff recommended options and motion language. Suggested Findings of Fact The Planning Commission reviewed this application at their August 4, 2021, meeting and have offered the following findings of fact for your consideration: Page 2 of 2 General Findings: 1. The City of Arden Hills is proposing amendments to the language of Chapter 13 – Zoning Code of the City Code. 2. The City of Arden Hills is proposing to classify Little Johanna as a General Development Lake. 3. Amendments to the Shoreland Regulations require approval from the Minnesota DNR. 4. Amendments to the Zoning Code regulations require a public hearing prior to action by the City Council. 5. The Planning Commission conducted a public hearing on August 4, 2021. Options and Motion Language The Planning Commission reviewed this application at their August 4, 2021 meeting. At that time, they recommended approval of Planning Case 21-018 for a Zoning Code Amendment to Chapter 13 of the Arden Hills City Code to amend the lake classification for Little Johanna from a Recreational Development Lake to a General Development Lake by a 5-0 vote. The following are motion language options for the City Council to consider. 1. Approval: Motion to approve and authorization to publish ordinance for Planning Case 21- 018 for a Zoning Code Amendment to Chapter 13 of the Arden Hills City Code to amend the lake classification of Little Johanna from a Recreational Development Lake to a General Development Lake based on the findings of fact and the August 23, 2021 Report to the City Council. 2. Approval with Amendments: Motion and authorization to publish ordinance to approve Planning Case 21-018 for a Zoning Code Amendment to Chapter 13 of the Arden Hills City Code to amend the lake classification of Little Johanna from a Recreational Development Lake to a General Development Lake based on the findings of fact and the August 23, 2021 Report to the City Council with amendments. 3. Denial: Motion to deny Planning Case Planning Case 21-018 for a Zoning Code Amendment to Chapter 13 based on the findings of fact: findings to deny should specifically reference the reasons for denial and why those reasons cannot be mitigated. 4. Table: Motion to table Planning Case 21-018 for a Zoning to Chapter 13 for the following reasons: a specific reason and/or information request should be included with a motion to table. Budget Impact N/A Attachments A. Ordinance 2021-007 (Redlined) B. Ordinance 2021-007 (Clean) C. Presentation Page 1 of 2 ORDINANCE NO. 2021-007 CITY OF ARDEN HILLS RAMSEY COUNTY, MINNESOTA AN ORDINANCE AMENDING CHAPTER 13, ZONING CODE, SECTION 1330, SUBSECTION 1330.02, SUBD. 1 OF THE ARDEN HILLS CITY CODE THE CITY COUNCIL OF THE CITY OF ARDEN HILLS, MINNESOTA, ORDAINS: SECTION 1. Chapter 13, Zoning Code, Section 1330.02, Shoreland Management Districts and Uses, Subd. 1, is hereby amended by deleting strikethrough language and adding the underlined language as follows: 1330.02 Shoreland Management Districts and Uses. Subd. 1. Classification of Lakes. (revised 8/23/21) DNR I.D. No. General Development Lakes: Josephine 62-57 Johanna 62-78 Karth 62-72 Little Johanna 62-58 Recreational Development Lakes: Little Johanna 62-58 Round Lake 62-70 Natural Environmental Lakes: Sunfish 62-65 Valentine 62-71 SECTION 2. This Ordinance shall become effective the day following its publication. Page 2 of 2 To view the final document, access adopted Ordinances via Arden Hills Public Laserfiche Weblink by visiting cityofardenhills.org and clicking on Archived Documents under Helpful Links on our main webpage. PASSED and ADOPTED this 23rd day of August, 2021, by the City Council of the City of Arden Hills, Minnesota. CITY OF ARDEN HILLS By _______________________________ David Grant, Mayor ATTEST: _____________________________ Julie Hanson, City Clerk Published in the St. Paul Pioneer Press on August 26, 2021. ORDINANCE NO. 2021-007 CITY OF ARDEN HILLS RAMSEY COUNTY, MINNESOTA AN ORDINANCE AMENDING CHAPTER 13, ZONING CODE, SECTION 1330, SUBSECTION 1330.02, SUBD. 1 OF THE ARDEN HILLS CITY CODE THE CITY COUNCIL OF THE CITY OF ARDEN HILLS, MINNESOTA, ORDAINS: SECTION 1. Chapter 13, Zoning Code, Section 1330.02, Shoreland Management Districts and Uses, Subd. 1, is hereby amended as follows: 1330.02 Shoreland Management Districts and Uses. Subd. 1. Classification of Lakes. (revised 8/23/21) DNR I.D. No. General Development Lakes: Josephine 62-57 Johanna 62-78 Karth 62-72 Little Johanna 62-58 Recreational Development Lakes: Round Lake 62-70 Natural Environmental Lakes: Sunfish 62-65 Valentine 62-71 SECTION 2. This Ordinance shall become effective the day following its publication. PASSED and ADOPTED this 23rd day of August, 2021, by the City Council of the City of Arden Hills, Minnesota. CITY OF ARDEN HILLS By _______________________________ David Grant, Mayor ATTEST: _____________________________ Julie Hanson, City Clerk Published in the St. Paul Pioneer Press on August 26, 2021. •Planning Case #21-018 –Public Hearing Required •Applicant: City of Arden Hills •Request: Zoning Code Amendment Section 1330.01 Subd. 1, Classification of Lakes •June 7, 2021 -City Council Special Work Session, staff was given direction to submit Resolution 85-22 to the DNR as approved on May 13, 1985. •June 23, 2021 -DNR approves Lake Reclassifications of Resolution 85-22. •August 5, 2021 –The Planning Commission voted unanimously to recommend approval of ordinance amendment. Redlined Ordinance Amendment - Options and Motion Language - •Approval:Motion to approve and authorization to publish ordinance for Planning Case 21-018 for a Zoning Code Amendment to Chapter 13 of the Arden Hills City Code to amend the lake classification of Little Johanna from a Recreational Development Lake to a General Development Lake based on the findings of fact and the August 23, 2021 Report to the City Council. •Approval with Amendments: Motion and authorization to publish ordinance to approve Planning Case 21-018 for a Zoning Code Amendment to Chapter 13 of the Arden Hills City Code to amend the lake classification of Little Johanna from a Recreational Development Lake to a General Development Lake based on the findings of fact and the August 23, 2021 Report to the City Council with amendments. •Denial:Motion to deny Planning Case Planning Case 21-018 for a Zoning Code Amendment to Chapter 13 based on the findings of fact: findings to deny should specifically reference the reasons for denial and why those reasons cannot be mitigated. •Table:Motion to table Planning Case 21-018 for a Zoning to Chapter 13 for the following reasons: a specific reason and/or information request should be included with a motion to table. Planning Case 21-018 –Shoreland Ordinance Amendment Questions? ________________________________________________________________________________________________________ Page 1 of 4 NEW BUSINESS – 9E MEMORANDUM DATE: August 23, 2021 TO: Honorable Mayor and City Councilmembers Dave Perrault, City Administrator FROM: Jessica Jagoe, Senior Planner SUBJECT: Planning Case # 21-016 – No Public Hearing Required Applicant: Bolton & Menk Property Location: 3900 Bethel Drive Request: Site Plan Review Budgeted Amount: Actual Amount: Funding Source: N/A N/A N/A Council Should Consider the Following: Motions to approve, table, or deny the following: • Planning Case 21-016 for Site Plan Review for Bethel University to update the scoreboard and sound system adjacent to the stadium field and track located in the southern quadrant of the Bethel University Campus. Specific improvements include replacing the electronic scoreboard to an LED/Video capable scoreboard with sound system upgrade. Approval of a Site Plan Review requires an affirmative vote of three councilmembers. Background Bethel University was approved a Conditional Use Permit Amendment on May 3, 2021 for stadium field upgrades which included the addition of a new track around it and practice fields to be converted into multi-purpose fields in the southern quadrant of their main campus at 3900 Bethel Drive. The CUP Amendment application noted that Bethel University was proposing changes to the scoreboard. Conditions of the CUP Amendment approval were that a separate permit shall be required for the scoreboard and that prior to replacement of sound system, Bethel University would be required to submit new sound system plans to the City Council for approval. The Applicant is proposing to convert the existing electronic scoreboard to a LED/Video capable scoreboard with a sound system fully contained within the accessory structure. Page 2 of 4 The City Council is not required to hold a public hearing for a Site Plan Review. For this application, the public was given an opportunity to comment on Planning Case 21-016 under Agenda Item 8E. A full evaluation of the proposed site plan review and improvements are included in the staff report under Agenda Item 8E. The remainder of this memo focuses on the requested approvals, findings of fact and the staff recommended conditions if a motion to approve is made. Suggested Findings of Fact: The Planning Commission reviewed this application at their August 4, 2021, meeting and have offered the following findings of fact for your consideration: General Findings: 1. The Bethel University main campus at 3900 Bethel Drive is located in the Institutional Zoning District. 2. A Higher Education, College Campus is a Conditional Use in the Institutional District. 3. Bethel University operates under a Conditional Use Permit Master Plan. 4. Athletic fields and accessory equipment are permitted under the CUP Master and Amended Plan for Bethel University. 5. Bethel University has requested Site Plan Review approval for installation of a new scoreboard and sound system in the stadium fields and track area. 6. The accessory structure and lighting would be in compliance with all provisions of the Zoning Code. 7. A public hearing is not required for Site Plan Review. 8. The proposed application meets all setback requirements. Site Plan Review Evaluation Findings: 9. The proposed plan is not anticipated to have any impact on traffic or parking conditions because the additions do not include an increase in football field seating. 10. The proposed plan includes the addition of LED lights and will within a reasonable level increase illumination around the stadium fields. 11. The proposed project is reasonable because scoreboards considered an accessory structures are addressed in the Code as reasonable uses within educational athletic facilities. 12. The proposed plan will not produce any permanent noise, odors, vibration, smoke, dust, air pollution, heat, liquid, or solid waste, and other nuisance characteristics. 13. The proposed plan will impact drainage on the site. 14. The proposed plan will not impact school population density. 15. The proposed plan is not expected to have a visual impact on surrounding properties or on land use compatibility with uses and structures on surrounding land or adjoining land values because of distance and existing foliage the new accessory structure will not be easily visible from outside the Bethel University campus. 16. Park dedication requirements are not applicable. 17. The proposed plan does not conflict with the general purpose and intent of the Zoning Code or the Comprehensive Development Plan for the City. 18. A public hearing for a Site Plan Review is not required before the request can be brought before the City Council. Page 3 of 4 19. The Planning Commission conducted a public hearing to allow for comment on August 4, 2021. Options and Motion Language The Planning Commission reviewed this application at their August 4, 2021 meeting. At that time, they recommended approval of the Bethel University application for Site Plan Review by a 5-0 vote. The following are motion language options for the City Council to consider. Approval with Conditions: Motion to adopt Resolution 2021-048, approving Planning Case 21- 016, for Site Plan Review for Bethel University based on the findings of fact, submitted plans, and the August 23, 2021 Report to the City Council, subject to the following conditions: 1) All conditions of the original Conditional Use Permit and Amendments shall remain in full force and effect. 2) That the project shall be completed in accordance with the plans submitted as amended by the conditions of approval. Any significant changes to these plans, as determined by the Senior Planner, shall require review and approval by the Planning Commission and City Council. 3) The proposed structure shall conform to all other regulations in the City Code. 4) A building permit shall be obtained for the proposed scoreboard. 5) That all building and setback requirements shall be met. 6) The scoreboard height shall not exceed 35 feet. 7) That the sound system being installed within the scoreboard shall meet all applicable standards set by the EPA and MPCA. 8) A separate sign permit shall be required and scoreboard signage must meet all requirements of City Code Section 1250. 9) That the scoreboard shall not be used as a dynamic sign to display sponsorship advertising, messages or videos. 10) A Bethel employee shall control the lighting and sound system at the football field. 11) The use of the sound system and lights at the football field be capped at 10:00 PM, except on nights that have a Bethel University sponsored events. 12) That an automatic dimmer module shall be installed to reduce the nighttime light output of the LED lighting of the scoreboard based on ambient light levels. 13) That the applicant shall cooperate with all reasonable requests from the City to modify direction and intensity of light and sound emitted from the scoreboard to mitigate its impact. 14) The Applicant shall be required to provide photometric calculations for the stadium lighting including the LED lighting of the scoreboard at the property lines of all adjacent residential properties indicating the plan meets ordinance requirements. Approval without Conditions: Motion to adopt Resolution 2021-048, approving Planning Case 21- 016, for Site Plan Review for Bethel University based on the findings of fact, submitted plans, and the August 23, 2021 Report to the City Council. Denial: Motion to deny Resolution 2021-048, approving Planning Case 21-016, for Site Plan Review for Bethel University based on the following findings of fact: the City Council should Page 4 of 4 identify findings to deny should specifically reference the reasons for denial and why those reasons cannot be mitigated. Table: Motion to table Resolution 2021-048, approving Planning Case 21-016, for Site Plan Review for Bethel University for the following reasons: the City Council should identify a specific reason and/or information request should be included with a motion to table. Deadline for Agency Action The City of Arden Hills received the completed application for this request on July 20, 2021. Pursuant to Minnesota State Statute, the City must act on this request by September 18, 2021 (60 days), unless the City provides the petitioner with written reasons for an additional 60-day review period. With consent of the applicant, the City may extend the review period beyond the initial 120 days. Budget Impact N/A Attachment A. Resolution 2021-048 B. Presentation To view the final document, access adopted Resolutions via Arden Hills Public Laserfiche Weblink by visiting cityofardenhills.org and clicking on Archived Documents under Helpful Links on our main webpage. 1 CITY OF ARDEN HILLS COUNTY OF RAMSEY STATE OF MINNESOTA RESOLUTION NO. 2021-048 RESOLUTION APPROVING A SITE PLAN REVIEW FOR THE SUBJECT PROPERTY 3900 BETHEL DRIVE WHEREAS, City Staff received a land use application for 3900 Bethel Drive (“Subject Property”) for a Site Plan Review on July 20, 2021; WHEREAS, the Subject Property is located in the INST – Institutional Zoning District and is guided as Public & Institutional in the Land Use plan; WHEREAS, the Subject Property’s use as an educational institution was previously approved under a Conditional Use Permit Master Plan (“Planning Case No. 78-5”); WHEREAS, a Site Plan Review is required for construction of a permanent accessory structure in this zoning district; WHEREAS, the Applicant is proposing to upgrade the scoreboard and sound system adjacent to the stadium field and track; WHEREAS, Subject Property meets the special district provisions for the INST District to operate an education institution use; WHEREAS, the City Council directed Staff to prepare a Land Use Application Public Policy Notification to notify all property owners within 500 feet of Subject Property when a request for the Planning Commission is to occur related to a land use application that does not require a public hearing; WHEREAS, the City’s obligation has been met where the Arden Hills Planning Commission did hold a public hearing on August 4, 2021. All persons present at said meeting were given an opportunity to be heard and present written statements; and WHEREAS the Planning Commission considered the Applicant’s request for a Site Plan Review and, as such voted 5-0 in favor of the recommending approval with conditions. NOW, THEREFORE, BE IT RESOLVED THAT THE CITY COUNCIL OF THE CITY OF ARDEN HILLS: To view the final document, access adopted Resolutions via Arden Hills Public Laserfiche Weblink by visiting cityofardenhills.org and clicking on Archived Documents under Helpful Links on our main webpage. 2 Hereby adopts Resolution 2021-048 approving Planning Case 21-016 for a Site Plan Review at the Subject Property 3900 Bethel Drive to update the scoreboard and sound system adjacent to the stadium field and track. BE IT FURTHER RESOLVED that City Council approves Planning Case 21-016 for a Site Plan Review at the Subject Property 3900 Bethel Drive, based on the findings of fact and the submitted plans and August 23, 2021 Report to the City Council, as amended by the following conditions: 1) All conditions of the original Conditional Use Permit and Amendments shall remain in full force and effect. 2) That the project shall be completed in accordance with the plans submitted as amended by the conditions of approval. Any significant changes to these plans, as determined by the Senior Planner, shall require review and approval by the Planning Commission and City Council. 3) The proposed structure shall conform to all other regulations in the City Code. 4) A building permit shall be obtained for the proposed scoreboard. 5) That all building and setback requirements shall be met. 6) The scoreboard height shall not exceed 35 feet. 7) That the sound system being installed within the scoreboard shall meet all applicable standards set by the EPA and MPCA. 8) A separate sign permit shall be required and scoreboard signage must meet all requirements of City Code Section 1250. 9) That the scoreboard shall not be used as a dynamic sign to display sponsorship advertising, messages or videos. 10) A Bethel employee shall control the lighting and sound system at the football field. 11) The use of the sound system and lights at the football field be capped at 10:00 PM, except on nights that have a Bethel University sponsored events. 12) That an automatic dimmer module shall be installed to reduce the nighttime light output of the LED lighting of the scoreboard based on ambient light levels. 13) That the applicant shall cooperate with all reasonable requests from the City to modify direction and intensity of light and sound emitted from the scoreboard to mitigate its impact. 14) The Applicant shall be required to provide photometric calculations for the stadium lighting including the LED lighting of the scoreboard at the property lines of all adjacent residential properties indicating the plan meets ordinance requirements. PASSED AND ADOPTED BY THE CITY COUNCIL OF THE CITY OF ARDEN HILLS THIS 23rd DAY OF AUGUST, 2021. ___________________________ David Grant, Mayor ATTEST: ___________________________ Julie Hanson, City Clerk Planning Case #21-016 –No Public Hearing Required Applicant: Bethel University Property Location: 3900 Bethel Drive Request: Site Plan Review 1 Overview Request •May 2021 -Bethel University was approved a Conditional Use Permit (CUP) Amendment for stadium field upgrades and scoreboard. •Conditions of the CUP Amendment approval were that a separate permit shall be required for the scoreboard and that prior to replacement of sound system, Bethel University would be required to submit new sound system plans to the City Council for approval. •The Applicant is proposing to convert the existing electronic scoreboard to a LED/Video capable scoreboard with a sound system fully contained within the accessory structure. Deadline for Agency Action •The City of Arden Hills received the completed application for this request on July 20, 2021. Pursuant to Minnesota State Statute, the City must act on this request by September 18, 2021 (60 days), unless the City provides the petitioner with written reasons for an additional 60- day review period. With consent of the applicant, the City may extend the review period beyond the initial 120 days. •Approval with Conditions:Motion to adopt Resolution 2021-048, approving Planning Case 21-016, for Site Plan Review for Bethel University based on the findings of fact, submitted plans, and the August 23, 2021 Report to the City Council, subject to the following conditions: 1)All conditions of the original Conditional Use Permit and Amendments shall remain in full force and effect. 2)That the project shall be completed in accordance with the plans submitted as amended by the conditions of approval. Any significant changes to these plans, as determined by the Senior Planner, shall require review and approval by the Planning Commission and City Council. 3)The proposed structure shall conform to all other regulations in the City Code. 4)A building permit shall be obtained for the proposed scoreboard. 5)That all building and setback requirements shall be met. 6)The scoreboard height shall not exceed 35 feet. 7)That the sound system being installed within the scoreboard shall meet all applicable standards set by the EPA and MPCA. 8)A separate sign permit shall be required and scoreboard signage must meet all requirements of City Code Section 1250. 9)That the scoreboard shall not be used as a dynamic sign to display sponsorship advertising, messages or videos. 10)A Bethel employee shall control the lighting and sound system at the football field. 11)The use of the sound system and lights at the football field be capped at 10:00 PM, except on nights that have a Bethel University sponsored events. 12)That an automatic dimmer module shall be installed to reduce the nighttime light output of the LED lighting of the scoreboard based on ambient light levels. 13)That the applicant shall cooperate with all reasonable requests from the City to modify direction and intensity of light and sound emitted from the scoreboard to mitigate its impact. 14)The Applicant shall be required to provide photometric calculations for the stadium lighting including the LED lighting of the scoreboard at the property lines of all adjacent residential properties indicating the plan meets ordinance requirements. 4 Options and Motion Language •Approval without Conditions: Motion to adopt Resolution 2021-048, approving Planning Case 21-016, for Site Plan Review for Bethel University based on the findings of fact, submitted plans, and the August 23, 2021 Report to the City Council. •Denial:Motion to deny Resolution 2021-048, approving Planning Case 21-016, for Site Plan Review for Bethel University based on the following findings of fact: the City Council should identify findings to deny should specifically reference the reasons for denial and why those reasons cannot be mitigated. •Table:Motion to table Resolution 2021-048, approving Planning Case 21-016, for Site Plan Review for Bethel University for the following reasons: the City Council should identify a specific reason and/or information request should be included with a motion to table. 5 Options and Motion Language Planning Case 21-016 –Bethel University Site Plan Review 6 Questions?